
Sample records for actinium c

  1. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  2. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    International Nuclear Information System (INIS)

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  3. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Spectroscopic and computational investigation of actinium coordination chemistry. (United States)

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes


    Fry, C; Thoennessen, M


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources. (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R


    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    International Nuclear Information System (INIS)

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  8. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    International Nuclear Information System (INIS)

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  10. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    International Nuclear Information System (INIS)

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  11. A new method for the determination of low-level actinium-227 in geological samples

    International Nuclear Information System (INIS)

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  13. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  14. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    International Nuclear Information System (INIS)

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL (United States)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    International Nuclear Information System (INIS)

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  17. Beginning C

    CERN Document Server

    Horton, Ivor


    Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

  18. Vitamin C (United States)

    Vitamins are substances that your body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for ... promotes healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources ...

  19. Vitamin C (United States)

    ... body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for your ... healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources include ...

  20. Hepatitis C (United States)

    ... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

  1. Professional C++

    CERN Document Server

    Gregoire, Marc; Kleper, Scott J


    Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

  2. Balanced {C_4, C_5}-Quatrefoil Systems


    Ushio, Kazuhiko


    In graph theory, the decomposition problems of graphs are very important topics. Various types of decompositions of many graphs can be seen in the literature of gaph theory. We give the necessary and sufficient condition for the existence of a balanced {C_4, C_5}-quatrefoil decomposition of K_n for each of (C_4, C_4, C_4, C_4)-quatrefoil, (C_4, C_4, C_4, C_5)-quatrefoil, (C_4, C_4, C_5, C_5)-quatrefoil, (C_4, C_5, C_5, C_5)-quatrefoil, and (C_5, C_5, C_5, C_5)-quatrefoil. These decompositions...

  3. C++ Cookbook

    CERN Document Server

    Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff


    Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't

  4. Professional C++

    CERN Document Server

    Gregoire, Marc


    Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,

  5. -C Refractories (United States)

    Xu, Yibiao; Sang, Shaobai; Li, Yawei; Ren, Bo; Zhao, Lei; Li, Yuanbing; Li, Shujing


    Al2O3-C refractories were first fabricated in a coke bed at 1673 K (1400 °C) using tabular corundum, reactive alumina, carbon black, silicon, and microsilica as the starting materials and phenol resin as the binder. Then the alkali attack resistance of those materials was conducted in the powder mixture of carbon black and potassium carbonate (1:1 wt pct) in a graphite crucible at 1273 K (1000 °C) for 10 hours. The correlation between pore size, permeability of Al2O3-C refractories, and their alkali (K2CO3) attack was investigated by means of mercury intrusion porosimetry, X-ray diffraction (XRD), and scanning electron microscopy (SEM). The results showed that the pore structure of Al2O3-C refractories was controlled by the addition of silicon, ultrafine reactive alumina, and microsilica to in-situ form SiC whiskers and mullite in the preparation process. The mean pore size of Al2O3-C refractories was strongly associated with permeability. With the decrease of the mean pore size, the permeability of the Al2O3-C refractories reduced constantly. The alkali attack test also verified that the Al2O3-C refractories with lower permeability had better alkali corrosion resistance, because the penetration of K vapor into the materials could be restricted effectively. The corrosion mechanism of Al2O3-C refractories supposes that (1) K2CO3 was reduced to K vapor and penetrated into the specimen through the open pores and (2) K vapor reacted with SiC, SiO2, and alumina to form KAlSi2O6 and KAlSiO4, which is in agreement with the thermodynamic prediction.

