WorldWideScience

Sample records for actinium c

  1. Synthesis and Characterization of the Actinium Aquo Ion

    OpenAIRE

    Maryline G. Ferrier; Benjamin W. Stein; Enrique R. Batista; John M. Berg; Eva R. Birnbaum; Jonathan W. Engle; Kevin D. John; Stosh A. Kozimor; Juan S. Lezama Pacheco; Lindsay N. Redman

    2017-01-01

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H2O) x 3+) is critical for current ef...

  2. Synthesis and Characterization of the Actinium Aquo Ion.

    Science.gov (United States)

    Ferrier, Maryline G; Stein, Benjamin W; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Engle, Jonathan W; John, Kevin D; Kozimor, Stosh A; Lezama Pacheco, Juan S; Redman, Lindsay N

    2017-03-22

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H 2 O) x 3+ ) is critical for current efforts to develop 225 Ac [ t 1/2 = 10.0(1) d] as a targeted anticancer therapeutic agent. However, given the limited amount of actinium available for study and its high radioactivity, many aspects of actinium chemistry remain poorly defined. We overcame these challenges using the longer-lived 227 Ac [ t 1/2 = 21.772(3) y] isotope and report the first characterization of this fundamentally important Ac-aquo coordination complex. Our X-ray absorption fine structure study revealed 10.9 ± 0.5 water molecules directly coordinated to the Ac III cation with an Ac-O H2O distance of 2.63(1) Å. This experimentally determined distance was consistent with molecular dynamics density functional theory results that showed (over the course of 8 ps) that Ac III was coordinated by 9 water molecules with Ac-O H2O distances ranging from 2.61 to 2.76 Å. The data is presented in the context of other actinide(III) and lanthanide(III) aquo ions characterized by XAFS and highlights the uniqueness of the large Ac III coordination numbers and long Ac-O H2O bond distances.

  3. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  4. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  5. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  6. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  7. LaPO4 Nanoparticles Doped with Actinium-225 that Partially Sequester Daughter Radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Woodward, Jonathan [ORNL; Kennel, Steve J [ORNL; Stucnkey, Alan [University of Tennessee, Knoxville (UTK); Osborne, Dustin [University of Tennessee, Knoxville (UTK); Wall, Jonathan [University of Tennessee, Knoxville (UTK); Rondinone, Adam Justin [ORNL; Standaert, Robert F [ORNL; Mirzadeh, Saed [ORNL

    2011-01-01

    Nanoscale materials have been envisioned as carriers for various therapeutic drugs, including radioisotopes. Inorganic nanoparticles (NPs) are particularly appealing vehicles for targeted radiotherapy because they can package several radioactive atoms into a single carrier and can potentially retain daughter radioisotopes produced by in vivo generators such as actinium -225 (225Ac, t1/2=10 d). Decay of this radioisotope to stable bismuth-209 proceeds through a chain of short-lived daughters accompanied by the emission of four -particles that release >27 MeV of energy. The challenge in realizing the enhanced cytotoxic potential of in vivo generators lies in retaining the daughter nuclei at the therapy site. When 225Ac is attached to targeting agents via standard chelate conjugation methods, all of the daughter radionuclides are released after the initial -decay occurs. In this work, 225Ac was incorporated into lanthanum phosphate NPs to determine whether the radioisotope and its daughters would be retained within the dense mineral lattice. Further, the 225Ac-doped NPs were conjugated to the monoclonal antibody mAb 201B, which targets mouse lung endothelium through the vasculature, to ascertain the targeting efficacy and in vivo retention of radioisotopes. Standard biodistribution techniques and microSPECT/CT imaging of 225Ac as well as the daughter radioisotopes showed that the NPs accumulated rapidly in mouse lung after intravenous injection. By showing that excess, competing, uncoupled antibodies or NPs coupled to control mAbs are deposited primarily in the liver and spleen, specific targeting of NP-mAb 201B conjugates was demonstrated. Biodistribution analysis showed that ~30% of the total injected dose of La(225Ac)PO4 NPs accumulated in mouse lungs 1 h post-injection yielding a value of % ID/g >200. Furthermore, after 24 h, 80% of the 213Bi daughter produced from 225Ac decay was retained within the target organ and 213Bi retention increased to ~87% at 120 h. In

  8. The release of dissolved actinium to the ocean: A global comparison of different end-members

    Science.gov (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.

    2008-01-01

    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry

  9. C

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Schouten, S.; Volkman, J.K.

    2014-01-01

    A limited suite of C-27, C-29 and C-30 rearranged hopenes identified as neohop-13(18)-enes have been reported in immature Recent and ancient marine/lacustrine sediments and their presence has been explained by dehydration and isomerisation of ubiquitous hopanols or hopenes. Here we investigated the

  10. Spectroscopy of actinium-215 and (p,t) studies of the stable palladium isotopes

    Science.gov (United States)

    Winkler, Ryan

    2009-12-01

    The study of both the microscopic and macroscopic structural evolution of the atomic nucleus is presented in this work. The excited states of the N = 126 isotone 215Ac were investigated at WNSL using the gas-filled recoil separator SASSYER. Recoil-decay tagging of the gamma rays corresponding to the decay of 215Ac after production via a fusion-evaporation reaction was made possible by using the redesigned SASSYER focal plane apparatus, including the addition of a pair of DSSDs and the multi-wire avalanche counter MACY. A number of transitions feeding the 29/2+ isomeric state corresponding to the ( ph49/2 )⊗(pii13/2) configuration were observed and tentatively assigned as decays from the high-spin 35/2 +, 39/2+, and 41/2+ states. Additionally, the decay from the low-lying 13/2+ state, corresponding to a pii13/2 quasiparticle excitation, was observed at 859 keV. This excitation energy is consistent with the systematics of the lighter N = 126 isotones suggesting a decrease in the energy gap between the pih9/2 and pi i13/2 orbitals. High-resolution (p,t) spectroscopy of the stable, even-even Palladium isotopes was performed in the search for signatures of quantum phase transitional behavior. A total of 54 previously unidentified 0+, 2 +, and 4+ states below an excitation energy of 3.5 MeV were discovered in this experiment. No enhancement of the 0+ level density, a signature of first-order phase transitions in nuclei, was observed in the studied isotopes. A theoretical description of the population strengths of excited 0+ states in two-nucleon transfer reactions was investigated within the framework of the IBM. These studies reveal that an enhanced population strength is not exclusive to regions of shape-coexistence but rather is a measure of the magnitude of the "change of structure" from the initial to residual nucleus.

  11. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  12. Simultaneous Separation of Actinium and Radium Isotopes from a Proton Irradiated Thorium Matrix.

    Science.gov (United States)

    Mastren, Tara; Radchenko, Valery; Owens, Allison; Copping, Roy; Boll, Rose; Griswold, Justin R; Mirzadeh, Saed; Wyant, Lance E; Brugh, Mark; Engle, Jonathan W; Nortier, Francois M; Birnbaum, Eva R; John, Kevin D; Fassbender, Michael E

    2017-08-15

    A new method has been developed for the isolation of (223,224,225)Ra, in high yield and purity, from a proton irradiated (232)Th matrix. Herein we report an all-aqueous process using multiple solid-supported adsorption steps including a citrate chelation method developed to remove >99.9% of the barium contaminants by activity from the final radium product. A procedure involving the use of three columns in succession was developed, and the separation of (223,224,225)Ra from the thorium matrix was obtained with an overall recovery yield of 91 ± 3%, average radiochemical purity of 99.9%, and production yields that correspond to physical yields based on previously measured excitation functions.

  13. Hepatite C Hepatitis C

    Directory of Open Access Journals (Sweden)

    Edna Strauss

    2001-02-01

    Full Text Available Estima-se que cerca de 3% da população mundial esteja infectada pelo vírus da hepatite C. Todos os que receberam transfusão de sangue ou seus componentes e os usuários de drogas podem estar infectados. Procedimentos odontológicos, médicos, tatuagem ou acupuntura também constituem fatores de risco. A infecção se cronifica em até 85% dos indivíduos, com evolução assintomática durante anos ou décadas e apresentação clínica variada. Para o diagnóstico, a determinação do anti-VHC revela-se muito sensível e a confirmação se faz pela determinação do RNA-VHC no sangue; o estadiamento da doença e a avaliação da atividade inflamatória pela biópsia hepática. O tratamento objetiva deter a progressão da doença hepática através da inibição da replicação viral. Devido à baixa eficácia terapêutica aliada a importantes efeitos colaterais do interferon e da ribavirina, esses medicamentos encontram indicações e contra-indicações específicas. Vários fatores preditivos de resposta ao tratamento, principalmente a carga viral e o genótipo do VHC, mostram-se úteis na avaliação dos pacientes.It has been estimated that 3% of the world population is infected with the hepatitis C virus. Those who are blood product recipients or have been illicit drug users are at risk. Dental and medical procedures as well as tattooing and acupuncture are also risk factors. Chronic infection occurs in up to 85% of infected cases but they may remain without symptoms during years or even decades, and clinical presentation varies. Determination of anti-HCV in sera is a fairly sensitive tool for the diagnosis, and confirmation requires the identification of HCV-RNA. Staging of the liver disease as well as definition of its present activity can be graded by liver biopsy. The aim of treatment is to stop the progression of the hepatic disease by inhibiting viral replication. Due to the low therapeutic efficacy combined with important side

  14. Beginning C

    CERN Document Server

    Horton, Ivor

    2013-01-01

    Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

  15. Vitamin C

    Science.gov (United States)

    Vitamins are substances that your body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for ... promotes healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources ...

  16. Hepatitis C

    Science.gov (United States)

    ... especially important for people who are showing signs liver fibrosis or scarring. Medicines used to treat hepatitis C ... Association for the Study of Liver Diseases. Diagnosis, management, and treatment of hepatitis C: an update. Hepatology . ...

  17. Hepatitis C

    Science.gov (United States)

    ... Doctors treat hepatitis C with antiviral medicines that attack the virus and can cure the disease in most cases. ... Doctors treat hepatitis C with antiviral medicines that attack the virus. You may need to take medicines for 12 ...

  18. Hepatitis C

    Science.gov (United States)

    ... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

  19. Professional C++

    CERN Document Server

    Gregoire, Marc; Kleper, Scott J

    2011-01-01

    Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

  20. Balanced {C_4, C_5}-Quatrefoil Systems

    OpenAIRE

    Ushio, Kazuhiko

    2004-01-01

    In graph theory, the decomposition problems of graphs are very important topics. Various types of decompositions of many graphs can be seen in the literature of gaph theory. We give the necessary and sufficient condition for the existence of a balanced {C_4, C_5}-quatrefoil decomposition of K_n for each of (C_4, C_4, C_4, C_4)-quatrefoil, (C_4, C_4, C_4, C_5)-quatrefoil, (C_4, C_4, C_5, C_5)-quatrefoil, (C_4, C_5, C_5, C_5)-quatrefoil, and (C_5, C_5, C_5, C_5)-quatrefoil. These decompositions...

  1. Professional C++

    CERN Document Server

    Gregoire, Marc

    2014-01-01

    Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,

  2. C++ Cookbook

    CERN Document Server

    Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff

    2006-01-01

    Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't

  3. -C Refractories

    Science.gov (United States)

    Xu, Yibiao; Sang, Shaobai; Li, Yawei; Ren, Bo; Zhao, Lei; Li, Yuanbing; Li, Shujing

    2014-06-01

    Al2O3-C refractories were first fabricated in a coke bed at 1673 K (1400 °C) using tabular corundum, reactive alumina, carbon black, silicon, and microsilica as the starting materials and phenol resin as the binder. Then the alkali attack resistance of those materials was conducted in the powder mixture of carbon black and potassium carbonate (1:1 wt pct) in a graphite crucible at 1273 K (1000 °C) for 10 hours. The correlation between pore size, permeability of Al2O3-C refractories, and their alkali (K2CO3) attack was investigated by means of mercury intrusion porosimetry, X-ray diffraction (XRD), and scanning electron microscopy (SEM). The results showed that the pore structure of Al2O3-C refractories was controlled by the addition of silicon, ultrafine reactive alumina, and microsilica to in-situ form SiC whiskers and mullite in the preparation process. The mean pore size of Al2O3-C refractories was strongly associated with permeability. With the decrease of the mean pore size, the permeability of the Al2O3-C refractories reduced constantly. The alkali attack test also verified that the Al2O3-C refractories with lower permeability had better alkali corrosion resistance, because the penetration of K vapor into the materials could be restricted effectively. The corrosion mechanism of Al2O3-C refractories supposes that (1) K2CO3 was reduced to K vapor and penetrated into the specimen through the open pores and (2) K vapor reacted with SiC, SiO2, and alumina to form KAlSi2O6 and KAlSiO4, which is in agreement with the thermodynamic prediction.

  4. C Shivakumara

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Shivakumara. Articles written in Bulletin of Materials Science. Volume 29 Issue 4 August 2006 pp 339-345 Ceramics and Glasses. Solution-combustion synthesis of Bi1–LnO1.5 (Ln = Y and La–Yb) oxide ion conductors · Manjunath B Bellakki A S Prakash C Shivakumara ...

  5. Vitamin C

    Science.gov (United States)

    ... to stomach upset and diarrhea. Large doses of vitamin C supplementation are not recommended during pregnancy. They can lead ... gov/pubmed/23440782 . Institute of Medicine. Food and Nutrition Board. Dietary Reference Intakes for Vitamin C, Vitamin E, Selenium, and Carotenoids. National Academies ...

  6. Buckyball C

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Buckyball C60 – The Story so Far… Amritanshu Sinha. General Article Volume 6 Issue 3 ... Author Affiliations. Amritanshu Sinha1. C/o Prof, Pradeep Mathur, Chemistry Department, Indian Institute of Technology Powai, Mumbai 400076, India.

  7. C Ramakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C Ramakrishnan. Articles written in Resonance – Journal of Science Education. Volume 6 Issue 10 October 2001 pp 48-56 General Article. Ramachandran and his Map · C Ramakrishnan · More Details Fulltext PDF. Volume 13 Issue 1 January 2008 pp 89-98 ...

  8. C Balaji

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C Balaji. Articles written in Journal of Earth System Science. Volume 118 Issue 4 August 2009 pp 331-343. Polarized microwave forward model simulations for tropical storm Fanoos · C Balaji M Deiveegan S P Venkateshan R M Gairola A Sarkar V K Agarwal · More Details ...

  9. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  10. Syntheses of the C1-C14 and C15-C25 fragments of amphidinolide C.

    Science.gov (United States)

    Wu, Dimao; Forsyth, Craig J

    2013-03-15

    Divergent syntheses of the C1-C14 and C15-C25 fragments of amphidinolide C have been achieved. The synthesis of the C15-C25 fragment featured cobalt-catalyzed modified Mukaiyama aerobic alkenol cyclization and sulfur-directed regiocontrolled Wacker oxidation of an internal alkene. The C1-C14 fragment was established by alkenyllithium addition to an aldehyde followed by a challenging olefination of a highly inert C9 ketone.

  11. Advanced C and C++ compiling

    CERN Document Server

    Stevanovic, Milan

    2014-01-01

    Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

  12. Hall C

    Data.gov (United States)

    Federal Laboratory Consortium — Hall C's initial complement of equipment (shown in the figure), includes two general-purpose magnetic spectrometers. The High Momentum Spectrometer (HMS) has a large...

  13. Hepatitis C

    Science.gov (United States)

    ... Weight loss Confusion, drowsiness and slurred speech (hepatic encephalopathy) Spider-like blood vessels on your skin (spider angiomas) Every chronic hepatitis C infection starts with an acute phase. ...

  14. Tetrafibricin: synthesis of the C1-C13, C15-C25, and C27-C40 fragments.

    Science.gov (United States)

    BouzBouz, Samir; Cossy, Janine

    2004-09-30

    [structure: see text] A sequence of chemoselective cross-metathesis reactions and enantioselective allyltitanations of aldehydes has been used to prepare the C1-C13, C15-C26, and C27-C40 fragments of tetrafibricin.

  15. Vitamina C

    Directory of Open Access Journals (Sweden)

    Manela-Azulay Mônica

    2003-01-01

    Full Text Available Há muito o papel do ácido ascórbico (AA no metabolismo do tecido conjuntivo tem sido reconhecido, sobretudo a partir do século 16, quando o escorbuto começou a ser prevenido com sumo de frutas cítricas. As primeiras publicações referentes ao uso tópico da vitamina C, inicialmente em cobaio, datam da década de 1960. Entretanto, só mais recentemente tem-se dado valor a essa via de aplicação. Os autores apresentam revisão sobre o assunto, discorrendo sobre o histórico da vitamina C, seus efeitos no metabolismo do tecido conjuntivo, no processo de cicatrização, sobre sua atividade antioxidante e mecanismos de ação.

  16. Agaba, C

    African Journals Online (AJOL)

    Agaba, C. Vol 4, No 1 (2009) - Articles The impact of advocacy and community mobilization on the utilization of health services at the Comprehensive Health Centre, Gindiri. Abstract PDF. ISSN: 2006-0734. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...

  17. C. cosym.

    African Journals Online (AJOL)

    sliade in a completely randomized design witli 5 replicates in 3 rows and 5 columlis at a spacing of 20 cm within rows and between rows. Observations were made ... nitrogen arid stored in a Freezer at -20 OC-until anaiyzed. Gas Cltromatography. Gas cli~~omatnprapli~c (GC) analysis were conducted on a Hewlett Packard ...

  18. Hepatitis C

    Science.gov (United States)

    ... liver diseases like hepatitis C. An occasional alcoholic drink may be okay, but check with your doctor first.What are the side ... family doctor to find out if this information applies to you and to get more information on ... Urticaria Check Your Symptoms Find out what else could be ...

  19. C 1

    Science.gov (United States)

    Nguyen, Thien; Karčiauskas, Kęstutis; Peters, Jörg

    2016-01-01

    Geometrically continuous ( G k ) constructions naturally yield families of finite elements for isogeometric analysis (IGA) that are C k also for non-tensor-product layout. This paper describes and analyzes one such concrete C 1 geometrically generalized IGA element (short: gIGA element) that generalizes bi-quadratic splines to quad meshes with irregularities. The new gIGA element is based on a recently-developed G 1 surface construction that recommends itself by its a B-spline-like control net, low (least) polynomial degree, good shape properties and reproduction of quadratics at irregular (extraordinary) points. Remarkably, for Poisson's equation on the disk using interior vertices of valence 3 and symmetric layout, we observe O ( h 3 ) convergence in the L ∞ norm for this family of elements. Numerical experiments confirm the elements to be effective for solving the trivariate Poisson equation on the solid cylinder, deformations thereof (a turbine blade), modeling and computing geodesics on smooth free-form surfaces via the heat equation, for solving the biharmonic equation on the disk and for Koiter-type thin-shell analysis.

  20. Stereoselective Synthesis of the C1-C9 and C11-C25 Fragments of Amphidinolides C, C2, C3, and F.

    Science.gov (United States)

    Akwaboah, Daniel C; Wu, Dimao; Forsyth, Craig J

    2017-03-03

    An efficient synthesis of the C1-C9 and the C11-C25 fragments of amphidinolides C, C2, C3, and F from a common intermediate is reported. The construction of the C1-C9 fragment involves an intramolecular hetero-Michael cyclization to form the 3,5-disubstituted trans-tetrahydrofuran moiety. The approach to prepare the C11-C25 fragment utilizes a highly stereoselective aerobic cobalt-catalyzed alkenol cyclization and a chelated Mukaiyama aldol reaction to form the C13-C14 bond and to concomitantly install the C13 hydroxyl group.

  1. Programming C# Building NET Applications with C#

    CERN Document Server

    Liberty, Jesse

    2009-01-01

    Programming C#, the top-selling book on Microsoft's high-performance C# programming language, is now in its fourth edition. Aimed at experienced programmers and web developers, this comprehensive guide focuses on the features and programming patterns that are unique to C#, and fundamental to the programming of web services and web applications on Microsoft's .NET platform.

  2. Accelerated C# 2010

    CERN Document Server

    Nash, Trey

    2010-01-01

    C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

  3. Dicty_cDB: AFI624 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YKMHYSIKIHNIKAYDLSLKKENHNANNINIDPYVKL KFDQFKKFKTESISKSITPTWKFEQTFHIPIMKDQDLKNKKVEIDCYDSCVIGGDNLIGG C...YKMHYSIKIHNIKAYDLSLKKENHNANNINIDPYVKL KFDQFKKFKTESISKSITPTWKFEQTFHIPIMKDQDLKNKKVEIDCYDSCVIGGDNLIGG C

  4. Dicty_cDB: SHL331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LPSTVKKLHLERCTGLTNVTQKLPPYDYLEIITFSSD TFIFYMSWIQNIKEFYFYNVEFPYTLNTTFVTDFENIENYTRLDYMGFSTNEIPDLTGFS C...LPSTVKKLHLERCTGLTNVTQKLPPYDYLEIITFSSD TFIFYMSWIQNIKEFYFYNVEFPYTLNTTFVTDFENIENYTRLDYMGFSTNEIPDLTGFS C

  5. Hepatitis C: Treatment

    Science.gov (United States)

    ... Public Home » Hepatitis C » Hepatitis C Treatment Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... Enter ZIP code here Enter ZIP code here Hepatitis C Treatment for Veterans and the Public Treatment ...

  6. Travelers' Health: Hepatitis C

    Science.gov (United States)

    ... Chapter 3 - Hepatitis B Chapter 3 - Hepatitis E Hepatitis C Deborah Holtzman INFECTIOUS AGENT Hepatitis C virus ( ... mother to child. Map 3-05. Prevalence of hepatitis C virus infection 1 PDF Version (printable) 1 ...

  7. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  8. Photosynthesis of C3, C3-C4, and C4 grasses at glacial CO2.

    Science.gov (United States)

    Pinto, Harshini; Sharwood, Robert E; Tissue, David T; Ghannoum, Oula

    2014-07-01

    Most physiology comparisons of C3 and C4 plants are made under current or elevated concentrations of atmospheric CO2 which do not reflect the low CO2 environment under which C4 photosynthesis has evolved. Accordingly, photosynthetic nitrogen (PNUE) and water (PWUE) use efficiency, and the activity of the photosynthetic carboxylases [Rubisco and phosphoenolpyruvate carboxylase (PEPC)] and decarboxylases [NADP-malic enzyme (NADP-ME) and phosphoenolpyruvate carboxykinase (PEP-CK)] were compared in eight C4 grasses with NAD-ME, PCK, and NADP-ME subtypes, one C3 grass, and one C3-C4 grass grown under ambient (400 μl l(-1)) and glacial (180 μl l(-1)) CO2. Glacial CO2 caused a smaller reduction of photosynthesis and a greater increase of stomatal conductance in C4 relative to C3 and C3-C4 species. Panicum bisulcatum (C3) acclimated to glacial [CO2] by doubling Rubisco activity, while Rubisco was unchanged in Panicum milioides (C3-C4), possibly due to its high leaf N and Rubisco contents. Glacial CO2 up-regulated Rubisco and PEPC activities in concert for several C4 grasses, while NADP-ME and PEP-CK activities were unchanged, reflecting the high control exerted by the carboxylases relative to the decarboxylases on the efficiency of C4 metabolism. Despite having larger stomatal conductance at glacial CO2, C4 species maintained greater PWUE and PNUE relative to C3-C4 and C3 species due to higher photosynthetic rates. Relative to other C4 subtypes, NAD-ME and PEP-CK grasses had the highest PWUE and PNUE, respectively; relative to C3, the C3-C4 grass had higher PWUE and similar PNUE at glacial CO2. Biomass accumulation was reduced by glacial CO2 in the C3 grass relative to the C3-C4 grass, while biomass was less reduced in NAD-ME grasses compared with NADP-ME and PCK grasses. Under glacial CO2, high resource use efficiency offers a key evolutionary advantage for the transition from C3 to C4 photosynthesis in water- and nutrient-limited environments. © The Author 2014

  9. Seminario C++, parte 1

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Clases en C++. Operaciones set/get/is. Tipo Referencia (&). El puntero 'this'. Los constructores. El destructor.

  10. Facts about Vitamin C

    Science.gov (United States)

    Facts about Vitamin C 1 Linda B. Bobroff and Isabel Valentín-Oquendo 2 FCS8702 Why do we need vitamin C? Vitamin C, also known as ascorbic acid, has a ... keep body tissues and the immune system healthy. Vitamin C also helps the body absorb iron from ...

  11. A generalized stoichiometric model of C3, C2, C2+C4, and C4 photosynthetic metabolism.

    OpenAIRE

    Bellasio, C.

    2016-01-01

    The goal of suppressing photorespiration in crops to maximize assimilation and yield is stimulating considerable interest among researchers looking to bioengineer carbon-concentrating mechanisms into C3 plants. However, detailed quantification of the biochemical activities in the bundle sheath is lacking. This work presents a general stoichiometric model for C3, C2, C2+C4, and C4 assimilation (SMA) in which energetics, metabolite traffic, and the different decarboxylating enzymes (NAD-depende...

  12. Practical C++ Programming

    CERN Document Server

    Oualline, Steve

    2003-01-01

    C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th

  13. Objective-C

    CERN Document Server

    DeVoe, Jiva

    2011-01-01

    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  14. Exploring C++ 11

    CERN Document Server

    Lischner, Ray

    2014-01-01

    Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat

  15. C++ for dummies

    CERN Document Server

    Davis , Stephen R

    2014-01-01

    The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new

  16. C++ Programming Language

    Science.gov (United States)

    Shaykhian, Gholam Ali

    2007-01-01

    C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.

  17. A generalized stoichiometric model of C3, C2, C2+C4, and C4 photosynthetic metabolism.

    Science.gov (United States)

    Bellasio, Chandra

    2017-01-01

    The goal of suppressing photorespiration in crops to maximize assimilation and yield is stimulating considerable interest among researchers looking to bioengineer carbon-concentrating mechanisms into C3 plants. However, detailed quantification of the biochemical activities in the bundle sheath is lacking. This work presents a general stoichiometric model for C3, C2, C2+C4, and C4 assimilation (SMA) in which energetics, metabolite traffic, and the different decarboxylating enzymes (NAD-dependent malic enzyme, NADP-dependent malic enzyme, or phosphoenolpyruvate carboxykinase) are explicitly included. The SMA can be used to refine experimental data analysis or formulate hypothetical scenarios, and is coded in a freely available Microsoft Excel workbook. The theoretical underpinnings and general model behaviour are analysed with a range of simulations, including (i) an analysis of C3, C2, C2+C4, and C4 in operational conditions; (ii) manipulating photorespiration in a C3 plant; (iii) progressively upregulating a C2 shuttle in C3 photosynthesis; (iv) progressively upregulating a C4 cycle in C2 photosynthesis; and (v) manipulating processes that are hypothesized to respond to transient environmental inputs. Results quantify the functional trade-offs, such as the electron transport needed to meet ATP/NADPH demand, as well as metabolite traffic, inherent to different subtypes. The SMA refines our understanding of the stoichiometry of photosynthesis, which is of paramount importance for basic and applied research. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  18. Hepatitis C: Clinical Trials

    Science.gov (United States)

    ... and Public Home » Hepatitis C » Treatment Decisions Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... can I find out about participating in a hepatitis C clinical trial? Many trials are being conducted ...

  19. SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

  20. C-TOOL

    DEFF Research Database (Denmark)

    Taghizadeh-Toosi, Arezoo; Christensen, Bent Tolstrup; Hutchings, Nicholas John

    2014-01-01

    Soil organic carbon (SOC) is a significant component of the global carbon (C) cycle. Changes in SOC storage affect atmospheric CO2 concentrations on decadal to centennial timescales. The C-TOOL model was developed to simulate farm- and regional-scale effects of management on medium- to long......-term SOC storage in the profile of well-drained agricultural mineral soils. C-TOOL uses three SOC pools for both the topsoil (0–25 cm) and the subsoil (25–100 cm), and applies temperature-dependent first order kinetics to regulate C turnover. C-TOOL also enables the simulation of 14C turnover. The simple...... model structure facilitates calibration and requires few inputs (mean monthly air temperature, soil clay content, soil C/N ratio and C in organic inputs). The model was parameterised using data from 19 treatments drawn from seven long-term field experiments in the United Kingdom, Sweden and Denmark...

  1. Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

    DEFF Research Database (Denmark)

    Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

    1997-01-01

    This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

  2. C P Anil Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C P Anil Kumar. Articles written in Journal of Earth System Science. Volume 124 Issue 8 December 2015 pp 1721-1733. Variation of surface electric field during geomagnetic disturbed period at Maitri, Antarctica · N Jeni Victor C Panneerselvam C P Anil Kumar.

  3. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C

  4. T C Pandya

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. T C Pandya. Articles written in Bulletin of Materials Science. Volume 25 Issue 1 February 2002 pp 63-67 Metals and Alloys. Volume variation of Gruneisen parameters of fcc transition metals · C V Pandya P R Vyas T C Pandya V B Gohel · More Details Abstract Fulltext PDF.

  5. C-Peptide Test

    Science.gov (United States)

    ... Weisenberger, J. (2013 March) Why Does a C-Peptide Test Matter? Diabetes Forecast [On-line information]. Available online at http:// ... Updated). What is c-peptide? What do c-peptide levels mean? Misc.health.diabetes, diabetes FAQ [On-line information from newsgroup]. Available ...

  6. c-Map as c=1 string

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrov, Sergei, E-mail: Sergey.Alexandrov@univ-montp2.fr [Universite Montpellier 2 and CNRS, Laboratoire Charles Coulomb UMR 5221, F-34095, Montpellier (France)

    2012-10-01

    We show the existence of a duality between the c-map space describing the universal hypermultiplet at tree level and the matrix model description of two-dimensional string theory compactified at a self-dual radius and perturbed by a sine-Liouville potential. It appears as a particular case of a general relation between the twistor description of four-dimensional quaternionic geometries and the Lax formalism for Toda hierarchy. Furthermore, we give an evidence that the instanton corrections to the c-map metric coming from NS5-branes can be encoded into the Baker-Akhiezer function of the integrable hierarchy.

  7. Learning C# 30

    CERN Document Server

    Liberty, Jesse

    2008-01-01

    If you're new to C#, Learning C# 3.0 is the ideal way to get started. Learning C# 3.0 starts with the fundamentals and takes you through intermediate and advanced C# features-including generics, interfaces, delegates, lambda expressions, and LINQ. You'll also learn how to build Windows applications and handle data with C#. Each chapter offers a self-contained lesson with plenty of annotated examples, illustrations, and a concise summary. No previous programming experience is required.

  8. Using C-Kermit

    CERN Document Server

    da Cruz, Frank

    2014-01-01

    An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced

  9. Head first C#

    CERN Document Server

    Stellman, Andrew

    2008-01-01

    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  10. Vitamin C and Infections

    Science.gov (United States)

    Hemilä, Harri

    2017-01-01

    In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose–response, for the duration of common cold symptoms, with up to 6–8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3–4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further. PMID:28353648

  11. Vitamin C and Infections

    Directory of Open Access Journals (Sweden)

    Harri Hemilä

    2017-03-01

    Full Text Available In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose–response, for the duration of common cold symptoms, with up to 6–8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3–4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  12. Vitamin C and Infections.

    Science.gov (United States)

    Hemilä, Harri

    2017-03-29

    In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose-response, for the duration of common cold symptoms, with up to 6-8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3-4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  13. Dicty_cDB: CHS486 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ieviveveaevevevevdlivgmdiidiaieeeeeeeeekvtvevdqevivevgvevvqg kdiieeetiikeetiiitttnhhhhlkamnlqiy*c*k... ieviveveaevevevevdlivgmdiidiaieeeeeeeeekvtvevdqevivevgvevvqg kdiieeetiikeetiiitttnhhhhlkamnlqiy*c*k

  14. Hemoglobin C, S-C, and E Diseases

    Science.gov (United States)

    ... more quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in ... are a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people ...

  15. Parylene C Aging Studies.

    Energy Technology Data Exchange (ETDEWEB)

    Achyuthan, Komandoor; Sawyer, Patricia Sue.; Mata, Guillermo Adrian; White II, Gregory Von; Bernstein, Robert

    2014-09-01

    Parylene C is used in a device because of its conformable deposition and other advantages. Techniques to study Parylene C aging were developed, and "lessons learned" that could be utilized for future studies are the result of this initial study. Differential Scanning Calorimetry yielded temperature ranges for Parylene C aging as well as post-deposition treatment. Post-deposition techniques are suggested to improve Parylene C performance. Sample preparation was critical to aging regimen. Short-term (%7E40 days) aging experiments with free standing and ceramic-supported Parylene C films highlighted "lessons learned" which stressed further investigations in order to refine sample preparation (film thickness, single sided uniform coating, machine versus laser cutting, annealing time, temperature) and testing issues ("necking") for robust accelerated aging of Parylene C.

  16. Interstellar C60+

    OpenAIRE

    Berne, Olivier; Mulas, Giacomo; Joblin, Christine

    2012-01-01

    Buckminsterfullerene (C60) was recently detected through its infrared emission bands in the interstellar medium (ISM), including in the proximity of massive stars, where physical conditions could favor the formation of the cationic form, C60+. In addition, C60+ was proposed as the carrier of two diffuse interstellar bands in the near-IR, although a firm identification still awaits for gas-phase spectroscopic data. We examined in details the Spitzer IRS spectra of the NGC 7023 reflection nebul...

  17. Seminario C++, parte 2

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. El compilador g++. Directivas de compilación. Make. Doxygen. Utilidad de compresión 'tar'. Introducción a UML. Ejercicio práctico.

  18. Seminario C++, parte 4

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Herencia simple. El destructor abstracto. Patrón de diseño singleton. Tipos enumerados. Declaraciones forward. Conversión entre objetos (upcasting/downcasting).

  19. Seminario C++, parte 3

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Funciones amigas. Entrada / Salida. Sobrecarga de funciones y operadores. Gestión de memoria dinámica. Atributos y métodos de clase. Implementación de relaciones entre objetos.

  20. C# Database Basics

    CERN Document Server

    Schmalz, Michael

    2012-01-01

    Working with data and databases in C# certainly can be daunting if you're coming from VB6, VBA, or Access. With this hands-on guide, you'll shorten the learning curve considerably as you master accessing, adding, updating, and deleting data with C#-basic skills you need if you intend to program with this language. No previous knowledge of C# is necessary. By following the examples in this book, you'll learn how to tackle several database tasks in C#, such as working with SQL Server, building data entry forms, and using data in a web service. The book's code samples will help you get started

  1. Programming C# 40

    CERN Document Server

    Griffiths, Ian; Liberty, Jesse

    2010-01-01

    With its support for dynamic programming, C# 4.0 continues to evolve as a versatile language on its own. But when C# is used with .NET Framework 4, the combination is incredibly powerful. This bestselling tutorial shows you how to build web, desktop, and rich Internet applications using C# 4.0 with .NET's database capabilities, UI framework (WPF), extensive communication services (WCF), and more. In this sixth edition, .NET experts Ian Griffiths, Matthew Adams, and Jesse Liberty cover the latest enhancements to C#, as well as the fundamentals of both the language and framework. You'll learn

  2. Stool C difficile toxin

    Science.gov (United States)

    Antibiotic associated colitis - toxin; Colitis - toxin; Pseudomembranous - toxin; Necrotizing colitis - toxin; C difficile - toxin ... not recently taken antibiotics. This condition is called pseudomembranous colitis .

  3. A PCR-RFLP assay for the detection and differentiation of Campylobacter jejuni, C. coli, C. fetus, C. hyointestinalis, C. lari, C. helveticus and C. upsaliensis.