  6. Why Y-c.c

    Czech Academy of Sciences Publication Activity Database

    Chodounský, David; Zapletal, Jindřich


    Roč. 166, č. 11 (2015), s. 1123-1149. ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.548, year: 2014

  7. Advanced C and C++ compiling

    CERN Document Server

    Stevanovic, Milan


    Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

  8. Theoretical vibrations of carbon chains C3, C4, C5, C6, C7, C8, and C9

    International Nuclear Information System (INIS)

    The MBPT (2) procedure with the 6-31g (asterisk) basis set was used to study nearly linear carbon chains. The theoretical vibrational frequencies of the molecules C3 through C9 are presented and, for C3 through C6, compared to experimental stretching frequencies and their (C-13)/(C-12) isotopomers. Predictions for C7, C8, and C9 stretching frequencies are calculated by directly scaling the theoretical frequencies with factors derived from experimental-to-theoretical ratios known for the smaller molecules. 28 refs

  9. C/C-PAA与C/C-FA弯曲性能对比%Comparison of Flexural Properties Between C/C-PAA and C/C-FA

    Institute of Scientific and Technical Information of China (English)

    张万强; 赵英民; 王涛; 詹万初



  10. Microscopic thermal characterization of C/C and C/C-SiC composites (United States)

    Jumel, J.; Krapez, J. C.; Lepoutre, F.; Enguehard, F.; Rochais, D.; Neuer, G.; Cataldi, M.


    To measure the thermal properties of C/C and C/C-SiC composites constituents, photoreflectance microscopy is used. Specific methods are developed to cope with experimental artefacts (material semi-transparency, convolution effects), so as with fibers and matrix specificities (strong thermal anisotropy, geometric effects…). Experimental results are presented demonstrating the interest of photoreflectance microscopy for a quantitative determination of the microscopic thermal properties of these complex graphite materials.

  11. Hepatite C

    Directory of Open Access Journals (Sweden)

    Strauss Edna


    Full Text Available Estima-se que cerca de 3% da população mundial esteja infectada pelo vírus da hepatite C. Todos os que receberam transfusão de sangue ou seus componentes e os usuários de drogas podem estar infectados. Procedimentos odontológicos, médicos, tatuagem ou acupuntura também constituem fatores de risco. A infecção se cronifica em até 85% dos indivíduos, com evolução assintomática durante anos ou décadas e apresentação clínica variada. Para o diagnóstico, a determinação do anti-VHC revela-se muito sensível e a confirmação se faz pela determinação do RNA-VHC no sangue; o estadiamento da doença e a avaliação da atividade inflamatória pela biópsia hepática. O tratamento objetiva deter a progressão da doença hepática através da inibição da replicação viral. Devido à baixa eficácia terapêutica aliada a importantes efeitos colaterais do interferon e da ribavirina, esses medicamentos encontram indicações e contra-indicações específicas. Vários fatores preditivos de resposta ao tratamento, principalmente a carga viral e o genótipo do VHC, mostram-se úteis na avaliação dos pacientes.

  12. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    International Nuclear Information System (INIS)

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  13. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)


    Waldek, Achim Marcus


    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  14. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    International Nuclear Information System (INIS)

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  15. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  16. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications


    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon


    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  17. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  18. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    International Nuclear Information System (INIS)

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  19. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    International Nuclear Information System (INIS)

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  20. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  1. HfC plasma coating of C/C composites

    International Nuclear Information System (INIS)

    The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs

  2. Hepatitis C and Incarceration (United States)

    ... It is also the most common type in jails and prisons. What is Hepatitis C? Hepatitis C is a ... risk for Hepatitis C because many people in jails or prisons already have Hepatitis C. • The most ...

  3. Accelerated C# 2010

    CERN Document Server

    Nash, Trey


    C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

  4. Comparative Study of C, C++, C# and Java Programming Languages


    Chen, Hao


    With the rapid development of software industry, more and more people want to learn programming languages. But nowadays there are more than 200 programming languages available, only a few of them can be applied comparatively widely. In this thesis, the research in programming language was conducted. Four of the most popular programming languages C, C++, C# and Java are chosen to be the objects to study. The technical features of these four programming languages were summarized and compar...

  5. Parallel C/C++: Convergence or divergence?

    Energy Technology Data Exchange (ETDEWEB)

    Stanberry, L. [Lawrence Livermore National Lab., CA (United States)


    C has been noted for its wide portability. C++ is touted as the next generation C. Both languages, however, have multiple proposals for parallel extensions. For C, this includes two different ANSI sponsored efforts, X3H5 and X3J11.1. Since C++ is itself in the throes of standardization, parallel C++ proposals are finding their audience among MPP vendors and C++ users in an ARPA-sponsored HPC++ consortium. The number of proposals is large and still growing, and questions arise of whether and how these proposals can converge in order to extend/preserve/protect the investment of the user community. In this panel the authors will bring together representatives from the ANSI committees, MPP vendors, and from independent research efforts to discuss the motivation for their respective proposals, to determine the interoperability of the proposals, and to argue for or against merging of proposals for a standard.