    Science.gov (United States)

    Kamei, Kazumasa; Asakura, Masahiro; Somroop, Srinuan; Hatanaka, Noritoshi; Hinenoya, Atsushi; Nagita, Akira; Misawa, Naoaki; Matsuda, Motoo; Nakagawa, Shinsaku; Yamasaki, Shinji

    2014-05-01

    Although Campylobacter jejuni and Campylobacter coli are the most common bacterial causes of human gastrointestinal diseases, other Campylobacter species are also involved in human and animal infections. In this study, we developed a cytolethal distending toxin (cdt) gene-based PCR-RFLP assay for the detection and differentiation of C. jejuni, C. coli, C. fetus, C. hyointestinalis, C. lari, C. helveticus and C. upsaliensis. Previously designed common primers, which can amplify the cdtB gene of C. jejuni, C. coli and C. fetus, were used for detecting seven Campylobacter species and differentiating between them by restriction digestion. The PCR-RFLP assay was validated with 277 strains, including 35 C. jejuni, 19 C. coli, 20 C. fetus, 24 C. hyointestinalis, 13 C. lari, 2 C. helveticus, 22 C. upsaliensis, 3 other Campylobacter spp. and 17 other species associated with human diseases. Sensitivity and specificity of the PCR-RFLP assay were 100 % except for C. hyointestinalis (88 % sensitivity). Furthermore, the PCR-RFLP assay successfully detected and differentiated C. jejuni, C. coli and C. fetus in clinical and animal samples. The results indicate that the PCR-RFLP assay is useful for the detection and differentiation of seven Campylobacter species important for human and animal diseases.

  4. C V Subramanian

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C V Subramanian. Articles written in Resonance – Journal of Science Education. Volume 12 Issue 6 June 2007 pp 4-9 General Article. Edavaleth Kakkat Janaki Ammal · C V Subramanian · More Details Fulltext PDF ...

  5. C V Sundaram

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C V Sundaram. Articles written in Resonance – Journal of Science Education. Volume 2 Issue 2 February 1997 pp 83-84 Classroom. Cadmium bars by · C V Sundaram · More Details Fulltext PDF ...

  6. Charu C Pant

    Indian Academy of Sciences (India)

    Tectonic controls on the geomorphic evolution of alluvial fans in the Piedmont Zone of Ganga Plain, Uttarakhand, India · Pradeep K Goswami Charu C Pant ... Geomorphological features of active tectonics and ongoing seismicity of northeastern Kumaun Himalaya, Uttarakhand, India · Vivekanand Pathak Charu C Pant ...

  7. R C Mittal

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. R C Mittal. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 12 December 2000 pp 26-33 General Article. Space-Filling Curves · R C Mittal · More Details Fulltext PDF ...

  8. R C Agarwala

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. R C Agarwala. Articles written in Sadhana. Volume 28 Issue 3-4 June-August 2003 pp 475-493. Electroless alloy/composite coatings: A review · R C Agarwala Vijaya Agarwala · More Details Abstract Fulltext PDF. Since the inception of electroless coating by Brenner & Riddell in 1946, it has been ...

  9. C S Yogananda

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C S Yogananda. Articles written in Resonance – Journal of Science Education. Volume 1 Issue 1 January 1996 pp 71-79 General Article. Fermat's Last Theorem A Theorem at Last! C S Yogananda · More Details Fulltext PDF. Volume 2 Issue 5 May 1997 pp 3-3 ...

  10. olivier c. martin

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. OLIVIER C. MARTIN. Articles written in Journal of Genetics. Volume 96 Issue 5 November 2017 pp 795-800 HALDANE AT 125. Haldane, Waddington and recombinant inbred lines: extension of their work to any number of genes · AREEJIT SAMAL OLIVIER C. MARTIN · More Details ...

  11. C*-algebras

    Science.gov (United States)

    Bär, Christian; Becker, Christian

    In this chapter we will collect those basic concepts and facts related to C*-algebras that will be needed later on. We give complete proofs. In Sects. 1, 2, 3, and 6 we follow closely the presentation in [1]. For more information on C*-algebras, see, e.g. [2-6].

  12. Mangal C Mahato

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Mangal C Mahato. Articles written in Resonance – Journal of Science Education. Volume 8 Issue 7 July 2003 pp 33-45 General Article. Noise Assisted Directed Motion at the Molecular Level – 1 · Mangal C Mahato A M Jayannavar · More Details Fulltext PDF.

  13. C N R Rao

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C N R Rao. Articles written in Resonance – Journal of Science Education. Volume 7 Issue 3 March 2002 pp 2-5 Article-in-a-Box. Tribute to Michael Faraday · C N R Rao · More Details Fulltext PDF. Volume 14 Issue 5 May 2009 pp 508-517 Reflections. Chemistry ...

  14. C N R Rao

    Indian Academy of Sciences (India)

    C N R Rao. Articles written in Journal of Chemical Sciences. Volume 112 Issue 2 April 2000 pp 83-95 Physical and Theoretical. An indigenous cluster beam apparatus with a reflectron time-of-flight mass spectrometer · G Raina G U Kulkarni R T Yadav V S Ramamurthy C N R Rao · More Details Abstract Fulltext PDF.

  15. Learning Boost C++ libraries

    CERN Document Server

    Mukherjee, Arindam

    2015-01-01

    If you are a C++ programmer who has never used Boost libraries before, this book will get you up-to-speed with using them. Whether you are developing new C++ software or maintaining existing code written using Boost libraries, this hands-on introduction will help you decide on the right library and techniques to solve your practical programming problems.

  16. Hepatitis C and Incarceration

    Science.gov (United States)

    ... Hepatitis C virus can be spread when tattoo, body art, or piercing equipment has tiny amounts of blood on it. Many people get tattoos, piercings, or other marks ... if the Hepatitis C virus is still in the body. If this test is positive, it means a ...

  17. C M K Nair

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.

  18. C. S. Stalin

    Indian Academy of Sciences (India)

    Tracking Galaxy Evolution Through Low-Frequency Radio Continuum Observations using SKA and Citizen-Science Research using Multi-Wavelength Data · Ananda Hota C. Konar C. S. Stalin Sravani Vaddi Pradeepta K. Mohanty Pratik Dabhade Sai Arun Dharmik Bhoga Megha Rajoria Sagar Sethi · More Details Abstract ...

  19. C R Gautam

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C R Gautam. Articles written in Bulletin of Materials Science. Volume 33 Issue 2 April 2010 pp 145-148 Ceramics and Glasses. IR study of Pb–Sr titanate borosilicate glasses · C R Gautam Devendra Kumar Om Parkash · More Details Abstract Fulltext PDF. The infrared spectra ...

  20. PRO-C3

    DEFF Research Database (Denmark)

    Hansen, Janne Fuglsang; Juul Nielsen, Mette; Nyström, Kristina

    2018-01-01

    OBJECTIVE: Detecting significant fibrosis and cirrhosis remains important in treatment and follow-up of patients with chronic hepatitis C Infection (CHC). The aim of this study was to assess the ability of PRO-C3 to identify significant fibrosis (Ishak score ≥3) and cirrhosis (Ishak score ≥5) bot...

  1. S C Girimaji

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. S C Girimaji. Articles written in Journal of Biosciences. Volume 26 Issue 3 September 2001 pp 285-287. Clipboard: Tuberous sclerosis complex: A Drosophila connection · Arun Kumar S C Girimaji · More Details Fulltext PDF. Volume 27 Issue 7 December 2002 pp 629-632.

  2. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor

    2009-01-01

    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the ...... bit key for a known S-box can be done in complexity 2^48. Finally, a C2 implementation with a 8 to 8 bit secret S-box (equivalent to 2048 secret bits) and a 56 bit secret key can be attacked in 2^53.5 C2 encryptions on average....

  3. C++ multithreading cookbook

    CERN Document Server

    Ljumovic, Milos

    2014-01-01

    The book is an easy-to-follow guide for creating multi-threaded applications using C++. Each topic is thoroughly explained with multiple illustrations. Many algorithms, such as Dinning Philosophers Problem give you thorough explanations that will help you to understand and solve concurrent tasks. The book is intended for enterprise developers and programmers who wish to make use of C++ capabilities to learn the multithreaded approach. Knowledge of multithreading along with experience in C++ is an added advantage. However it is not a prerequisite.

  4. Beginning Visual C# 2010

    CERN Document Server

    Watson, Karli; Pedersen, Jacob Hammer

    2010-01-01

    Update to Wrox's leading C# book for beginners. Get ready for the next release of Microsoft's C# programming language with this essential Wrox beginner's guide. Beginning Microsoft Visual C# 2010 starts with the basics and brings you thoroughly up to speed. You'll first cover the fundamentals such as variables, flow control, and object-oriented programming and gradually build your skills for Web and Windows programming, Windows forms, and data access. Step-by-step directions walk you through processes and invite you to "Try it Out," at every stage. By the end, you'll be able to write

  5. Head first C#

    CERN Document Server

    Stellman, Andrew

    2010-01-01

    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  6. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit

    2007-01-01

    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  7. Dicty_cDB: SSA659 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence KDQLSQLCDQLQQTDLNILEQLQFDKKYERNVGLSAFRHWISEFTWRKYLDSVPEVLKRL NSFRTTSEDQLYQIRQQLERTNAVTLRQIANSYVSI...C: KDQLSQLCDQLQQTDLNILEQLQFDKKYERNVGLSAFRHWISEFTWRKYLDSVPEVLKRL NSFRTTSEDQLYQIRQQLERTNAVTLRQIANSYVSI

  8. Dicty_cDB: SSB649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---TDNWDKEKLAKKAAEGLKNAKNTASSYAFGINASKDQLNSNFKNIKENISSNLNNAK HTIEENVHNAQRTGYPPKVPAPGSNKFIGFLALGVFG...C: ---TDNWDKEKLAKKAAEGLKNAKNTASSYAFGINASKDQLNSNFKNIKENISSNLNNAK HTIEENVHNAQRTGYPPKVPAPGSNKFIGFLALGVFG

  9. Dicty_cDB: SFL103 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---DLKPQNLLCAGEEGDDIRVADFGLSKIFGDGDYLXTCCGSPEYVAPEVLECKPYDKA CXLWSVGVITYVLLTGCFPXWDKNNAVLYEXIRNVDL...C: ---DLKPQNLLCAGEEGDDIRVADFGLSKIFGDGDYLXTCCGSPEYVAPEVLECKPYDKA CXLWSVGVITYVLLTGCFPXWDKNNAVLYEXIRNVDL

  10. Dicty_cDB: SSJ589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence KVPCPKILKYCQEGELPTGCCPCTPQPTKKPDCSRVPCPKILKYCKEGELPTGCCPCTPQ PTKKPDCSDVMCTMDIRYCKNGELPTGCCPCTPQETK...C: KVPCPKILKYCQEGELPTGCCPCTPQPTKKPDCSRVPCPKILKYCKEGELPTGCCPCTPQ PTKKPDCSDVMCTMDIRYCKNGELPTGCCPCTPQETK

  11. Dicty_cDB: CHA291 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---QLLLEKQKEEQVQKDKPKTRRSRVLGSTLSDKDIRKFKNTRSLVVERALLPSSLNLV ITKSKEIPAKXQMLTAIRKNISNTFHRMYGDLLDNRY...C: ---QLLLEKQKEEQVQKDKPKTRRSRVLGSTLSDKDIRKFKNTRSLVVERALLPSSLNLV ITKSKEIPAKXQMLTAIRKNISNTFHRMYGDLLDNRY

  12. Dicty_cDB: CFE502 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence HYIYHQLLVGVVAEIXKXIAXNIHVNQIEXXAYXPFVS--- ---LEVIQLVLKQDHRYHHHIAQTCAELSSACNHVGMICIQVPSNCTNTRFPCCPSHPIC...C: lylsptfgwgggrdxexhrsxytcksdrxlxixticim--- ---LEVIQLVLKQDHRYHHHIAQTCAELSSACNHVGMICIQVPSNCTNTRFPCCPSHPIC

  13. Dicty_cDB: VFA406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1029-1846 5' similar to SW:... Gm-c1055 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1055-2291 5' simila... Gm-c1035 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1035-246 5' similar to SW:PRC9_SPIOL P52427 PR....y1 Gm-c1014 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1014-1846 5' sim

  14. Dicty_cDB: VFC303 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BF187729.1 EST444016 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA42I13 5' sequence...|AW907097.1 EST343129 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA5C8, mRNA sequence...|AW906350.1 EST342472 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA3C3, mRNA sequence...|AW906668.1 EST342790 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA4C11 similar

  15. LOADING SIMULATION PROGRAM C

    Data.gov (United States)

    U.S. Environmental Protection Agency — LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for...

  16. Glycine decarboxylase in C3, C4 and C3-C4 intermediate species.

    Science.gov (United States)

    Schulze, Stefanie; Westhoff, Peter; Gowik, Udo

    2016-06-01

    The glycine decarboxylase complex (GDC) plays a central role in photorespiration. GDC is localized in the mitochondria and together with serine hydroxymethyltransferase it converts two molecules of glycine to one molecule of serine, CO2 and NH3. Overexpression of GDC subunits in the C3 species Arabidopsis thaliana can increase the metabolic flux through the photorespiratory pathway leading to enhanced photosynthetic efficiency and consequently to an enhanced biomass production of the transgenic plants. Changing the spatial expression patterns of GDC subunits was an important step during the evolution of C3-C4 intermediate and likely also C4 plants. Restriction of the GDC activity to the bundle sheath cells led to the establishment of a photorespiratory CO2 pump. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Parallelization in Modern C++

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    The traditionally used and well established parallel programming models OpenMP and MPI are both targeting lower level parallelism and are meant to be as language agnostic as possible. For a long time, those models were the only widely available portable options for developing parallel C++ applications beyond using plain threads. This has strongly limited the optimization capabilities of compilers, has inhibited extensibility and genericity, and has restricted the use of those models together with other, modern higher level abstractions introduced by the C++11 and C++14 standards. The recent revival of interest in the industry and wider community for the C++ language has also spurred a remarkable amount of standardization proposals and technical specifications being developed. Those efforts however have so far failed to build a vision on how to seamlessly integrate various types of parallelism, such as iterative parallel execution, task-based parallelism, asynchronous many-task execution flows, continuation s...

  18. A1C Test

    Science.gov (United States)

    ... 1997). Taber's Cyclopedic Medical Dictionary. F.A. Davis Company, Philadelphia, PA [18th Edition]. Pagana, Kathleen D. & Pagana, ... Translating the A1C Assay Into Estimated Average Glucose Values. Diabetes Care 31:1473-1478, 2008 DOI: 10. ...

  19. LOADING SIMULATION PROGRAM C

    Science.gov (United States)

    LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for simulating hydrology, sediment, and general water quality

  20. Beginning Objective-C

    CERN Document Server

    Dovey, James

    2012-01-01

    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  1. Insulin C-peptide

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003701.htm Insulin C-peptide test To use the sharing features ... a product that is created when the hormone insulin is produced and released into the body. The ...

  2. C-FERST

    Science.gov (United States)

    The Community-Focused Exposure and Risk Screening Tool (C-FERST) is an online tool which provides access to resources that can help communities learn more about their environmental issues, and explore exposure and risk reduction options.

  3. C1 esterase inhibitor

    Science.gov (United States)

    ... protein called C1, which is part of the complement system. This system is a group of proteins that ... 2013:chap 20. Sullivan KE, Grumach AS. The complement system. In: Adkinson NF, Bochner BS, Burks AW, et ...

  4. C. difficile Infection

    Science.gov (United States)

    ... days. The most effective treatment, however, is fecal microbiota transplant, also known as stool transplant. In studies, ... Hepatitis C Inflammatory Bowel Disease Irritable Bowel Syndrome Obesity Digestive Health Topics Abdominal Pain Syndrome Belching, Bloating, ...

  5. Dicty_cDB: SSE551 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  6. Dicty_cDB: VFC392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  7. Dicty_cDB: AFF396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  8. Dicty_cDB: VFE318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  9. Dicty_cDB: VFF663 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  10. Dicty_cDB: VFE361 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  11. Dicty_cDB: VFF382 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  12. Dicty_cDB: AFF388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  13. Dicty_cDB: VFG581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  14. Dicty_cDB: VFF530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  15. Dicty_cDB: SSK263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  16. Dicty_cDB: VFG517 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA...EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  17. Dicty_cDB: SFF811 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HILQIHSRKMNVSADVNFDELARSSEDFNGAQLKAVCVEAXXLH Frame C: ---lvpxvsivrlvviercnvqc*sysinwmvsvvmqisklspppivliswi...lls*dlvv wierlxshyqmkrlelisfkftlvr*tfplmlismswhvplkismaln*kqfvskxvxct Homology vs C

  18. Dicty_cDB: VFC623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LXDDPIIHSHLXELXSNXLEQXLCRXIEPFSRVEISHI AAFIDLPVDVVERKLSLMILDKKYNGILDQGTGTLIVFEEQKXR*ii*lffrnywcfksc c*xtl...LXDDPIIHSHLXELXSNXLEQXLCRXIEPFSRVEISHI AAFIDLPVDVVERKLSLMILDKKYNGILDQGTGTLIVFEEQKXR*ii*lffrnywcfksc c*xtl

  19. Dicty_cDB: SLE356 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGATGGNSGGAT--- Frame C: vvlleaivevlqvvtvevlleeiaavlhhlvaileviaavlleviaavlleaivevlqvv tvevlleeivevtvvphlqeviavg*qv...ivalqpeeilevlqvvpvlqeviavg*qeallevivavllevivavllevivavlleviv evllevivevll--- Homology vs CSM-cDNA Score

  20. Dicty_cDB: CFE321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---PHPEFAQHKFXVSGFAARQPYNHPNXDFVQPGDLYRLMSEDAKSRFVSNLVGHMSGV TIKEIQVRAVSNFYKADKDLGARLCKGXWY*c**chqirc*iklvnqyiknnkkikk*kk...---PHPEFAQHKFXVSGFAARQPYNHPNXDFVQPGDLYRLMSEDAKSRFVSNLVGHMSGV TIKEIQVRAVSNFYKADKDLGARLCKGXWY*c**chqirc*iklvnqyiknnkkikk*kk

  1. 8C.02

    DEFF Research Database (Denmark)

    Jensen, B L; Frederiksen-Moller, B; Jorgensen, J S

    2015-01-01

    OBJECTIVE: The serine protease prostasin (PRSS8, CAP1) and its activator matriptase and inhibitor nexin-1 are necessary for normal placental development in mice. Prostasin is regulated by aldosterone in the kidney and may activate the epithelial sodium channel (ENaC). Preeclampsia is characterize...... to renal EnaC activation and suppression of aldosterone in preeclampsia. Potential impact of prostasin-matriptase on placental development is likely to be at the level of activity and not protein abundance....

  2. L C Lee

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. L C Lee. Articles written in Sadhana. Volume 28 Issue 5 October 2003 pp 945-955. Micro-machining of optical glasses – A review of diamond-cutting glasses · F Z Fang X D Liu L C Lee · More Details Abstract Fulltext PDF. In order to diamond-turn optical glasses to a nanometric surface finish, it is ...

  3. C# 30 Design Patterns

    CERN Document Server

    Bishop, Judith

    2009-01-01

    Want to speed up the development of your .NET applications? Tackle common programming problems with C# design patterns. This guide explains what design patterns are and why they're used, with tables and guidelines to help you choose one pattern over another, and plenty of case studies to illustrate how each pattern is used in practice. C# 3.0 features are introduced by example and summarized for easy reference.

  4. c b palan

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C B PALAN. Articles written in Bulletin of Materials Science. Volume 39 Issue 5 September 2016 pp 1157-1163. Synthesis and luminescence properties of Tb 3 + − d o p e d L i M g P O _4$ phosphor · C B PALAN N S BAJAJ A SONI S K OMANWAR · More Details Abstract ...

  5. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts

    2012-03-06

    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  6. [C4 type photosynthesis].

    Science.gov (United States)

    Drozak, Anna; Wasilewska, Wioleta; Buczyńska, Alicja; Romanowska, Elzbieta

    2012-01-01

    C4 photosynthesis includes several anatomical and biochemical modifications that allow plants to concentrate CO2 at the site of Rubisco. The photorespiratory pathway is repressed in C4 plants, since the rates of photosynthesis and biomass production are increased. This is an adaptation to high light intensities, high temperatures and dryness. C4 plants contain two distinct types of photosynthetic cells, mesophyll and bundle sheath. The processes of assimilation and reduction of CO2 are separated spatiality and catayzed by two different enzymes. Only the bundle sheath chloroplasts perform the reactions of the Calvin-Benson cycle with the help of the Rubisco enzyme present exclusively in this cell type. The primary CO2 fixation occurs in mesophyll cells through the action of the phosphoenolpyruvate carboxylase. The light-dependent reactions of the photosynthesis occur exclusively in the latter cell type. These differences in photochemistry lead to distinct redox profiles in both types of cells. C4 plants are divided into three biochemical subtypes on the basis of differences in the mechanisms of decarboxylation of the C4 acids. C4 plants will provide the main source of food for humans and animals in the nearest decade.

  7. Registration of CA0469C025C chickpea germplasm

    Science.gov (United States)

    Chickpea (Cicer arientinum L.) germplasm CA0469C025C (Reg. No. XXX; PI XXX), was released by the USDA-ARS in 2010. CA0469C025C was released based on its improved yield and reaction to Ascochyta blight relative to the popular commercial cultivars ‘Dwelley’, ‘Sierra’, and ‘Sawyer’. CA0490C025C is deri...

  8. Dicty_cDB: AFL250 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06

  9. Dicty_cDB: SFF569 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06

  10. Dicty_cDB: SFF287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06

  11. Dicty_cDB: SFB347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06

  12. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    J.C. Christensen var kun regeringsleder i tre år, men i en lille menneskealder kunne stort set intet ske i dansk politik uden om ham. I et kvart århundrede var han et magtcentrum. Centralt i J.C. Christensens politiske virke i årene 1890-1924 stod kampen for det parlamentariske folkestyre....... Parlamentarismen har lige siden udgjort fundamentet for vores styreform, og dens fortsatte betydning og grundlovsfæstede status gør den til den betydeligste arv, J.C. Christensen har efterladt sig. Men hvem var J.C. Christensen egentlig? Han satte sit afgørende fingeraftryk på indførelsen af kvindelig valgret......, stiftelsen af Det Radikale Venstre og Venstre, tilblivelsen af det norske kongehus, Albertiaffæren, salget af De Vestindiske Øer, Påskekrisen og genforeningen med Sønderjylland. Nu har J.C. Christensens efterkommere for første gang givet adgang til hans efterladte dagbøger og breve. Det har gjort det muligt...

  13. Dicty_cDB: VFD348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  14. Dicty_cDB: AFN814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06

  15. Dicty_cDB: AFO440 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  16. Dicty_cDB: SFG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  17. Dicty_cDB: AFO646 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  18. Dicty_cDB: AFN790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  19. Dicty_cDB: VFA442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  20. Dicty_cDB: VFD181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  1. Dicty_cDB: VSE884 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone PP095G12 similar to RAS RELATED PROTEIN RAB7. 68 6e-08 1 AW290476 |AW290476.1 NXNV027C10F Nsf Xylem Normal wood Vertical...27C10 Nsf Xylem Normal wood Vertical Pinus taeda cDNA clone NXNV027C10 5' similar... |CD018114.1 NXLV_002_C09_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV_002_C09 5' simil

  2. Introduction to C

    DEFF Research Database (Denmark)

    Albertsen, Niels Christian

    2006-01-01

    them in /* and */. e.g.: /* a comment */. Note that the C compiler is case sensitive. A C program may consist of several program segments. One of them must be the main program, the rest are denoted functions. In contrast to PASCAL the concept procedure does not exist. Every segment starts with a number...... of declarations, after which follows the executable code. As in PASCAL both global and local variables may be declared. It is possible to combine a program from several separate files, one of which contains the main program, the others functions. This leads to the concept of scope of global variables. To avoid......The principles of C are very much like those of PASCAL, although the syntax differs slightly. The programs are entered in free format, which the programmer may utilise to make the text reader-friendly, and every sentence is ended with a semicolon. Comments can be entered at any point by enclosing...

  3. Hepatitis C pada Anak

    Directory of Open Access Journals (Sweden)

    Yusri Dianne Jurnalis

    2014-05-01

    Full Text Available AbstrakInfeksi virus hepatitis C saat ini masih merupakan persoalan yang serius. Penularan infeksi HCV pada anak yang utama adalah melalui transfusi darah atau produk darah yang saat ini bertanggung jawab menyebabkan kasus hepatitis C kronis. Selain itu infeksi HCV pada anak dapat disebabkan oleh transmisi perinatal (vertikal. Infeksi HCV akut dapat berakhir dengan sirosis dan karsinoma hepatoselular setelah dekade ketiga (sekitar 20%, karena progresivitas infeksi HCV lebih lambat dari infeksi hepatitis B virus. Pada umumnya infeksi HCV bersifat asimptomatik termasuk pada anak. Karena tidak ada gejala yang jelas pada infeksi HCV tersebut maka diagnosis infeksi HCV hanya dapat ditegakkan dengan pemeriksaan awal laboratorium dan uji serologi, dan bila perlu dengan uji molekuler pada pasien dengan risiko tinggi. Kebijakan kuratif khusus terhadap HCV adalah terapi antivirus berupa interferon dan ribavirin yang diberikan bila diagnosis HCV sudah ditegakkanKata kunci: Hepatitis C, diagnosis and management problem, childrenAbstractHepatitis C virus infection is still a serious problem. Transmission of HCV infection in children is a major blood transfusion or blood products that are currently responsible for causing chronic hepatitis C cases. Additionally HCV infection in children can be caused by perinatal transmission (vertical. Acute HCV infection may end up with cirrhosis and hepatocellular carcinoma after the third decade (around 20%, due to a slower progression of HCV infection of hepatitis B virus infection. In most cases of HCV infection are asymptomatic, including in children. Since there are no obvious symptoms in the diagnosis of HCV infection HCV infection can only be confirmed by laboratory examinations and serologic testing early, and if necessary with molecular testing in patients at high risk. Curative policy is specific to HCV antiviral therapy such as interferon and ribavirin are given when the diagnosis of HCV has been established

  4. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M

    2010-01-01

    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  5. Practical C++ financial programming

    CERN Document Server

    Oliveira, Carlos

    2015-01-01

    Practical C++ Financial Programming is a hands-on book for programmers wanting to apply C++ to programming problems in the financial industry. The book explains those aspects of the language that are more frequently used in writing financial software, including the STL, templates, and various numerical libraries. The book also describes many of the important problems in financial engineering that are part of the day-to-day work of financial programmers in large investment banks and hedge funds. The author has extensive experience in the New York City financial industry that is now distilled in

  6. Why Are C3-C4 Intermediate Species Rare?

    Science.gov (United States)

    Johnson, J. E.; Field, C. B.; Berry, J. A.

    2014-12-01

    While C3-C4 intermediate photosynthesis is thought to represent the evolutionary bridge between C3 and C4 photosynthesis, C3-C4 intermediate species are ecologically rare in comparison to both C3 and C4 species. Here, we report results from a laboratory experiment, field observations, and model simulations that suggest a new explanation for the ecological rarity of C3-C4 intermediate species. In the laboratory experiment, we combined gas exchange and fluorescence to characterize the temperature response of photosynthesis in three closely-related species in the genus Flaveria that are representatives of the C3, C3-C4 intermediate, and C4 photosynthetic pathways. The leaf temperature that maximized the quantum yield for CO2 assimilation (Topt(ΦCO2)) was 24.9 ± 0.7°C in Flaveria robusta (C3), 29.8 ± 1.0°C in F. chloraefolia (C3-C4), and 35.7 ± 0.8°C in F. bidentis (C4), and was linearly related to the temperature sensitivity of the coupling between CO2 assimilation and electron transport (d(ΦCO2/ ΦPSII)/dT)). While F. chloraefolia does not simultaneously occur with F. robusta and F. bidentis in naturally-assembled communities, this C3-C4 intermediate species does occur with other C3 and C4 species. During the growing season in two of these mixed-photosynthetic-type communities, leaf temperatures for F. chloraefolia were similar to the Topt(ΦCO2) determined in the laboratory. A model of maximum potential carbon gain suggests that competitive coexistence of C3, C3-C4 intermediate, and C4 species could be dependent on a temperature regime that highlights the distinct relative advantages of the C3-C4 intermediate pathway. In combination, these results suggest that the relative temperature sensitivity of the C3, C3-C4 intermediate, and C4 photosynthetic pathways combined with environmental variation in temperature may help to explain why C3-C4 intermediate species are generally rare.

  7. Dicty_cDB: AFK259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se51b09.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2418 5', mRNA sequence. 34 8e-04...ss71e08.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1062-1887 5' similar to TR:Q9S740...sb97c10.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-619 5', mRNA sequence. 34 0...sh38b07.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-3950 5', mRNA sequence. 34 0

  8. Dicty_cDB: SSF112 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sa81e11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-5733 5' similar to SW:VSPA_SOYBN...sae29c02.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-4323 5' similar to TR:O49855...st77g08.y1 Gm-c1054 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1054-687 5' similar to TR:O49855...sp15g08.y1 Gm-c1042 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1042-663 5' similar to TR:O49855

  9. Dicty_cDB: VFF253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mRNA sequence. 46 0...sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-6285 5', mRNA sequence. 46 0...sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', mRNA sequence. 46 0...saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA sequence. 46 0

  10. Dicty_cDB: AFE576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar....1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...35.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9Z...e chromosome IV reading frame ORF YDL084w. 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  11. Dicty_cDB: SFL479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O657...4653 GDI2. ;, mRNA sequence. 62 5e-08 2 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...nce. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...uence. 62 5e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O2

  12. Dicty_cDB: VFH105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE342309.1 EST395153 potato stolon, Cornell University Solanum tuberosum cDNAclone cSTA19F21, mRNA sequence...|AW906350.1 EST342472 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA3C3, mRNA sequence...|BE342617.1 EST395461 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA20L9, mRNA sequence...|AW907097.1 EST343129 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA5C8, mRNA sequence...|AW906668.1 EST342790 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA4C11 similar

  13. Dicty_cDB: CHL239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sq27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1046-2101 5' similar to WP:D1005...sad75f02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9XFY7...sc93f08.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' similar to WP:D1005.1

  14. Dicty_cDB: SFB381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sf79b03.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-2310 5', mRNA sequence. 34 0...sag44a03.y1 Gm-c1081 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1081-1542 5' similar to TR:Q9SKA6...saa73f04.y1 Gm-c1063 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1063-247 5', mRNA sequence. 34 0

  15. Dicty_cDB: SLJ376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saj06h02.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9939 5', mRNA sequence. 42 0...so71b06.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-1068 5', mRNA sequence. 42 0...sah65a10.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-3092 5', mRNA sequence. 42 0

  16. Dicty_cDB: VSB739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI320483 |BI320483.1 sah56b01.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' ... sh92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-759...111.1 sh40a06.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar to TR:O49

  17. Dicty_cDB: CHD833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 ...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9Z...I974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' si

  18. Dicty_cDB: SFL383 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 st5...9b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS06...4435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q

  19. Dicty_cDB: SSE865 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 sah56b01.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2...09174.1 sh92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-7592 5' similar to TR:O... |AW395111.1 sh40a06.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar to

  20. Dicty_cDB: SFL121 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 59.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071...471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS...08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068

  1. Dicty_cDB: AFO168 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available its) Value N BI972870 |BI972870.1 sai84a09.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...ae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 O6...tor 3, mRNA sequence. 44 2.0 1 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS

  2. Dicty_cDB: VHM716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1046-2101 5' similar to WP:D1005.1 CE0...208.1 sad75f02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9...1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' simila

  3. Dicty_cDB: AFB155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sd88e01.y1 Gm-c1009 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1009-148...4.y3 Gm-c1086 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1640 5' similar to TR:O80632 O80632 F...c1055 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1055-334 5' similar to TR:O80632 O80632 F12L6.11 P

  4. Dicty_cDB: SFD888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c105...e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06 Q9ZS06

  5. Dicty_cDB: SFE227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' sim...Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS06 RNA HELICASE ;, ...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-906

  6. Dicty_cDB: VSC267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3.1 sah56b01.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' similar to TR:O494...W509174.1 sh92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-7592 5' similar to TR...m-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar

  7. Dicty_cDB: CHH241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Gm-c1071 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1071-476 5', mRNA sequence. 40 19 1 AC147729 ... |BE803342.1 sr55a09.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:

  8. Dicty_cDB: SHB242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-7762 5' similar ...66 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-1230 5' similar to TR:Q9XEU0 Q9XEU0 ZINC-FINGER

  9. Dicty_cDB: CHA214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA

  10. Dicty_cDB: SHF821 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cloneUI-D-GC1-aau-c-07-0-UI 3', mRNA sequence. 30 0.007 3 DT338982 |DT338982.1 JBW092C02.b_012.abi Pineapp...le week 5-10 nematode-infected gall cDNA library Ananas comosus cDNA clone JBW092C0

  11. Dicty_cDB: CHS286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se cDNA Schistosoma japonicum cDNA, mRNA sequence. 50 7e-05 3 CF445056 |CF445056.1 EST681401 normalized cDNA library of onion...652 |CF439652.1 EST675997 normalized cDNA library of onion Allium cepa cDNA clone ACAAS01, mRNA sequence. 46

  12. Sodium dichloroiodate promoted C-C bond cleavage: An efficient ...

    Indian Academy of Sciences (India)

    SAKET B BHAGAT

    2018-02-01

    Feb 1, 2018 ... benzimidazoles/benzothiazoles/benzoxazoles under mild conditions. This tandem process involved a C-C bond cleavage and C-N bond formation. Keywords. Benzimidazole/benzothiazole/benzoxazole; β-diketones; NaICl2; C-C bond cleavage. 1. Introduction. Nitrogen-containing five-member heterocyclic ...

  13. D and C - slideshow

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/presentations/100013.htm D and C - series—Normal anatomy To use the ... MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Editorial team. Related MedlinePlus Health Topics ...

  14. V C Srivastava

    Indian Academy of Sciences (India)

    Volume 23 Issue 2 April 2000 pp 73-78 Materials Synthesis. Microstructural features induced by spray forming of a ternary Pb–Sn–Sb alloy ... Volume 28 Issue 2 April 2005 pp 125-130 Composites. Microstructure and electrical conductivity of Al–SiCp composites produced by spray forming process · V C Srivastava S N Ojha.

  15. C P Navathe

    Indian Academy of Sciences (India)

    Design, development and performance characteristics of a large aperture disc amplifier for high power Nd: Glass laser chain · M P Kamath P K Tripathi A P Kulkarni R Chandra A S Joshi C P Navathe P D Gupta · More Details Abstract Fulltext PDF. A large aperture disc amplifier has been designed, set-up and characterized ...

  16. R C Rannot

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. R C Rannot. Articles written in Pramana – Journal of Physics. Volume 82 Issue 3 March 2014 pp 585-605 Research Articles. Long term performance evaluation of the TACTIC imaging telescope using ∼400 h Crab Nebula observation during 2003–2010 · A K Tickoo R Koul ...

  17. 11C-imaging

    DEFF Research Database (Denmark)

    Thorpe, Michael R; Ferrieri, Abigail P; Herth, Matthias Manfred

    2007-01-01

    The long-distance transport and actions of the phytohormone methyl jasmonate (MeJA) were investigated by using the short-lived positron-emitting isotope 11C to label both MeJA and photoassimilate, and compare their transport properties in the same tobacco plants (Nicotiana tabacum L.). There was ...

  18. Hepatitis C in India

    Indian Academy of Sciences (India)

    2008-10-15

    Oct 15, 2008 ... Hepatitis C is an emerging infection in India and an important pathogen causing liver disease in India. The high risk of chronicity of this blood-borne infection and its association with hepatocellular carcinoma underscores its public health importance. Blood transfusion and unsafe therapeutic interventions ...