  6. Hemoglobin C disease (United States)

    Clinical hemoglobin C ... Hemoglobin C is an abnormal type of hemoglobin, the protein in red blood cells that carries oxygen. It is ... Americans. You are more likely to have hemoglobin C disease if someone in your family has had ...

  7. Mapping the Globe with C & C Technologies (United States)

    Kleiner, A. A.


    C & C Technologies is an international survey and mapping company with an entrepreneurial spirit that is evident throughout. C & C was recently awarded the MTS (Marine Technology Society) ROV Committee Corporate Excellence Award in recognition of their pioneering spirit displayed by the introduction of the HUGIN 3000 Autonomous Underwater Vehicle (AUV) to the offshore industry. This presentation will outline the wide variety of global mapping projects that C & C has performed for government, private sector, and academia. These include high-resolution mapping of Cater Lake, the Panama Canal, Antarctica, Lake Tahoe, and the HUGIN 3000ś discovery of the German submarine U-166 in 5000 feet of water in the Gulf of Mexico. Adacemic disciplines required to support these technical challenges will be characterized and job opportunities in this emerging field will be addressed.

  8. C-TOOL

    DEFF Research Database (Denmark)

    Taghizadeh-Toosi, Arezoo; Christensen, Bent Tolstrup; Hutchings, Nicholas John;


    Soil organic carbon (SOC) is a significant component of the global carbon (C) cycle. Changes in SOC storage affect atmospheric CO2 concentrations on decadal to centennial timescales. The C-TOOL model was developed to simulate farm- and regional-scale effects of management on medium- to long...... proper model evaluation. Experimental verification of management effects on subsoil C storage, subsoil C inputs from roots, and vertical transport of C in the soil profile remains prioritised research areas....

  9. C++ Programming Language (United States)

    Shaykhian, Gholam Ali


    C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.

  10. Valence neutrons' role in the collisions 13C+12C and 13C+13C

    International Nuclear Information System (INIS)

    The resonant behaviour is not limited to collisions between α-like nuclei: resonance structures have been observed in the direct channels for the 13C+12C and 13C+13C collisions; in the contrary, the resonances observed in the fusion channels are not so pronounced as in the 12C+12C case: the valence neutrons increase the number of reaction channels and the density of states in the states in the compound nuclei, the resonances are therefore 'washed out' and it is difficult to observe them experimentally

  11. Practical C++ Programming

    CERN Document Server

    Oualline, Steve


    C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th

  12. C++ for dummies

    CERN Document Server

    Davis , Stephen R


    The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new

  13. Exploring C++ 11

    CERN Document Server

    Lischner, Ray


    Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat

  14. Objective-C

    CERN Document Server

    DeVoe, Jiva


    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  15. Testing of DLR C/C-SiC and C/C for HIFiRE 8 Scramjet Combustor (United States)

    Glass, David E.; Capriotti, Diego P.; Reimer, Thomas; Kutemeyer, Marius; Smart, Michael K.


    Ceramic Matrix Composites (CMCs) have been proposed for use as lightweight hot structures in scramjet combustors. Previous studies have calculated significant weight savings by utilizing CMCs (active and passive) versus actively cooled metallic scramjet structures. Both a carbon/carbon (C/C) and a carbon/carbon-silicon carbide (C/C-SiC) material fabricated by DLR (Stuttgart, Germany) are being considered for use in a passively cooled combustor design for Hypersonic International Flight Research Experimentation (HIFiRE) 8, a joint Australia / Air Force Research Laboratory hypersonic flight program, expected to fly at Mach 7 for approximately 30 sec, at a dynamic pressure of 55 kilopascals. Flat panels of the DLR C/C and C/C-SiC materials were installed downstream of a hydrogen-fueled, dual-mode scramjet combustor and tested for several minutes at conditions simulating flight at Mach 5 and Mach 6. Gaseous hydrogen fuel was used to fuel the scramjet combustor. The test panels were instrumented with embedded Type K and Type S thermocouples. Zirconia felt insulation was used during some of the tests to reduce heat loss from the back surface and thus increase the heated surface temperature of the C/C-SiC panel approximately 177 C (350 F). The final C/C-SiC panel was tested for three cycles totaling over 135 sec at Mach 6 enthalpy. Slightly more erosion was observed on the C/C panel than the C/C-SiC panels, but both material systems demonstrated acceptable recession performance for the HIFiRE 8 flight.

  16. Oxidation Behavior of C/C-SiC Gradient Matrix Composites

    Institute of Scientific and Technical Information of China (English)


    Oxidation behavior of C/C-SiC gradient matrix composites and C/C composites were compared in stationary air. The results show that oxidation threshold of C-SiC materials increases with the amount of SiC particles in the codeposition matrix. Oxidation rate of C/C-SiC gradient matrix composites is significantly lower than that of C/C material. The micro-oxidation process was observed by SEM.

  17. Hemoglobin C disease (United States)

    Clinical hemoglobin C ... Hemoglobin C is an abnormal type of hemoglobin, the protein in red blood cells that carries oxygen. It is a type of hemoglobinopathy. The disease is caused by a problem with ...

  18. A1C test (United States)

    HbA1C test; Glycated hemoglobin test; Glycosylated hemoglobin test; Hemoglobin glycosylated test; Glycohemoglobin test ... have recently eaten does not affect the A1C test, so you do not need to fast to ...

  19. SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures Project (United States)

    National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

  20. Hepatitis C FAQs (United States)

    ... State and Local Partners & Grantees Resource Center Hepatitis C FAQs for the Public Recommend on Facebook Tweet ... URL - Redirecting ... Quick Links to Hepatitis ... A | B | C | D | E Viral Hepatitis Home Statistics & Surveillance Populations & ...

  1. Stool C. difficile toxin (United States)

    ... page: // Stool C. difficile toxin To use the sharing features on this page, please enable JavaScript. The stool C. difficile toxin test detects harmful substances produced by ...

  2. Cryptococcosis (C. neoformans) (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. neoformans Infection Recommend on Facebook Tweet Share Compartir ... throughout the world. People can become infected with C. neoformans after breathing in the microscopic fungus, although ...

  3. D and C (United States)

    D and C is a procedure to scrape and collect the tissue (endometrium) from inside the uterus. Dilation ("D") is a ... cervix to allow instruments into the uterus. Curettage ("C") is the scraping of the walls of the ...

  4. C style guide (United States)

    Doland, Jerry; Valett, Jon


    This document discusses recommended practices and style for programmers using the C language in the Flight Dynamics Division environment. Guidelines are based on generally recommended software engineering techniques, industry resources, and local convention. The Guide offers preferred solutions to common C programming issues and illustrates through examples of C Code.

  5. C2 Agility

    DEFF Research Database (Denmark)

    Mitchell, Dr. William; Alberts, David S.; Bernier, Francois;

    circumstances. SAS-085 was formed to improve the understanding of C2 Agility and assess its importance to NATO. SAS-085 accomplished these objectives by articulating the principles of C2 Agility, in the form of a C2 Agility Conceptual Model, substantially validating this model and establishing the importance of...

  6. Large N_c


    Jenkins, Elizabeth E.


    The 1/N_c expansion of QCD with N_c=3 has been successful in explaining a wide variety of QCD phenomenology. Here I focus on the contracted spin-flavor symmetry of baryons in the large-N_c limit and deviations from spin-flavor symmetry due to corrections suppressed by powers of 1/N_c. Baryon masses provide an important example of the 1/N_c expansion, and successful predictions of masses of heavy-quark baryons continue to be tested by experiment. The ground state charmed baryon masses have all...