  19. Suresh C. Babu'

    African Journals Online (AJOL)

    FOOD AND NUTRITION POLICIES IN AFRICA: CAPACITY CHALLENGES AND TRAINING OPTIONS. Suresh C. Babu'. ABSTRACT. In spite of the continued efforts of nutritionists to address nutrition problems in sub-Saharan Africa, the levels of undernutrition remain high. This paper is an attempt to provide an overview of ...

  20. C2 Agility

    DEFF Research Database (Denmark)

    Mitchell, Dr. William; Alberts, David S.; Bernier, Francois

    Agility is the capability to successfully effect, cope with, and/or exploit changes in circumstances. While other factors will also influence outcomes, C2 Agility enables entities to effectively and efficiently employ the resources they have in a timely manner in a variety of missions and circums...

  1. D C Gautam

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. D C Gautam. Articles written in Journal of Chemical Sciences. Volume 125 Issue 1 January 2013 pp 85-93. An efficient ... Synthesis and evaluation of antimicrobial and anthelmintic activity of novel fluorinated 7-ethyl-10-phenothiazines, their sulphones and ribofuranosides.

  2. The structure of C

    Indian Academy of Sciences (India)

    6; ePublication: 1 November 2014. Abstract. The nucleus 12C has a rather significant role in modern nuclear physics, but whose influence can be traced to the work of Hoyle in the 1950s, when it was concluded that there should be a state ...

  3. C;ultivation -or:

    African Journals Online (AJOL)

    Soil kept in a desiccated c'o~ftion (~% .moisture content, equi1;alent to 38.6 Mpa tension) for 2 years, wasfoiJnd ... Keywords: Antibiotic-resis1:animutants; bradyrhizobial surrivaI, cowpea, soil· desiccation: ~.: .... causing genetic alterations. rich laboratory media could have been caused by \\the.long periods of may also ...

  4. Coturnix c. coturnix

    Indian Academy of Sciences (India)

    The wild common quail (Coturnix c. coturnix) is a partial migrant bird with an unfavourable conservation status in. Europe. Hunting activity associated with destruction and/or modification of their habitat, climate changes, released of. Japanese and/or hybrid quails and predation (nonhuman) are likely to severely affect their ...

  5. Suresh C. Jhanwar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Suresh C. Jhanwar. Articles written in Journal of Genetics. Volume 79 Issue 3 2000 pp 113-123. Characterization of newly established colorectal cancer cell lines: correlation between cytogenetic abnormalities and allelic deletions associated with multistep tumorigenesis · Hans Gerdes ...

  6. Fundamentals of C

    CERN Document Server

    Guruprasad, N

    2009-01-01

    The book presents a contemporary approach to programming. Complte C programs are presented as and when it is required. This Book is not a cookbook . To get the maximum benefit from this book, you should take as active a role as possible. Don`t just read the examples. Enter it into your system and try them out.

  7. Umesh C S Yadav

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Umesh C S Yadav. Articles written in Journal of Biosciences. Volume 28 Issue 2 March 2003 pp 215-221 Articles. Regulation of glucose utilization and lipogenesis in adipose tissue of diabetic and fat fed animals: Effects of insulin and manganese · Najma Z Baquer M Sinclair S ...

  8. The 5C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche

    2014-01-01

    the approaches and reach a new level of conscious action when designing? Informed by theories of design thinking, knowledge production, and learning, we have developed a model, the 5C model, accompanied by 62 method cards. Examples of how the model has been applied in an educational setting are provided...

  9. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....

  10. The 4C model

    DEFF Research Database (Denmark)

    Knox, Jeanette Bresson Ladegaard

    2014-01-01

    Doctors and nurses at the neonatal intensive-care unit at The University Hospital, Rigshospitalet, in Copenhagen, Denmark regularly find themselves in ethically challenging and potentially distressing situations concerning the life of ill newborn babies. In collaboration with the neonatal intensi...... how the 4C model was developed and whereof it consists....

  11. Dicty_cDB: VFJ721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se29h12.y1 Gm-c1015 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1015-2688 5' similar to SW:KADB_ORYSA...sae09e07.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-2509 5' similar to SW:KADB_ORYSA...sm55e02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-7827 5' similar to SW:KADB_ORYSA...sj49a11.y1 Gm-c1033 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1033-597 5' similar to SW:KADB_ORYSA

  12. Dicty_cDB: SSD708 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sai17h12.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3815 5' similar to TR:O80678...sai20g08.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3784 5' similar to TR:O80678...st97d06.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-155 5' similar to TR:O80678...sai11e07.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-2917 5' similar to TR:O80678

  13. Dicty_cDB: AFJ756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saj14a08.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-2703 5' similar to TR:O04336...sc88e12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-455 5' similar to TR:O04336...saa54g06.y1 Gm-c1060 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1060-684 5' similar to TR:O04336...sai33a08.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-5007 5' similar to TR:Q9ZUI7

  14. Dicty_cDB: SFD132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf70a03.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-1541 5' similar to TR:P93358...sac08f03.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-4086 5' similar to SW:ERP5_MEDSA...sj98c05.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-2625 5' similar to SW:ERP5_MEDSA...si40c04.y1 Gm-r1030 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-r1030-1375 5' similar to TR:P93358

  15. Dicty_cDB: SSD524 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence update 1997.10.13 Translated Amino Acid sequence ---lsffkyhahslflk*c*fri*ifqmmpi...ssncgktnnkikknnkkkkkkif**lk** kkkiiik*flfyf Frame C: ---lsffkyhahslflk*c*fri*ifqmmpiniqlf*YQFILSNSXQFVLAFLLI

  16. Dicty_cDB: SFJ186 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 56 6...e-04 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...97.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O657...Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O6...7 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' similar to TR:O65744 O65744 GDP DISSOCIAT

  17. Dicty_cDB: VFA481 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1e-21 4 AW472197 |AW472197.1 si21b11.y1 Gm-c1029 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1029-18...88 7e-21 3 BF596899 |BF596899.1 su92h06.y1 Gm-c1055 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1055...93.1 sk86f03.y1 Gm-c1035 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1035-246 5' similar to SW:PRC9_...1 Gm-c1014 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1014-1846 5' similar to SW:PRC9_SPIOL P52427

  18. Dicty_cDB: SLI621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G DRAFT SEQUENCE, 9 unordered pieces. 58 5e-08 4 AW201445 |AW201445.1 sf03c02.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3045 5' similar to SW:ERF1_ARATH P35614 ...y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-2790 5' similar to SW:ERF1_ARATH P35614...1 AW831104 |AW831104.1 sm08g04.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-8335 5'

  19. Dicty_cDB: AFJ131 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available I437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' sim...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 GDI2. ;, mRNA seque...ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION INH...IBITOR. ;, mRNA sequence. 62 1e-05 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...e max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O

  20. Dicty_cDB: AFN644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 71471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE...9.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS0...435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c10...ae chromosome IV reading frame ORF YDL084w. 42 3e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  1. Dicty_cDB: CHM483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available INNKKK--- ---VQGNNAVCVPQQSSTSGGHQNDPCDTVQCPYGYSCESRDGFEAKCTRDEDEPTHRPT HRPKPPHDSDKYLCDNVHCPRGYKCNAKN...qm*c*kwccqmycrl*nsksms*hpmsnrlqm*rsqp *snlcfrrkresr*lfnl**c*l*slwfslcydsc*m*grcc*ml*cs* Frame C: stq...INNKKK--- ---VQGNNAVCVPQQSSTSGGHQNDPCDTVQCPYGYSCESRDGFEAKCTRDEDEPTHRPT HRPKPPHDSDKYLCDNVHCPRGYKCNAKN

  2. Dicty_cDB: CHR571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BQ739501.1 PfESToab46g04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BQ596812.1 PfESToab22h07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU494691.1 PfESToab66c05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BQ633658.1 PfESToab45a03.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BQ596247.1 PfESToab31c07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence

  3. Dicty_cDB: VFF462 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST402197 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY17P13...EST340081 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8G3 5'...|AW617822.1 EST324221 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT24L9 5'

  4. Dicty_cDB: CFI391 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST402197 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY17P13...EST340081 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8G3 5'...|AW617822.1 EST324221 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT24L9 5'

  5. Dicty_cDB: VFF490 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST402197 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY17P13...EST340081 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8G3 5'...|AW617822.1 EST324221 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT24L9 5'

  6. Dicty_cDB: SSE709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BF187220.1 EST443507 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39D17 5' sequence...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5'...|BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA35F24, mRNA

  7. Dicty_cDB: VFF801 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST402197 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY17P13...EST340081 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8G3 5'...|AW617822.1 EST324221 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT24L9 5'

  8. Dicty_cDB: VFD878 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST402197 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY17P13...EST340081 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8G3 5'...|AW617822.1 EST324221 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT24L9 5'

  9. Dicty_cDB: AFN582 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE341239.1 EST345340 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA16L1, mRNA sequence...|AW906877.1 EST343000 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA4F14, mRNA sequence...EST306417 tomato flower buds 0-3 mm, Cornell University Lycopersicon esculentum cDNA clone cTOA1G18 5'

  10. Dicty_cDB: SSA726 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST303158 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY6G23,...EST303159 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY6G23 similar...EST303157 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY6G23 similar

  11. Dicty_cDB: VFA270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST402197 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY17P13...EST340081 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8G3 5'...|AW617822.1 EST324221 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT24L9 5'

  12. Dicty_cDB: VFI438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BF187220.1 EST443507 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39D17 5' sequence...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5'...|BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA35F24, mRNA

  13. Dicty_cDB: VFI213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5'...|BF187220.1 EST443507 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39D17 5' sequence...|BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA35F24, mRNA

  14. Dicty_cDB: SLJ744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW617326.1 EST323737 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT22L7 5'...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2H5 5'...EST401326 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY13D17

  15. Dicty_cDB: SSB191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST340090 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD8K1 5'...EST338521 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD2E1 5'...EST339369 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD4B20 5'

  16. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM598965 |BM598965.1 17000687687920 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449701382 5'...BM597672 |BM597672.1 17000687500233 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449708554 5'...BM606412 |BM606412.1 17000687083330 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449709088 5'

  17. Dicty_cDB: SSA689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM597427 |BM597427.1 17000687496066 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449711169 5'...BM581369 |BM581369.1 17000687244247 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449689000 5'...BM600995 |BM600995.1 17000687067184 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449679885 5'

  18. Dicty_cDB: CHJ550 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM615995 |BM615995.1 17000687147636 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449728790 5'...BM610691 |BM610691.1 17000687112101 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449733782 5'...BM610376 |BM610376.1 17000687110678 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449712509 5'

  19. Dicty_cDB: AHA679 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM608903 |BM608903.1 17000687086872 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449690492 5'...BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  20. Dicty_cDB: CFG804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-14 3 BU041060 |BU041060.1 PP_LEa0008C18f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0008C18f...10 BU040467 |BU040467.1 PP_LEa0006C14f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0006C14f

  1. Dicty_cDB: VSF637 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BQ633139.1 PfESToab38c04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum 3D7 cDNA 5', mRNA sequence...|BU496524.1 PfESToab51c12.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496772.1 PfESToab58f06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence

  2. Dicty_cDB: VSF605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BQ633139.1 PfESToab38c04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496524.1 PfESToab51c12.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496772.1 PfESToab58f06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence

  3. Dicty_cDB: VSK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BQ633139.1 PfESToab38c04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496524.1 PfESToab51c12.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496772.1 PfESToab58f06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence

  4. Dicty_cDB: SFJ818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Translated Amino Acid sequence HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQV LTLDG...sicf*iqypnpywtwlfkr*gn*tfnss*rqc*c Frame C: HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQV LTLDG

  5. Dicty_cDB: SHA641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence REHIEKILKTPXGEKKDVXSLLSSYHPTAVESIWXDYWLXXGYFS--- Translated Amino Acid sequence...*llvxxxiff--- Frame C: REHIEKILKTPXGEKKDVXSLLSSYHPTAVESIWXDYWLXXGYFS--- Homology vs CSM-cDNA Score E

  6. Dicty_cDB: VSJ792 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LYPSXI*inl*nekk n Frame C: yikwkrftqkvsf*vtedhkllntqtsv*sklkvlshvkiqlfi*vkksv*sakfpnqpk tqlvtkfhgvrfakptvvqvlsklvspets... qpktqlvtkfhgvrfakptvvqvlsklvspetshqklwvpqselcythqxsk*ifktkkk Homology vs CSM-cDN

  7. Complement C3c as a Biomarker in Heart Failure

    Directory of Open Access Journals (Sweden)

    A. Frey

    2013-01-01

    Full Text Available Introduction. Experimental data indicates an important role of the innate immune system in cardiac remodeling and heart failure (HF. Complement is a central effector pathway of the innate immune system. Animals lacking parts of the complement system are protected from adverse remodeling. Based on these data, we hypothesized that peripheral complement levels could be a good marker for adverse remodeling and prognosis in patients with HF. Methods and Results. Since complement activation converges on the complement factor C3, we measured serum C3c, a stable C3-conversion product, in 197 patients with stable systolic HF. Subgroups with normal and elevated C3c levels were compared. C3c levels were elevated in 17% of the cohort. Patients with elevated C3c levels exhibited a trend to better survival, slightly higher LVEF, and lower NTpro-BNP values in comparison to patients with normal C3c values. No differences were found regarding NYHA functional class. Significantly more patients with elevated C3c had preexisting diabetes. The prevalence of CAD, arterial hypertension, and atrial fibrillation was not increased in patients with elevated C3c. Conclusion. Elevated C3c levels are associated with less adverse remodeling and improved survival in patients with stable systolic heart failure.

  8. Dicty_cDB: SFG327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c1055 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1055-334 5' similar to TR:O80632 O80632 F12L6.11 P...ROTEIN. ;, mRNA sequence. 40 4e-05 2 BM092674 |BM092674.1 sah17c04.y3 Gm-c1086 Glycine max cDNA clone GENOME SYSTEMS... ;, mRNA sequence. 40 4e-05 2 AW102462 |AW102462.1 sd88e01.y1 Gm-c1009 Glycine max cDNA clone GENOME SYSTEMS

  9. Dicty_cDB: VSG848 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3092 5', mRNA sequenc...e. 48 0.093 1 BF010328 |BF010328.1 ss98d09.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...a69e08.y1 Gm-c1060 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1060-2127 5', mRNA sequence. 48 0.093

  10. Dicty_cDB: AFF475 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignificant alignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' simil...uence. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  11. Dicty_cDB: AFG486 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06 Q9ZS06 R...NA HELICASE ;, mRNA sequence. 56 9e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS....y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06 Q9ZS06 RN

  12. Dicty_cDB: VSA479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' similar to TR:O49447 O49447 AD...92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-7592 5' similar to TR:O49447 O494...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar to TR:O49447

  13. Dicty_cDB: CHD158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... CLONE ID:sequence. 56 7e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06 Q9ZS06 RNA HELI

  14. Dicty_cDB: AFI284 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE I....1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 ...3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  15. Dicty_cDB: AFE478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS0...74435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLON

  16. Dicty_cDB: SFD645 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DNA clone pMHAM-41K9 5' end, mRNA sequence. 64 6e-10 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...RNA HELICASE ;, mRNA sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS... Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' simila

  17. Dicty_cDB: SFB185 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lxlkqfi kllklklfiklklklklli Frame C: *IYIYINPKLIIIIKKIKKTRSVGLFASLFYFFSKKKYKKK--- ---xssxsssxscsssssssssxssssxssssssssssssssxss...sssxxssssxsssss ssssssxssssssssssss Homology vs CSM-cDNA Score E Sequences producing sign

  18. Dicty_cDB: SSG469 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame C: *ykkkkkkklkkiketnikknkkki**wvng*c*liqhhf***gyhylpygmvvldhinl iwrinf**sitmicqtngy*yylvlvhyhsspffiiw...TITLSSVIAFVCGVILTLFWYYSNHFLFVN--- ---iircfnyrvwstcliipcpncnftnnflcs*twssinfnetntktktrsrkfnkflk kkkikkkknsd*k

  19. Dicty_cDB: CHO141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM608903 |BM608903.1 17000687086872 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449690492 5'...BM610376 |BM610376.1 17000687110678 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449712509 5'...BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  20. Dicty_cDB: SLD388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence QQQQQQQQQQQQQILTPKKKMISTSNGGTFIKKEDTS--- Translated Amino Acid sequence...fhfkrwyiykerryfa--- Frame C: QQQQQQQQQQQQQILTPKKKMISTSNGGTFIKKEDTS--- Homology vs CSM-cDNA Score E Sequences

  1. Dicty_cDB: VFC463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iwkksgi--- ---vaqkpssnhhs*vwnllvstkppttps*nvmlisrkdlcgnvvlsggttmfpgiadr mnkeltalapstmkikiiapperkysvwiggsil...aslstfqqmwixkeeydesgpsivhr kc Frame C: cwptgt*fkyiyinhlkmgr*rcssfsyr*rfwyv*srfcw**c

  2. Dicty_cDB: SLG686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGATGGN SGAAT--- Frame C: vevlleeiaavlhhlvaileviaavlleviaavlleaivevlqvvtvevlleeivevtvv phlqeviavg*qv...ivalqpeeilevlqv vpvlqeviavg*qeallevivavllevivavllevivavllevivevllevivevllvvi vvlql--- Homology vs CSM-cDNA

  3. Dicty_cDB: VHI283 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e C: nsniyi**ne*vnnfilnfgfnfshlcstqipiii*rfiik*fk*psnwftiilwftirf klririphn*hrfii...fwfwfwfkwyfrrfwfrfrfrfrlr*rfrfrfrccqwftirfrcc qwftirfrcc*wftiwcpnwftircw*cfrcfhw*piwfsisrn*ywfiiqw*w*wcpnw c

  4. Dicty_cDB: CFJ357 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---ESFCXIGEMVLSAAGPGSISLXQXSRXPSFAXEXGXRNQYRLIXVSNVHAENIMMSV EYFQ Translated Amino Acid sequence (All...C: ---ESFCXIGEMVLSAAGPGSISLXQXSRXPSFAXEXGXRNQYRLIXVSNVHAENIMMSV EYFQ Homology vs CSM-cDNA Score E Sequences

  5. Dicty_cDB: VFE664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VVNPIM SKLYQEGGMPQGGGMPGGTSNDSPKSSNNKVDELD*rnfseenisik*ixlkne*vsk Translated Amino Acid sequence (All...VVNPIM SKLYQEGGMPQGGGMPGGTSNDSPKSSNNKVDELD*rnfseenisik*ixlkne*vsk Frame C: c*nksky*iiky*KMSSIGIDLGTT

  6. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 - 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  7. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 �- 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  8. Wave Star C5

    DEFF Research Database (Denmark)

    Kramer, Morten; Kristensen, Tom Sten

    Design pile loads in this document are based on the Morison equation. In Chapter 3 and 4 the background for the design loads provided in Chapter 5 are given. In the remaining chapters from Chapter 6 and onward discussions and explanations of the results are given. A historical list of activities ...... to the present revision is given in Appendix A. Calculations of extreme events with wave slamming and plunging wave breaking is included in Appendix B and C....

  9. Hepatitis C in dermatology

    Directory of Open Access Journals (Sweden)

    Zonunsanga

    2015-10-01

    Full Text Available Hepatitis C is a serious public health problem all over the world. It is caused by a single stranded RNA virus. Most acute infections are subclinical, but in 75% of individuals, infection leads to a chronic hepatitis, which in some cases can progress to cirrhosis and occasionally development of hepatoma. It has wide range of dermatological manifestations. This review article deals with the overview of epidemiology, pathogenesis, clinical manifestations, management and prevention.

  10. c.z. Roux

    African Journals Online (AJOL)

    of the possible output versus input relationships which remain invariant with time. Hence, it follows that in. (15) uI (t) can be interpreted as a growth law and u4 (t) can be interpreted as the main control law. If the second moment matrixC isof rank one and Ipl

  11. Dicty_cDB: VSK364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 36 0.031 2 AW100096 |AW100096.1 sd20c05.y2 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...4 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1084-470 5' similar to TR:Q39835 Q39835 EXTENSIN. ;, m... AW164667 |AW164667.1 se76a06.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-587 5' si...sac11f12.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-4487 5', mRNA sequence. 36 0.1

  12. Dicty_cDB: VFB422 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 21 4 AW472197 |AW472197.1 si21b11.y1 Gm-c1029 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1029-1846 ...6e-21 3 BF596899 |BF596899.1 su92h06.y1 Gm-c1055 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1055-22...1 sk86f03.y1 Gm-c1035 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1035-246 5' similar to SW:PRC9_SPI...A7A.F CE23243 ;, mRNA sequence. 78 8e-18 2 AI938326 |AI938326.1 sc43b11.y1 Gm-c1014 Glycine max cDNA clone GENOME SYSTEMS

  13. Dicty_cDB: AFA836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequence 6225 from Patent WO02053728. 40 5e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...8e-09 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...OG. [1] ;, mRNA sequence. 38 4e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...I966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' simi

  14. Dicty_cDB: AFO484 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...SE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...6749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar

  15. Dicty_cDB: VSF473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ax cDNA 3', mRNA sequence. 54 5e-04 1 AI941061 |AI941061.1 sb83h05.y1 Gm-c1010 Glycine max cDNA clone GENOME SYSTEMS...54 5e-04 1 BG652825 |BG652825.1 sad84e07.y1 Gm-c1055 Glycine max cDNA clone GENOME SYSTEMS...ojae mixed EST library cDNA, mRNA sequence. 54 5e-04 1 BE347117 |BE347117.1 sp35b10.y1 Gm-c1043 Glycine max cDNA clone GENOME SYSTEMS...9146.1 sai08a12.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-2352 5' similar to SW:R

  16. Dicty_cDB: AFN831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Sequence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...ELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...OLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' si

  17. Dicty_cDB: SFH857 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BU498573.1 PfESToab99a02.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BU495626.1 PfESToab75e05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BU495625.1 PfESToab75e04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BI815241.1 PfESToaa16c01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BI670760.1 PfESToaa03h11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to

  18. Dicty_cDB: VFC858 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BI816026.1 PfESToaa35e05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum 3D7 cDNA 5' similar...|BQ451076.1 PfESToab03e06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BQ577318.1 PfESToab17e07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BI670625.1 PfESToaa02c05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BU498204.1 PfESToab94b07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to

  19. Dicty_cDB: CHA143 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BI816026.1 PfESToaa35e05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum 3D7 cDNA 5' similar...|BQ451076.1 PfESToab03e06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BQ577318.1 PfESToab17e07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BI670625.1 PfESToaa02c05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...|BU498204.1 PfESToab94b07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to

  20. Dicty_cDB: SLJ890 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BU497898.1 PfESToab89g09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BQ739548.1 PfESToab47d01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU498278.1 PfESToab95b07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU498442.1 PfESToab97c07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BI670537.1 PfESToaa01b07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence

  1. Hepatitis B & C and HIV

    Science.gov (United States)

    ... Find Services HIV SERVICES LOCATOR Locator Search Search Hepatitis B & C Topics Hepatitis B Hepatitis C Hepatitis ... Infections Sexually Transmitted Diseases Smoking Women's Health Issues Hepatitis B Virus and Hepatitis C Virus Infection People ...

  2. Clinical findings in C5-C6 and C5-C7 root palsies with brachial plexus traction lesions.

    Science.gov (United States)

    Bertelli, J A; Ghizoni, M F

    2013-03-01

    Stretch injuries of the C5-C7 roots of the brachial plexus traditionally have been associated with palsies of shoulder abduction/external rotation, elbow flexion/extension, and wrist, thumb, and finger extension. Based on current myotome maps we hypothesized that, as far as motion is concerned, palsies involving C5-C6 and C5-C7 root injuries should be similar. In 38 patients with upper-type palsies of the brachial plexus, we examined for correlations between clinical findings and root injury level, as documented by CT tomomyeloscan. Contrary to commonly held beliefs, C5-C7 root injuries were not associated with loss of extension of the elbow, wrist, thumb, or fingers, but residual hand strength was much lower with C5-C7 vs C5-C6 lesions.

  3. Dicty_cDB: SFJ449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  4. Dicty_cDB: AFJ402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  5. Dicty_cDB: CFC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  6. Dicty_cDB: AFI273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  7. Dicty_cDB: CHE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  8. Dicty_cDB: CFE844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  9. Dicty_cDB: CHD258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  10. Dicty_cDB: SFD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  11. Dicty_cDB: SFI237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  12. Dicty_cDB: SFD673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  13. Dicty_cDB: SFJ795 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  14. Dicty_cDB: AFE889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  15. Dicty_cDB: SFL120 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  16. Dicty_cDB: SSD420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  17. Dicty_cDB: CFH515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  18. Dicty_cDB: AFA816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  19. Dicty_cDB: SFC277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  20. Dicty_cDB: AFI337 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  1. Dicty_cDB: CHB577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  2. Dicty_cDB: AFH834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  3. Dicty_cDB: SFA175 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  4. Dicty_cDB: SFE141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  5. Dicty_cDB: CFJ161 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  6. Dicty_cDB: CFH888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  7. Dicty_cDB: VFC328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mRNA sequence. 46 0...sc01b07.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-878 5', mRNA sequence. 46 0...sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-6285 5', mRNA sequence. 46 0...sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', mRNA sequence. 46 0...saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA sequence. 46 0

  8. Dicty_cDB: VSK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sq27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1046-2101 5' similar to WP:D1005...sad75f02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9XFY7...sc93f08.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' similar to WP:D1005.1...sm51c09.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-7433 5' similar to SW:ACLY_RAT...sk39d02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-4540 5' similar to WP:D1005

  9. Dicty_cDB: AFN656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sai84a09.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-7338 5' similar to TR:O65744

  10. Dicty_cDB: AFH224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 56 5e-06 2 AI437629...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  11. Dicty_cDB: SSL425 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available st34c12.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-888 5' similar to TR:Q40203...saj22d08.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-3615 5' similar to TR:Q40203...sr02d07.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1478 5' similar to TR:Q40203...saf89h03.y3 Gm-c1079 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1079-1134 5' similar to TR:Q40203...saf62g05.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-1065 5' similar to TR:Q40203

  12. Dicty_cDB: VFE739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sc01b07.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-878 5', mRNA sequence. 46 0...sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mRNA sequence. 46 0...sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-6285 5', mRNA sequence. 46 0...sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', mRNA sequence. 46 0...saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA sequence. 46 0

  13. Dicty_cDB: VFG265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sh46h12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4800 5' similar to TR:Q43637...sag05d03.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1080-173 5' similar to TR:Q9XHH0...sv14d06.y1 Gm-c1056 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1056-1716 5' similar to TR:Q9XHH0...sah19c09.y3 Gm-c1086 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1674 5' similar to TR:Q43637...st25a12.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-23 5' similar to TR:Q43637 Q43637

  14. Dicty_cDB: AFO611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' similar to TR:O65744

  15. Dicty_cDB: SFH229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sh46h12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4800 5' similar to TR:Q43637...sae30b10.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-4292 5' similar to TR:Q9XHH0...sah19c09.y3 Gm-c1086 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1674 5' similar to TR:Q43637...sag05d03.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1080-173 5' similar to TR:Q9XHH0...sv14d06.y1 Gm-c1056 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1056-1716 5' similar to TR:Q9XHH0

  16. Dicty_cDB: SFJ116 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 62 1e-05 1 AI437629...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  17. Dicty_cDB: AFK433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  18. Dicty_cDB: AFI123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 62 1e-05 1 AI437629...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744

  19. Dicty_cDB: SLI838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se51b09.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2418 5', mRNA sequence. 34 4e-04...ss71e08.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1062-1887 5' similar to TR:Q9S740...sb97c10.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-619 5', mRNA sequence. 34 7e-04...sh38b07.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-3950 5', mRNA sequence. 34 7e-04...sb65b12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-216 5', mRNA sequence. 34 8e-04

  20. Dicty_cDB: VFJ438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---XQMKVXAEXNKFGELKEIXEPSYXSXVTECKGVMXVVHLFENGIPQCQLVNQHLXIL AKKFKATKFVKIRSEEAIHNYPDKNLPTILVYF...Frame C: ---XQMKVXAEXNKFGELKEIXEPSYXSXVTECKGVMXVVHLFENGIPQCQLVNQHLXIL AKKFKATKFVKIRSEEAIHNYPDKNLPTILVYF

  1. Dicty_cDB: CHO570 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence IICVFLFVCFVLFCFVCFVFIPVINYFYFILFFLKMVFENGNSGNVKKTITSPNKSINGQ NHFNKVIKSTTSPIKSTIPTLSKTQSST...FGIVTPNXLXXSTXGKR Frame C: IICVFLFVCFVLFCFVCFVFIPVINYFYFILFFLKMVFENGNSGNVKKTITSPNKSINGQ NHFNKVIKSTTSPIKSTIPTLSKTQSST

  2. Dicty_cDB: SSI696 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence SINSEQQQDEEELEDEKKQLNDGSSSGGGDNFENGGDLEKEKEKDDDTDISKIESILNDD NDNDTTLNEIQQQQQQQQQQQQ...qftp--- Frame C: SINSEQQQDEEELEDEKKQLNDGSSSGGGDNFENGGDLEKEKEKDDDTDISKIESILNDD NDNDTTLNEIQQQQQQQQQQQQ

  3. Dicty_cDB: AFI865 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TRGGESTINEYPSA GVKIGNSLNLRKDGEFDLRIPIEANYSKNYSNHFENGVLTLTFKEEXKVSR Translated Amino Acid sequence (All...TRGGESTINEYPSA GVKIGNSLNLRKDGEFDLRIPIEANYSKNYSNHFENGVLTLTFKEEXKVSR Frame C: tiigyfkrgktftanlinninlps

  4. Dicty_cDB: VSE737 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---PVLFAGSIKDNITFGNDSATMDQIISAAEKANAHSFIEEFENGYDTIVGERGVRLSG GQKQRVAIARAMIQNPMILLLDEATSALDAESE...Frame C: ---PVLFAGSIKDNITFGNDSATMDQIISAAEKANAHSFIEEFENGYDTIVGERGVRLSG GQKQRVAIARAMIQNPMILLLDEATSALDAESE

  5. Dicty_cDB: VSD315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m cDNA clone cSTS6M7 5' sequence, mRNA sequence. 44 9e-16 5 BQ047062 |BQ047062.1 EST596180 P. infestans-challenged...589584.1 EST497426 P. infestans-challenged leaf Solanum tuberosum cDNA clone BPLI2C14 5' sequence, mRNA sequ

  6. Dicty_cDB: SLJ322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 BG732108 |BG732108.1 ps20c12.y4 Trichinella spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' simil...54 0.002 1 BG353063 |BG353063.1 ps20c12.y1 Trichinella spiralis ML CMVsport jasmer Trichinella spiralis cDNA

  7. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  8. Dicty_cDB: AFM354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NGXVVLXXXXIXXIHXF XQVXSVXXXXXX Frame B: ---vxxxqxxqarigxwxxxxxxkxxxxxxxxfxcwxxxcxlxmxwwffxxxx...yxxsixx fkxnqxxxxxx Frame C: ---xxxxrxxrqelxxgxxxxgxkxxvrxqxxxnvgxxxaxxxwxggslxxyxxfxpsix ssxisxxxxxx

  9. Dicty_cDB: AFL805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: ---rf*vkkkrfffxxgkkxkkxkxxxxxkxxxxxxxxxxxkxkxxxxkxsxxkkknk Frame B: ---GFRXKKKGFFLXXXKKXKNXKXXXXXKX...XXXXXXXXXXKXKXXXXKXPXEKKKIK Frame C: ---vlgxkkkvffxpwxkkxktkxxxxxxkxxxxxxxxxxxxkxxxxxkxxx

  10. Dicty_cDB: VFN130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XSSXXXTPKPKPKPKPTPTTSTPNLSAKSATNSPYKSSIRNASPQP TSKPK Frame B: ---xxxxxxxxxxxhhxxx...qhqnqnqnqnqhqqhqhqiyqpnqqqihhinhqlgmhhhnp hqnqn Frame C: ---xxxxxxnxxxxiixxxntktktktktntnnintkfisqisnkfti*ii

  11. Dicty_cDB: SSH728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ERILSISLTPAMERILSLEQEAQLIQWIEEEIDLNQTVTKDRIKKRVCTMFTERVGKPRD SVSDDWWLNFRNRHPEIK...kichfkkkkkk Frame C: ERILSISLTPAMERILSLEQEAQLIQWIEEEIDLNQTVTKDRIKKRVCTMFTERVGKPRD SVSDDWWLNFRNRHPEIK

  12. Dicty_cDB: VSA557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---nnsnfn*fwk*RYSMGNVTAFYPGSEEDLIGLEKSMKLVEALIEEEIKXGIPAERII LSGFSQGGALTLYTGYQSKHKLAALITLSGFSPSLS...C: ---nnsnfn*fwk*RYSMGNVTAFYPGSEEDLIGLEKSMKLVEALIEEEIKXGIPAERII LSGFSQGGALTLYTGYQSKHKLAALITLSGFSPSLS

  13. Dicty_cDB: SHF874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ILFFGMGSTLLLLNYCLGPNQDKFNPLAWLITLFGSFIIVFGSIRSDTILILDKKKENPR FIEEERLLSSSTXIKNIIEDSIDYNEIIINNGSXNY Translated Amino...ILFFGMGSTLLLLNYCLGPNQDKFNPLAWLITLFGSFIIVFGSIRSDTILILDKKKENPR FIEEERLLSSSTXIKNIIEDSIDYNEIIINNGSXNY Homology vs CSM-cDNA

  14. Dicty_cDB: SSB877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VVLVVLINNMVVLMVIKNNXNKVLILLILVLNLVVVVHNKHNSVNNNKQFKKKKN *kypkiskypki*n*kkkkknfqnyy*inlynn... C: NKVLMVVLVVLINNMVVLMVIKNNXNKVLILLILVLNLVVVVHNKHNSVNNNKQFKKKKN *kypkiskypki*n*kkkkknfqnyy*inlynn

  15. Dicty_cDB: SSF714 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HFMPHLKCKPYSDPRIINVSSVVGFNGDLMN RFPCYVSSKFALDGFTESISNDLKKYDIKCTTVKPGYFITPFNDHII--- Translated Amino Acid...HFMPHLKCKPYSDPRIINVSSVVGFNGDLMN RFPCYVSSKFALDGFTESISNDLKKYDIKCTTVKPGYFITPFNDHII--- Frame C: fllfklff

  16. Dicty_cDB: AFL686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IHMVKVHLQLTMQIQFNVKLLSRPDEPPEIL--- ---KEIGLKDQPDLSKILETLYIELNTYGESTFTVDDANTINVKLLSRPDEPPEILPHQV PVLVEEIDTTND...eiglkdqpdlskiletlyiel ntygestftvddanti*c*tie*tr*ttrdit--- ---KEIGLKDQPDLSKILETLYIELNTYGESTFTVDDANTINVKLLSRPDEPPEILPHQV

  17. Dicty_cDB: SHA189 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  18. Dicty_cDB: CHN840 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  19. Dicty_cDB: CHK742 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  20. Dicty_cDB: CHP520 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  1. Dicty_cDB: CHJ706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  2. Dicty_cDB: SHG607 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  3. Dicty_cDB: CHK704 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  4. Dicty_cDB: CHN414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  5. Dicty_cDB: CHM455 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  6. Dicty_cDB: SHJ790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  7. Dicty_cDB: CHE174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  8. Dicty_cDB: CHM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  9. Dicty_cDB: SHG537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  10. Dicty_cDB: SHL126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  11. Dicty_cDB: CHM552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  12. Dicty_cDB: SHJ838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  13. Dicty_cDB: SHA788 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  14. Dicty_cDB: CHR818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  15. Dicty_cDB: CHN863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  16. Dicty_cDB: CHH295 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  17. Dicty_cDB: SHE806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  18. Dicty_cDB: SHK285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  19. Dicty_cDB: SHE135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  20. Dicty_cDB: AFI606 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 Translated Amino Acid sequence HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQV LTLDG...sniqtliglgcsrdkairlltqakgnvdva Frame C: HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQV LTLDG