  7. Complement C3


    Dinasarapu, Ashok Reddy; Chandrasekhar, Anjana; Sahu, Arvind; Subramaniam, Shankar


    Complement C3 is the central component of the human complement system. It is ~186 kDa in size, consisting of an α-chain (~110 kDa) and a β-chain (~75 kDa) that are connected by cysteine bridges. C3 in its native form is inactive. Cleavage of C3 into C3b (~177 kDa) and C3a (~9 kDa) is a crucial step in the complement activation cascade, which can be initiated by one or more of the three distinct pathways, called alternative, classical and lectin complement pathways. In the alternative pathway,...

  8. Head first C#

    CERN Document Server

    Stellman, Andrew


    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  9. Learning C# 30

    CERN Document Server

    Liberty, Jesse


    If you're new to C#, Learning C# 3.0 is the ideal way to get started. Learning C# 3.0 starts with the fundamentals and takes you through intermediate and advanced C# features-including generics, interfaces, delegates, lambda expressions, and LINQ. You'll also learn how to build Windows applications and handle data with C#. Each chapter offers a self-contained lesson with plenty of annotated examples, illustrations, and a concise summary. No previous programming experience is required.

  10. Using C-Kermit

    CERN Document Server

    da Cruz, Frank


    An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced

  11. Microstructure and Oxidation Behavior of CNT/PyC/SiC Coating on C/C Composite Material


    Mizuki, Hironori; Sano, Hideaki; Zheng, Guo-Bin; Uchiyama, Yasuo


    CNT/PyC/SiC coating were prepared by direct growth of CNTs on C/C followed by deposition of PyC (pyrolytic carbon) and SiC. It is found that the coating consisted of two layers; the CNT/PyC/SiC layer and SiC layer. The oxidation resistance of C/C was improved by the coating, which had much fewer cracks and better thermal-shock resistance.

  12. Hemoglobin C, S-C, and E Diseases (United States)

    ... Myeloma (Video) Multiple Myeloma Additional Content Medical News Hemoglobin C, S-C, and E Diseases By Alan E. ... Aplastic Anemia Autoimmune Hemolytic Anemia Sickle Cell Disease Hemoglobin C, S-C, and E Diseases Thalassemias Hemoglobin C, S- ...

  13. Parylene C Aging Studies.

    Energy Technology Data Exchange (ETDEWEB)

    Achyuthan, Komandoor; Sawyer, Patricia Sue.; Mata, Guillermo Adrian; White II, Gregory Von; Bernstein, Robert


    Parylene C is used in a device because of its conformable deposition and other advantages. Techniques to study Parylene C aging were developed, and %22lessons learned%22 that could be utilized for future studies are the result of this initial study. Differential Scanning Calorimetry yielded temperature ranges for Parylene C aging as well as post-deposition treatment. Post-deposition techniques are suggested to improve Parylene C performance. Sample preparation was critical to aging regimen. Short-term (~40 days) aging experiments with free standing and ceramic-supported Parylene C films highlighted %22lessons learned%22 which stressed further investigations in order to refine sample preparation (film thickness, single sided uniform coating, machine versus laser cutting, annealing time, temperature) and testing issues (%22necking%22) for robust accelerated aging of Parylene C.

  14. Properties of c meson

    Indian Academy of Sciences (India)

    Ajay Kumar Rai; P C Vinodkumar


    The mass spectrum of $c\\bar{b}$ meson is investigated with an effective quark-antiquark potential of the form $\\dfrac{-_{c}}{r} + Ar^{}$ with varying from 0.5 to 2.0. The and -wave masses, pseudoscalar decay constant, weak decay partial widths in spectator model and the lifetime of c meson are computed. The properties calculated here are found to be in good agreement with other theoretical and experimental values at potential index, = 1.

  15. Scurvy and Vitamin C


    Mayberry, Jason A.


    This paper outlines the history of scurvy and vitamin C. The first section of the paper outlines the science of vitamin C. The second discusses outlines the medical progression of vitamin C deficiency and scurvy. The third section gives a brief timeline of scurvy throughout human history. The fourth section discusses the conditions during the age of sail that combined to make scurvy the greatest killer of sailors. The final section follows the scientific drive to find a cure and eventual elim...