  1. Dicty_cDB: CHC309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  2. Dicty_cDB: CHC634 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  3. Dicty_cDB: CHC288 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  4. Dicty_cDB: CHC526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  5. Dicty_cDB: CHE290 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  6. Dicty_cDB: CHC281 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  7. Dicty_cDB: AFK555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  8. Dicty_cDB: CHD110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  9. Dicty_cDB: CHD807 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  10. Dicty_cDB: CHC140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  11. Dicty_cDB: CHC111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  12. Dicty_cDB: CHA610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  13. Dicty_cDB: CHE175 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  14. Dicty_cDB: CHC616 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  15. Dicty_cDB: AFI736 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  16. Dicty_cDB: AFK775 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  17. Dicty_cDB: CHD180 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  18. Dicty_cDB: CHE460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  19. Dicty_cDB: CHA777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  20. Dicty_cDB: CHA546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  1. Dicty_cDB: AFI163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  2. Dicty_cDB: CHD321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  3. Dicty_cDB: CHB575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  4. Dicty_cDB: AFI741 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  5. Dicty_cDB: CHA328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  6. Dicty_cDB: CHA891 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 021018ABCA005552HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA005552...021014ABCA004075HT (ABCA) Royal Gala fruit stored at 0.5 degrees C for 24 hours Malus x domestica cDNA clone ABCA004075

  7. Dicty_cDB: VFA461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence LISHIHTYTHTYILNIPLKKQYTNKTYIIMSTFPTSTIVHPTVLLSVVDHYNRVAKDTNK RVVGALLGSNN--- Translated Amino...Frame B: LISHIHTYTHTYILNIPLKKQYTNKTYIIMSTFPTSTIVHPTVLLSVVDHYNRVAKDTNK RVVGALLGSNN--- Frame C: *yhtyi

  8. Dicty_cDB: SLG608 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence IPQYPSLNDSSSNGNGTPALSSPSSTTPHPTTPHPTTPTSTPNQRFQSNGSSSFQNQLQN HLENKLSSFWSSQLRDIHKTE...knn*lnnltly*ylgk Frame C: IPQYPSLNDSSSNGNGTPALSSPSSTTPHPTTPHPTTPTSTPNQRFQSNGSSSFQNQLQN HLENKLSSFWSSQLRDIHKTE

  9. Dicty_cDB: AFM658 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXFLXGXFXGIYGXFXNAIXKKRTXXXNXNPRXXLXSKXXXIXRX XGGYWXFXLXRX Frame B: ---txfgxxxxslatgvflxaxsxxfmvx...sxmxfxkkgxaixtktxgpfyxxxgplslgx mvvigxsxxlg Frame C: ---xglvxxvxxwxqxfsxgxxqxxlwfxxqcxskkkdx

  10. Dicty_cDB: SLJ806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---DGIWDVISDEEAVSIAAPIADPEKACIKLRDQAFSRGSTDNISVIVIRFPPFLEGI* kknkknkkkkikeieln Translated Amino Acid...B: ---DGIWDVISDEEAVSIAAPIADPEKACIKLRDQAFSRGSTDNISVIVIRFPPFLEGI* kknkknkkkkikeieln Frame C: ---mvfgmlsl

  11. Dicty_cDB: SHB466 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N BU746157 |BU746157.1 CH3#002_C07T7 Canine heart normalized cDNA Library in pBluescriptCanis familiaris...030 2 BU746156 |BU746156.1 CH3#002_C07T3 Canine heart normalized cDNA Library in pBluescript Canis familiaris

  12. Dicty_cDB: VHA684 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N BU746157 |BU746157.1 CH3#002_C07T7 Canine heart normalized cDNA Library in pBluescriptCanis familiaris...043 1 BU746156 |BU746156.1 CH3#002_C07T3 Canine heart normalized cDNA Library in pBluescript Canis familiaris

  13. Dicty_cDB: SHF448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CV428924.1 EST02153 Atlantic salmon Lambda Zap Express heart cDNA library Salmo salar cDNA clone hr_004_h06 5'...CK882927 |CK882927.1 SGP147615 Atlantic salmon Heart cDNA library Salmo salar cDNA clone H6-0590, mRNA

  14. Dicty_cDB: VFH449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GSILTGWLATFXVFDIDGKYNDNLILWWSNKDKKYXWPRVNGDSIPNGF XSAPIKLIQGEIQYNRTIYSGHFGSKLLDXNSKLXPSLDWFIIAKLL*nenfp...FDIDGKYNDNLILWWSNKDKKYXWPRVNGDSIPNGF XSAPIKLIQGEIQYNRTIYSGHFGSKLLDXNSKLXPSLDWFIIAKLL*nenfpv Frame C: ptgniti

  15. Dicty_cDB: SSM443 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence TVQDRKYIYDNPLPTGISPYSELFSENKLHTXKKQSTTSSHQNQPWKPSLKXTTSIQDNC HKITKNTTFRPISPPPPKPNFY---...DKSEKTTPLSVVVSQ*kk Frame C: TVQDRKYIYDNPLPTGISPYSELFSENKLHTXKKQSTTSSHQNQPWKPSLKXTTSIQDNC HKITKNTTFRPISPPPPKPNFY---

  16. Dicty_cDB: VSG401 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence *RDKVEEIEEQEEEEEEYSIIFKIIKKVNNNKQQQEINDNSELFFKLLKNQYIKKK--- ---LKEDKVEEIEEQEEEEEEYSIIFKIIKKVNNNKQQQEIN...Frame C: *RDKVEEIEEQEEEEEEYSIIFKIIKKVNNNKQQQEINDNSELFFKLLKNQYIKKK--- ---*kkikskklkskkkkkknivlflkl*kkliiinnnkkl

  17. Dicty_cDB: AFH152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 80 4e-19 2 CF211274 |CF211274.1 CAB20007_IVa_Ra_C07 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera c...DNA clone CAB20007_IVa_Ra_C07 3', mRNA sequence. 78 4e-18 3 CF211191 |CF211191.1 CAB20007_IVa_Fa_C07 Caberne

  18. Dicty_cDB: CHA105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73-367476 strain AX4, complete sequence. 38 0.39 6 BE317387 |BE317387.2 NF068C10LF1F1070 Developing...49770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA sequence. 36 0.5

  19. Dicty_cDB: CHF675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 48 0.15 1 BG453581 |BG453581.1 NF092A07LF1F1050 Developing leaf Medicago truncatula cDNA...15 1 BG453480 |BG453480.1 NF092C08LF1F1055 Developing leaf Medicago truncatula cDNA clone NF092C08LF 5', mRN

  20. Dicty_cDB: SFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124-6045772 strain AX4, complete sequence. 34 0.50 7 BE317387 |BE317387.2 NF068C10LF1F1070 Developing leaf M...249770 |BE249770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA seque

  1. Dicty_cDB: SSL148 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence KPNLYIYIFNKKKKKKKTNYSKKMTXTNIDINSLNIKEKEEKEEGLIKDKSKKELKKLQK QQYKQQKKQEKKNNKVNKVINEGVP...ktl*iisc**slfti--- Frame C: KPNLYIYIFNKKKKKKKTNYSKKMTXTNIDINSLNIKEKEEKEEGLIKDKSKKELKKLQK QQYKQQKKQEKKNNKVNKVINEGVP

  2. Dicty_cDB: AFI546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IGESDRIGVFPSNFISDSSDSSKKRVDVAGRKCKV LYDYRTDCEGELNIKEGEILTIEYPHEGWPFGSN Translated Amino Acid sequence...IGESDRIGVFPSNFISDSSDSSKKRVDVAGRKCKV LYDYRTDCEGELNIKEGEILTIEYPHEGWPFGSN Frame C: ---xxnxdhnnnnylnqln*

  3. Dicty_cDB: SHE823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ---VDKMFTATGESRFPIIVEGANLFFTQKARLMIEEKGAIIFKDASANKGGVTSSSLEV LAALALNDEEF...qnhtl klslvlinxssv Frame C: ---VDKMFTATGESRFPIIVEGANLFFTQKARLMIEEKGAIIFKDASANKGGVTSSSLEV LAALALNDEEF

  4. Dicty_cDB: SHE719 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---NPLCNADIFVPCGGRPESVQLTNVDKMFTATGESRFPIIVEGANLFFTQKARLMIEE KGAIIFKDASANKGGVTSSSLEVLAALALNDEEF...Frame C: ---NPLCNADIFVPCGGRPESVQLTNVDKMFTATGESRFPIIVEGANLFFTQKARLMIEE KGAIIFKDASANKGGVTSSSLEVLAALALNDEEF

  5. Dicty_cDB: CHR279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---NPLCNADIFVPCGGRPESVQLTNVDKMFTATGESRFPIIVEGANLFFTQKARLMIEE KGAIIFKDASANKGGVTSSSLEVLAALALNDEEF...Frame C: ---NPLCNADIFVPCGGRPESVQLTNVDKMFTATGESRFPIIVEGANLFFTQKARLMIEE KGAIIFKDASANKGGVTSSSLEVLAALALNDEEF

  6. Dicty_cDB: CFH749 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 949067E10.y2 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, ...leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence. 42 7e-11 4 dna update 2004. 2. 2 Homology

  7. Dicty_cDB: SLF664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---SLIKEIEKANYNIFKDLKDNYGEPTIEKLNELRYKFNDAARESREVIKNKIESAQAI EQELAKNLKKPHADSNGHPKPYPHHHLLNQENQIDENLIIV*kki...Frame C: ---SLIKEIEKANYNIFKDLKDNYGEPTIEKLNELRYKFNDAARESREVIKNKIESAQAI EQELAKNLKKPHADSNGHPKPYPHHHLLNQENQIDENLIIV*kki

  8. Dicty_cDB: SLD371 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) tag22f08.y1 Hydra EST -Kiel 1 Hydra vulgaris cDNA... 38 1.3 2 ( DN302284 ) PL04025A2C08 cDNA from sexually... mature hermaphodi... 34 3.2 2 ( DN308666 ) PL05017A2B08 cDNA from sexually mature hermaphodi... 34 3.2 2 d

  9. Dicty_cDB: VFK428 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BF187223.1 EST443510 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39F1 5' sequence...|BE353311.1 EST400443 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT35N21, mRNA

  10. Dicty_cDB: VSB541 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST339456 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD5A23 5'...EST339530 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD5A22 5'

  11. Dicty_cDB: AFI839 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ18J22...EST338844 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD3K19 5'

  12. Dicty_cDB: VFG165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE471638.1 EST416491 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA29J22, mRNA...|BE343505.1 EST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA

  13. Dicty_cDB: SSA535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW617320.1 EST323731 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT22J19 5'...|BE339651.1 EST343708 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA7N10 similar

  14. Dicty_cDB: AFL147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE471638.1 EST416491 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA29J22, mRNA...|BE343505.1 EST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA

  15. Dicty_cDB: SSE265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BF187220.1 EST443507 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39D17 5' sequence...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5'

  16. Dicty_cDB: VSD536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST353640 tomato flower buds 0-3 mm, Cornell University Lycopersicon esculentum cDNA clone cTOA18I21...|BF187223.1 EST443510 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39F1 5' sequence

  17. Dicty_cDB: VFF687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE471638.1 EST416491 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA29J22, mRNA...|BE343505.1 EST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA

  18. Dicty_cDB: SSK787 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA35F24, mRNA...EST401784 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY15H11

  19. Dicty_cDB: CFJ845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST321699 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB13E3 5'...EST402393 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY19A14

  20. Dicty_cDB: SLK886 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST321661 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB11J18...EST312013 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX11M3 5'

  1. Dicty_cDB: VFA826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST339326 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD4J9 5'...EST355849 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD10L12

  2. Dicty_cDB: SSK156 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ11O16...EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21

  3. Dicty_cDB: AFF281 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST338521 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD2E1 5'...EST339369 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD4B20 5'

  4. Dicty_cDB: SSK654 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5'...|BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA35F24, mRNA

  5. Dicty_cDB: SHD580 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST339280 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD4B5 5'...EST339284 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD4B15 5'

  6. Dicty_cDB: SHL729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 200704.1 PEG002-C-111796-501 Normalized Pedal-Pleural Ganglia Aplysia californica cDNA clone PEG002-C-111796... 5', mRNA sequence. 44 4.7 1 EB189322 |EB189322.1 PEG001-C-009321-501 Non-Normalized Pedal

  7. Dicty_cDB: VHA409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |EB223488.1 PEG002-C-104408-501 Normalized Pedal-Pleural Ganglia Aplysia califor...nica cDNA clone PEG002-C-104408 5', mRNA sequence. 44 0.44 2 EB238172 |EB238172.1 PEG003-C-223796-501 Normalized Pedal

  8. Dicty_cDB: VSA723 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence ---SEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKXIQ NMDPHELYTYAKEIQAPLE...kinnfyfyyfflkkkkkk Frame C: ---SEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKXIQ NMDPHELYTYAKEIQAPLE

  9. Dicty_cDB: AFK713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cD...NA clone NXLV_039_C04 5', mRNA sequence. 46 0.018 2 BM158719 |BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical

  10. Dicty_cDB: CHL380 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stercoralis cDNA 5' similar to WP:C41C4.8 CE05402 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA...ratti cDNA 5' similar to SW:TER2_CAEEL P54812 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA

  11. Dicty_cDB: SHJ572 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ratti cDNA 5' similar to SW:TER2_CAEEL P54812 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA...stercoralis cDNA 5' similar to WP:C41C4.8 CE05402 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA

  12. Dicty_cDB: VFD775 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ASAGVACKLDSDGYKALGKATSXILGSL TPVATCGTLPLVRDLQDSGFDIQITGFGKEETYHADNEYALLSDFKNAIKIL Translated Amino Acid...ASAGVACKLDSDGYKALGKATSXILGSL TPVATCGTLPLVRDLQDSGFDIQITGFGKEETYHADNEYALLSDFKNAIKIL Frame C: ---evhtvn

  13. Dicty_cDB: VFM632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mino Acid sequence cwptglqalkkmnksilllvlvivsiigsidskkvfnvrtdlknqlkfrhfddsldydai nyqwftqsvdhfnpanpttfqqrylindqywdgtgpvfimingegpmdi...HNKLFXIHPS Frame C: cwptglqalkkmnksilllvlvivsiigsidskkvfnvrtdlknqlkfrhfddsldydai nyqwftqsvdhfnpanpttfqqrylindqywdgtgpvfimingegpmdi

  14. Dicty_cDB: CHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence FCFQQVCSATDGDVCTTVPLNCDDGLQCTVDSCIGPMGVCSHIAIAPKCLECALEPCITT DNCQPVICGPDGRCIQETIEDFCDDYNYCTV...Frame C: FCFQQVCSATDGDVCTTVPLNCDDGLQCTVDSCIGPMGVCSHIAIAPKCLECALEPCITT DNCQPVICGPDGRCIQETIEDFCDDYNYCTV

  15. Dicty_cDB: SFF439 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VEKMKNANAFCPKFCDNCTSKKVTRKCETCSISLCKACESSHVAKNGGHKTIYSDSHIAS DFDIETHINKDSDIDPPTYLPFTH--- Translated Amino Acid...VEKMKNANAFCPKFCDNCTSKKVTRKCETCSISLCKACESSHVAKNGGHKTIYSDSHIAS DFDIETHINKDSDIDPPTYLPFTH--- Frame B: yryrf**c*

  16. Dicty_cDB: CHN775 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kvdqhekeccvvahrpppkcslrcppkhecrinhfgeeccvks rxdcltcedlncerkglhcamktvpxikkivgk Tra...vvahrpppkcslrcppkhecrinhfgeeccvks rxdcltcedlncerkglhcamktvpxikkivgk Frame C: ysilflinsn*kkkq*ltklkikk**RMLFL

  17. Dicty_cDB: CHO823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ckvdqhg keccvvahrpppkcslrcpprhecrvnhfgeeccvkvhhdkcslrcppgheckvdqhgke ccvvahrpppkxslrcppkhecrinhfgeeccvksrndcltcedlncerkglhcamk...rpppkxslrcppkhecrinhfgeeccvksrndcltcedlncerkglhcamktvp xikkiv Frame C: ysilflinsn*kkkq*ltklkikk**RMLFXKNIGVF

  18. Dicty_cDB: CHJ870 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available heckvdqhgkeccvvahrpppkcslrcpprhecrvnhfgeeccvkvhhd kcslrcppgheckvdqhgkeccvvahrpppkcslrcppkhecrinhfgeeccvksrndcl tcedlncerkglhcamk...hd kcslrcppgheckvdqhgkeccvvahrpppkcslrcppkhecrinhfgeeccvksrndcl tcedlncerkglhcamktvpidkencwkk Frame C: aywxl

  19. Dicty_cDB: CHJ796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available us gallus multi-tissues normalized and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (M13R primer...ed and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 36 0.47 2 AF239838

  20. Dicty_cDB: CHN738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (M13R primer...gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 44 0.39 2 AC150654 |AC150654.2 Oryza sativa (japonica c

  1. Dicty_cDB: CHQ872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i-tissues normalized and once-subtracted cDNA library (gcal) clone gcal0007c.b.20, 5prim end (M13R primer). ...ed and once-subtracted cDNA library (gcal) clone gcal0007c.b.20, 3prim end (M13F primer

  2. Dicty_cDB: SSA438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence ---TTGAYIANRVTNKITPIHERIYCCRSGSAADTQAISDYVRYYLEMHTSELCDEPDVK TAASLFQLLCYSNKNNLMAGI...kkkkkkkk Frame C: ---TTGAYIANRVTNKITPIHERIYCCRSGSAADTQAISDYVRYYLEMHTSELCDEPDVK TAASLFQLLCYSNKNNLMAGI