  16. Natural 14C variations

    International Nuclear Information System (INIS)

    This thesis deals with the natural variations in the atmospheric 14C activity, their geophysical origin and their impact on radiocarbon dating. Studies confirm the idea that one is dealing with a mechanism of a certain regularity. The correlation between a 14C variation during the Little Ice Age and the absence of sunspots on the solar surface suggest the sun to be responsible for some kind of modulation of the galactic cosmic ray spectrum. The background of a changing natural 14C level is relevant when studying the antropogenic perturbation of the atmospheric 14C concentration by the addition of CO2 from fossil fuel combustion. The results presented point to a Suess effect over the past 150 years of about 20 per thousand, but also show a local dilution effect. If this local effect is present over large continental parts of the Northern Hemisphere this will put limits to the use of tree ring 14C measurements for testing carbon reservoir models. Finally the influence of 14C variations upon the interpretations of 14C dates for archaeological and geological purposes has been investigated. It is shown that care must be taken especially in the interpretation of highly accurate 14C data of material only covering a few years of growth. One geological example illustrates that 14C variations can easily be interpretated as alternating fast and slow rises of the sea level. (Auth.)

  17. C++ for dummies

    CERN Document Server

    Davis, Stephen Randy


    Enter the world of computer programming with this step-by-step guide to the C++ language! C++ is a great introduction to object-oriented programming, and this friendly guide covers everything you need to know and nothing you don't. You'll write your first program by the end of Chapter 1. C++ For Dummies, 6th Edition, helps you understand C++ programming from the ground up. It's full of examples to show you how things work, and it even explains "why", so you understand how the pieces fit together. And the bonus CD includes a special code editor, an update GNU compiler, and all source code from

  18. Dating by C14

    International Nuclear Information System (INIS)

    This report summarizes the results of studies made with two assemblies for dating geological and archaeological objects with C14. The advantages and drawbacks of three ways of determining C14 activity in solid, liquid and gaseous substances are discussed. Data are given of the chemical preparation and cleaning of the gaseous carbon compounds ethane, acetylene and carbon dioxide, and the calculation of their C14 activity. The report assesses the mistakes that can be made in determining age by C14, and gives data for geological and archaeological objects in the Soviet Union. (author)

  19. Programming C# 40

    CERN Document Server

    Griffiths, Ian; Liberty, Jesse


    With its support for dynamic programming, C# 4.0 continues to evolve as a versatile language on its own. But when C# is used with .NET Framework 4, the combination is incredibly powerful. This bestselling tutorial shows you how to build web, desktop, and rich Internet applications using C# 4.0 with .NET's database capabilities, UI framework (WPF), extensive communication services (WCF), and more. In this sixth edition, .NET experts Ian Griffiths, Matthew Adams, and Jesse Liberty cover the latest enhancements to C#, as well as the fundamentals of both the language and framework. You'll learn

  20. Thermoelectric properties of porous SiC/C composites

    NARCIS (Netherlands)

    Fujisawa, Masashi; Hata, Toshimitsu; Kitagawa, Hiroyuki; Bronsveld, Paul; Suzuki, Youki; Hasezaki, Kazuhiro; Noda, Yasutoshi; Imamura, Yuji


    We developed a porous SiC/C composite by oxidizing a SiC/C composite made from a mixed powder of wood charcoal and SiO2 (32-45 mu m) by pulse current sintering at 1600 and 1800 degrees C under a N-2 atmosphere. The microstructures of the porous SiC/C composites with oxidation and the SiC/C composite

  1. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  2. cDNA: 12295 [

    Lifescience Database Archive (English)

    Full Text Available H. sapiens + Hs.267288 Homo sapiens full open reading ... frame cDNA clone RZPDo834G0212D for gene C ... 6orf55, chromosome 6 open reading ... frame 55; complete cds, incl. stopcodon gnl|UG|Hs# ...

  3. cDNA: 16610 [

    Lifescience Database Archive (English)

    Full Text Available H. sapiens + Hs.62595 Homo sapiens full open reading ... frame cDNA clone RZPDo834H088D for gene C9o ... rf9, chromosome 9 open reading ... frame 9; complete cds, incl. stopcodon gnl|UG|Hs#S ...

  4. cDNA: 40378 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.154312 Mus musculus 7 days embryo whole body cDNA, RIKEN full-length enriched l ... ibrary, clone:C430046A10 product:HYPERTENSION ... RELATED PROTEIN 1, full insert sequence gnl|UG|Mm# ...

  5. Learning Boost C++ libraries

    CERN Document Server

    Mukherjee, Arindam


    If you are a C++ programmer who has never used Boost libraries before, this book will get you up-to-speed with using them. Whether you are developing new C++ software or maintaining existing code written using Boost libraries, this hands-on introduction will help you decide on the right library and techniques to solve your practical programming problems.

  6. Effect of HfC on the ablative and mechanical properties of C/C composites

    International Nuclear Information System (INIS)

    The ablation and mechanical behavior of the carbon/carbon (C/C) and hafnium carbide (HfC) modified C/C (HfC-C/C) composites were evaluated by oxyacetylene flame and the three-point bending tests. The effect of impact damage on their mechanical behavior was also investigated. To produce the HfC-C/C composites, the refractory carbide precursor was introduced to the preforms by impregnating with HfOCl2.8H2O solution. Both the C/C and the HfC-C/C preforms were densified by thermal gradient chemical vapor infiltration. Results indicated that, although the linear and mass ablation rates exhibited by the HfC-C/C composites were lower than those for the C/C composites by 55% and 21%, respectively, the maximum flexural load for the C/C composites was significantly higher by 33% than that of HfC-C/C composites. The influence of pre-impact loading on mechanical behavior was greater for the HfC-C/C composites than for the C/C composites.

  7. Dicty_cDB: SSB832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnments: (bits) Value N ( C94506 ) Dictyostelium discoideum slug cDNA, clone SSL114. 377 e-111 2 ( C89831 ) ...Dictyostelium discoideum slug cDNA, clone SSG211. 377 e-111 2 ( AU038639 ) Dictyostelium discoideum slug cDN...A, clone SSL286. 377 e-111 2 ( C93164 ) Dictyostelium discoideum slug cDNA, clone... SSM728. 377 e-111 2 ( C92937 ) Dictyostelium discoideum slug cDNA, clone SSF118. 377 e-111 2 ( AU034859 ) D...ictyostelium discoideum slug cDNA, clone SLE606. 377 e-111 2 ( C94177 ) Dictyostelium discoideum slug cDNA,

  8. Dicty_cDB: SSB514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N ( AU037133 ) Dictyostelium discoideum slug cDNA, clone SSB514. 159 4e-55 3 ( C93995 ) Dictyostelium discoideum slug... cDNA, clone SSK677. 159 1e-54 3 ( C90543 ) Dictyostelium discoideum slug cDNA, clone SSI703.... 159 1e-54 3 ( C94442 ) Dictyostelium discoideum slug cDNA, clone SSK808. 159 2e-54 3 ( C92716 ) Dictyostelium discoideum slug... cDNA, clone SSF896. 159 2e-54 3 ( AU037609 ) Dictyostelium discoideum slug... cDNA, clone SSD849. 159 2e-54 3 ( C91229 ) Dictyostelium discoideum slug cDNA, clone SSJ846. 1

  9. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor; Matusiewicz, Krystian

    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the 56...... bit key for a known S-box can be done in complexity 2^48. Finally, a C2 implementation with a 8 to 8 bit secret S-box (equivalent to 2048 secret bits) and a 56 bit secret key can be attacked in 2^53.5 C2 encryptions on average....

  10. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor;


    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the 56...... bit key for a known S-box can be done in complexity 2^48. Finally, a C2 implementation with a 8 to 8 bit secret S-box (equivalent to 2048 secret bits) and a 56 bit secret key can be attacked in 2^53.5 C2 encryptions on average....