  3. Dicty_cDB: CHK605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM604216 |BM604216.1 17000687073620 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449730833 5'...BM587162 |BM587162.1 17000668409583 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600448420536 5'

  4. Dicty_cDB: VSF534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM610799 |BM610799.1 17000687113252 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449715249 5'...BM600478 |BM600478.1 17000687054213 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449701959 5'

  5. Dicty_cDB: SSA650 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM608903 |BM608903.1 17000687086872 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449690492 5'...BM595657 |BM595657.1 17000687475903 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449718151 5'

  6. Dicty_cDB: VSJ822 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM598953 |BM598953.1 17000687687906 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449701710 5'...BM602820 |BM602820.1 17000687071842 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449709881 5'

  7. Dicty_cDB: SHE546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  8. Dicty_cDB: SHC648 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  9. Dicty_cDB: SFH188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM608464 |BM608464.1 17000687086466 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449703472 5'...BM582892 |BM582892.1 17000687277215 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449716301 5'

  10. Dicty_cDB: SSH695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM577635 |BM577635.1 17000659322446 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600447013605 5'...BM600381 |BM600381.1 17000687053817 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449716431 5'

  11. Dicty_cDB: AFH332 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM610376 |BM610376.1 17000687110678 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449712509 5'...BM608903 |BM608903.1 17000687086872 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449690492 5'

  12. Dicty_cDB: SLI833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM609231 |BM609231.1 17000687087868 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449680268 5'...BM584018 |BM584018.1 17000687279674 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449685532 5'

  13. Dicty_cDB: VSG809 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM593534 |BM593534.1 17000687443509 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449692125 5'...BM597148 |BM597148.1 17000687490356 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449717891 5'

  14. Dicty_cDB: VSG554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM600102 |BM600102.1 17000687050893 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449733231 5'...BM585066 |BM585066.1 17000687283198 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449687707 5'

  15. Dicty_cDB: VSF284 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM605098 |BM605098.1 17000687075777 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449716696 5'...BM602053 |BM602053.1 17000687068891 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449722729 5'

  16. Dicty_cDB: SSA767 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM597672 |BM597672.1 17000687500233 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449708554 5'...BM606412 |BM606412.1 17000687083330 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449709088 5'

  17. Dicty_cDB: VSA317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM615669 |BM615669.1 17000687147375 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449732747 5'...BM609776 |BM609776.1 17000687107051 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449692879 5'

  18. Dicty_cDB: VSA312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM594030 |BM594030.1 17000687444142 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449728440 5'...BM606698 |BM606698.1 17000687084185 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449696728 5'

  19. Dicty_cDB: CHM571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM609491 |BM609491.1 17000687102146 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449695402 5'...BM586532 |BM586532.1 17000687317957 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449731812 5'

  20. Dicty_cDB: VSD568 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM611355 |BM611355.1 17000687114723 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449726382 5'...BM617899 |BM617899.1 17000687160107 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449701204 5'

  1. Dicty_cDB: SHB489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  2. Dicty_cDB: SHC385 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  3. Dicty_cDB: VSC853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM580362 |BM580362.1 17000687242479 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449691255 5'...BM596501 |BM596501.1 17000687479278 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449711548 5'

  4. Dicty_cDB: VHP287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XYXGHHGEEFEMGXVFVH QVIHTIEFVXGAVSNXASHXRLWAXSLAXSEXXSVXXERIXIGQVXRGNPFLA Translated Amino Acid sequence...XYXGHHGEEFEMGXVFVH QVIHTIEFVXGAVSNXASHXRLWAXSLAXSEXXSVXXERIXIGQVXRGNPFLA Frame C: ---sfpfqlxwslnhcs*

  5. Dicty_cDB: CHP326 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Alexandrium tamarense cDNA cloneUI-D-GC1-aau-c-07-0-UI 3', mRNA sequence. 30 0.002 3 DT338982 |DT338982.1 JBW092C02.b_012.abi Pineap...ple week 5-10 nematode-infected gall cDNA library Ananas

  6. Dicty_cDB: VSJ102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---THXSEELKQXXLLSQIIRXNINSPTIIDTPSVLXQYQQPQLQQPQQPQQPQQQDQEE FNPIMSIPMVPIMPNNTNNXITNKK Translated Amino Acid sequence...---THXSEELKQXXLLSQIIRXNINSPTIIDTPSVLXQYQQPQLQQPQQPQQPQQQDQEE FNPIMSIPMVPIMPNNTNNXITNKK Frame C: TIPHGVVVKSMELLYFIFT

  7. Dicty_cDB: CHR196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VAAKISDSDKSTIESETESVLKWLESNQTAEKD EYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDE Translated Amino...VAAKISDSDKSTIESETESVLKWLESNQTAEKD EYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDE Frame C: ---skk

  8. Dicty_cDB: SFI213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfse Translated...SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfse Frame C:

  9. Dicty_cDB: SHE817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTPPVSTTPKPTQPVSKFGAKLSANSAVAEAIARN MGGGAPPIRKPVAPEPEPEPVTPTKDVTPLKSKPVVAPRSTPTTSTPTK Translated Amino...TTTPPVSTTPKPTQPVSKFGAKLSANSAVAEAIARN MGGGAPPIRKPVAPEPEPEPVTPTKDVTPLKSKPVVAPRSTPTTSTPTK Frame C: cwpt

  10. Dicty_cDB: VSF850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mino Acid sequence ktiqkppqqndffsspqqnnnnnnnnifgndpfnfnsspqqpqqppqqqqqqnnnnsnnr nnnnsfdgfgdfsdfgnksnnsnnnsfg...tttk**sxrfn Frame C: ktiqkppqqndffsspqqnnnnnnnnifgndpfnfnsspqqpqqppqqqqqqnnnnsnnr nnnnsfdgfgdfsdf

  11. Dicty_cDB: CHL540 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TSKGGYTLQCSTYQIGVLLQFNQYETLTSEEIQESTQLIDSVLKGTLTSLAKSKILLADP PLDDEEIAKTTKFSLNKQFKNKKTKIFINVXX*k Translated...TSKGGYTLQCSTYQIGVLLQFNQYETLTSEEIQESTQLIDSVLKGTLTSLAKSKILLADP PLDDEEIAKTTKFSLNKQFKNKKTKIFINVXX*k Frame C:

  12. Dicty_cDB: SFB460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence NNFFLFFYINNIKMISLEDLSPTLWKSPDKEGELKKQGHVVKNWKKRKFIIQNDMLFYFK DKEERPVGAVPLRMSRCYENK...plipsrkx Frame C: NNFFLFFYINNIKMISLEDLSPTLWKSPDKEGELKKQGHVVKNWKKRKFIIQNDMLFYFK DKEERPVGAVPLRMSRCYENK

  13. Dicty_cDB: SFA328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVE ISHIAKLIDLPVDVVERKLSLMILDKKCNGILDQGTGTLIVFEEQKXDKLFN Translated Amino...LSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVE ISHIAKLIDLPVDVVERKLSLMILDKKCNGILDQGTGTLIVFEEQKXDKLFN Frame C: ---

  14. Dicty_cDB: VHG145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LVQHTHELEVSHQLGSPXYFMPH VGQXFQGITLTXSMELKYPMTKEQVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHXCYN WWF Translated Amino...LVQHTHELEVSHQLGSPXYFMPH VGQXFQGITLTXSMELKYPMTKEQVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHXCYN WWF Frame C: --

  15. Dicty_cDB: VFE514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VSQPQEDIVNRE--- ---VGAEAVXAKANXIDNNLHIXESAAAIKGAVVERANALDERFQISGFFKSASDMISQQ ASNLMKAAEENSTVSPIVNKVSSFGXFI...c*sttrrhck*r--- ---VGAEAVXAKANXIDNNLHIXESAAAIKGAVVERANALDERFQISGFFKSASDMISQQ ASNLMKAAEENSTVSPIVNKVSSFGXFI

  16. Dicty_cDB: VHJ363 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LVQHTHELEVSHQLGSPXYFMPHVGQXFQGIT LTXSMELKYPMTKEQVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHTVT Translated Amino...LVQHTHELEVSHQLGSPXYFMPHVGQXFQGIT LTXSMELKYPMTKEQVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHTVT Frame C: ---vpii

  17. Dicty_cDB: VHJ207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NDPTRXSDNXLPYKLVQHTHELEVSHQLGSPXYFMPHVGQFFQGITLTISMELKYPMTKE QVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHTVT Translated Amino...NDPTRXSDNXLPYKLVQHTHELEVSHQLGSPXYFMPHVGQFFQGITLTISMELKYPMTKE QVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHTVT Frame C: ---rnqs

  18. Dicty_cDB: AHA254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LVQHXHELEVSHQLGSPXY FMPHVGQFFQGITLTISMELKYPMTKEQVVERYQKFYQNEPLIKIDXDGIPEVKSNSGKH Translated Amino Acid...LVQHXHELEVSHQLGSPXY FMPHVGQFFQGITLTISMELKYPMTKEQVVERYQKFYQNEPLIKIDXDGIPEVKSNSGKH Frame C: ---wriqvnh

  19. Dicty_cDB: VFI342 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GYLDSSYGDHTKFSTIDFKEISDIIQSNVNGFDDIPNVEFVIQSPQDKLENKVISRVVER GNGETLACGTGACGVAISSILKGYCNENTEITV Translated Amino...GYLDSSYGDHTKFSTIDFKEISDIIQSNVNGFDDIPNVEFVIQSPQDKLENKVISRVVER GNGETLACGTGACGVAISSILKGYCNENTEITV Frame C: ---y

  20. Dicty_cDB: CHC775 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---NXSLVGDSAGGNMXIVLGLMAKVRNGPSFKRICLYYPAIDSGMNSGSYKEFHNDFYL TKDGMKWFWDAYTNSPKDTNEIYCSPSKCKE...Frame C: ---NXSLVGDSAGGNMXIVLGLMAKVRNGPSFKRICLYYPAIDSGMNSGSYKEFHNDFYL TKDGMKWFWDAYTNSPKDTNEIYCSPSKCKE

  1. Dicty_cDB: VSG669 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence RVRTKQTVQQIPLLTVKAGPRDGDKWIDRLKEEYQALIKYVEINKKADNDWFNIESNPLG TRWQGKCWYIYNFKKYEFDLEFDMPVTYPET...Frame C: RVRTKQTVQQIPLLTVKAGPRDGDKWIDRLKEEYQALIKYVEINKKADNDWFNIESNPLG TRWQGKCWYIYNFKKYEFDLEFDMPVTYPET

  2. Dicty_cDB: CHF413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yncnynrn Frame C: ---ssxaasxspssxaasxspssxaassspssxassssspsssassssapsssassssap sssassssassssassaattaattiatta...LQLQPQ Frame B: ---iixccklfsifxccklfsifxccklfpifxciiklfpificiiklcpificiiklcs ificiificiificiicsnyscnyncnyscn

  3. Dicty_cDB: VHO349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TVTVSVLFLPKVWMILSGQQHSMDSIGTSMDSMG RSNGNTTEAESTRGYTNKDYNNQSVGRSFSAHATGFKDVAPSXHPQLGIVXTGGDNFPRV GSSQXAASRSEA...AHATGFKDVAPSXHPQLGIVXTGGDNFPRV GSSQXAASRSEAEINX Frame C: ---fyfkr*sncnycxstxlqfyldlqlqyqyfsyqrfg*fylvnniqwiq

  4. Dicty_cDB: SSB287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C824178 ) SME00004148 esmbsro2 Sawyeria marylandensis cDNA,... 36 0.003 3 ( CZ931291 ) 249206 Tomato EcoRI B...76 1 ( C93938 ) Dictyostelium discoideum slug cDNA, clone SSL884. 504 e-148 2 ( E

  5. Dicty_cDB: SFC166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YDIGIWSQTSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHN VKALEVIWKHQHLGKFFSMKNTLHVDDLSKNFAM Translated Amino Acid...YDIGIWSQTSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHN VKALEVIWKHQHLGKFFSMKNTLHVDDLSKNFAM Frame C: ---nhyqfkii

  6. Dicty_cDB: SFF548 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DIGIWSQTSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHNV KALEVIWKHQHLGKFFSMKNTLHVDDLSKNFAMNPKN Translated Amino...DIGIWSQTSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHNV KALEVIWKHQHLGKFFSMKNTLHVDDLSKNFAMNPKN Frame C: ---hyqf

  7. Dicty_cDB: CFC336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GIWSQTSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHNVKA LEVIWXHQHLGKFFSMKNXXHVDDLSKNFAMNPKNGV Translated Amino...GIWSQTSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHNVKA LEVIWXHQHLGKFFSMKNXXHVDDLSKNFAMNPKNGV Frame C: ---nv

  8. Dicty_cDB: CFF647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHNVKALEVIW KHQHLGKFFSMKNTLHVDDLSKNFAMNPKN Translated Amino...TSWKWIEIKLTELGLLTNPRFKICFVMDQTLMFKVTTYRTINGKERTKIKHNVKALEVIW KHQHLGKFFSMKNTLHVDDLSKNFAMNPKN Homology vs CSM-cDNA

  9. Dicty_cDB: CHJ680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iveeivalqpeeilevlqvvpvlqeviavg*qea llevivavllevivavllevivavllevivevllxphrxrslyvlxpvrqxlxlxxxaaa xpnxgxxtgaxxxxax...xpnxgxxtgaxxxxax Frame C: ---xviaavlleviagvlreaivevxqvvxvevllkeivevxvvxhlqeviagwlxggat ggnsggatggnsggcnr

  10. Dicty_cDB: VSD732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c*qssfrfwlfry**ryyaih i*n*c*ysn*tcfnkhekhc*scwfingksc*nyhliking*fpsc*hclfyl*vftin...kscs*nh*ctrcywpiqssnyc*qssfrfwlfry**ryyaih i*n*c*ysn*tcfnkhekhc*scwfingksc*nyhliking*fpsc*hclfyl*vftind lln*...drkscs*nh*ctrcywpiqssnyc*qssfrfwlfry**ryy aihi*n*c*ysn*tcfnkhekhc*scwfingksc*nyhliking

  11. Dicty_cDB: VFK513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MTELITSILNSINHNSHXG MSNQKKQQIQAKVNQIKKTDLVVKRQQDIDTLCANKIQHNYNEIVAYRLRSISSLLDSKY ...ls*scscclsnksfpkitfklkt kk Frame C: lkykkkrnknil*MAELTNHFNKVNELLNDWDGVGLSHELSMTELITSILNSINHNSHXG MSNQKKQQIQAKVNQIKKTDLVVKRQQDIDTLCAN

  12. Dicty_cDB: SSE647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FLQDGSSSLNSASQQGS GSSSSGSNEPTKQHFTYVTGPVLSAYLIISILLAILFTGICCISDLQVPDRYEAPKSKVL *kkkkkkkkkkk Translated...FLQDGSSSLNSASQQGS GSSSSGSNEPTKQHFTYVTGPVLSAYLIISILLAILFTGICCISDLQVPDRYEAPKSKVL *kkkkkkkkkkk Frame C:

  13. Dicty_cDB: SSK304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FLQDGSSSLNSASQQGS GSSSSGSNEPTKQHFTYVTGPVLSAYLIISILLAILFTGICCISDLQVPDRYEAPKSKVL *kkkkkkkkkkkk Translated...FLQDGSSSLNSASQQGS GSSSSGSNEPTKQHFTYVTGPVLSAYLIISILLAILFTGICCISDLQVPDRYEAPKSKVL *kkkkkkkkkkkk Frame C:

  14. Dicty_cDB: AFJ532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QAWXXGVNXIGDDIANTAHXVG DGXANTAR*vgdgixipaxegyxlikxgaextwvxky*rlsxikixkaqqrmaxqxxxxr fmqxxsxxrrlqxnxxrxe Tran...sxikixkaqqrmaxqxxxxr fmqxxsxxrrlqxnxxrxe Frame C: INYFFYLHYIQFNFINFLMAKLKIIIYIVII

  15. Dicty_cDB: CHI403 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *ttrkiestk*stxrkklk* nknnqkqnsnn Frame C: nnnnnnnnnninninninininntntntntntnininnnninnkpnnnnhtytniinndi ntintnnnxndxnxxnxxnxxxxxnxx...xxxnxxnxxxxxxxxndx--- ---TQENNQENNQENNQENKNNQSKIQQEQNEKQEQNEKQEVNEKQEVNEKQEVNEKQEL NEK

  16. Dicty_cDB: VSH826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence HIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLG MRHFHLLRNQYHCPTVSLEKIWTLVPESVRK...Frame C: HIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLG MRHFHLLRNQYHCPTVSLEKIWTLVPESVRK

  17. Dicty_cDB: VHG250 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence SVSHIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFG KLGMRHFHLLRNQYHCPTVSLEKIWTLVPESVRK...Frame C: SVSHIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFG KLGMRHFHLLRNQYHCPTVSLEKIWTLVPESVRK

  18. Dicty_cDB: VSH782 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKK--- ---KMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKL GMRHFHLLRNQYHCPTVSLEKIWTLVPESVRK... Frame C: kmptrfskhrksrgdvcagygrvgkhrkhpggrgnagglthhrinfdkyhpgyfgklgmr hfhllrnqyhcptvslekiwtlvpesvrk...*kk--- ---KMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKL GMRHFHLLRNQYHCPTVSLEKIWTLVPESVRK

  19. Dicty_cDB: VSE309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence HIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLG MRHFHLLRNQYHCPTVSLEKIWTLVPESVRK...Frame C: HIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLG MRHFHLLRNQYHCPTVSLEKIWTLVPESVRK

  20. Dicty_cDB: VSG689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence MPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLGMRH FHLLRNQYHCPTVSLEKIWTLVPESVRK...- Frame C: MPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLGMRH FHLLRNQYHCPTVSLEKIWTLVPESVRK