  11. Reaction of montmorillonite in alkaline solution at 60 C, 90 C, 120 C and 180 C

    International Nuclear Information System (INIS)

    The reaction of montmorillonite was investigated. Three kinds of bentonites with different montmorillonite composition were mixed with 0.3M NaOH solution and 0.3M Ca(OH)2 slurry. They were immersed at 60 C, 90 C, 120 C, and 180 C for one month, three months and six months. The concentrations of the soluble ions were measured and the bentonites were analyzed quantitatively after the immersion. 50% of the montmorillonite was reacted within two weeks at greater than 90 C. Montmorillonite reacts less when mixed with Si-minerals. It extensively reacted in 0.3M Ca(OH)2 slurry. These results suggest that the reaction mechanism of the montmorillonite in alkaline solution was dominantly Si dissolution, and would decrease by controlling the concentration of Si ion. The cement/bentonite system under Si saturated conditions is discussed

  12. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  13. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  14. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  15. Head first C#

    CERN Document Server

    Stellman, Andrew


    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  16. C++ multithreading cookbook

    CERN Document Server

    Ljumovic, Milos


    The book is an easy-to-follow guide for creating multi-threaded applications using C++. Each topic is thoroughly explained with multiple illustrations. Many algorithms, such as Dinning Philosophers Problem give you thorough explanations that will help you to understand and solve concurrent tasks. The book is intended for enterprise developers and programmers who wish to make use of C++ capabilities to learn the multithreaded approach. Knowledge of multithreading along with experience in C++ is an added advantage. However it is not a prerequisite.

  17. Practical C programming

    CERN Document Server

    Oualline, Steve


    There are lots of introductory C books, but this is the first one that has the no-nonsense, practical approach that has made Nutshell Handbooks® famous. C programming is more than just getting the syntax right. Style and debugging also play a tremendous part in creating programs that run well and are easy to maintain. This book teaches you not only the mechanics of programming, but also describes how to create programs that are easy to read, debug, and update. Practical rules are stressed. For example, there are fifteen precedence rules in C (&& comes before || comes before ?:). The practi

  18. Vitamin C In Neuropsychiatry

    Directory of Open Access Journals (Sweden)

    Pavlović Dragan M.


    Full Text Available Vitamins are necessary factors in human development and normal brain function. Vitamin C is a hydrosoluble compound that humans cannot produce; therefore, we are completely dependent on food intake for vitamin C. Ascorbic acid is an important antioxidative agent and is present in high concentrations in neurons and is also crucial for collagen synthesis throughout the body. Ascorbic acid has a role in modulating many essential neurotransmitters, enables neurogenesis in adult brain and protects cells against infection. While SVCT1 enables the absorption of vitamin C in the intestine, SVCT2 is primarily located in the brain.

  19. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit


    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  20. Dicty_cDB: SLE291 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value N ( AU061448 ) Dictyostelium discoideum slug cDNA, clone S...LE291. 412 e-121 2 ( C90755 ) Dictyostelium discoideum slug cDNA, clone SSJ111. 385 e-113 2 ( C94506 ) Dictyostelium discoideum slug... cDNA, clone SSL114. 377 e-111 2 ( C89831 ) Dictyostelium discoideum slug... cDNA, clone SSG211. 377 e-111 2 ( AU038639 ) Dictyostelium discoideum slug cDNA, clone SSL2...86. 377 e-111 2 ( C93164 ) Dictyostelium discoideum slug cDNA, clone SSM728. 377 e-111 2 ( C92937 ) Dictyostelium discoideum slug

  1. Introduction to C

    DEFF Research Database (Denmark)

    Albertsen, Niels Christian


    The principles of C are very much like those of PASCAL, although the syntax differs slightly. The programs are entered in free format, which the programmer may utilise to make the text reader-friendly, and every sentence is ended with a semicolon. Comments can be entered at any point by enclosing...... them in /* and */. e.g.: /* a comment */. Note that the C compiler is case sensitive. A C program may consist of several program segments. One of them must be the main program, the rest are denoted functions. In contrast to PASCAL the concept procedure does not exist. Every segment starts with a number....... To avoid this extra complication, we will in the following consider only C programs contained in a single file....

  2. cDNA: 34099 [

    Lifescience Database Archive (English)

    Full Text Available H. sapiens + Hs.15282 Homo sapiens cDNA FLJ44214 fis, clone THYMU3003309, moderately similar to ... Homo sapiens sarcoma antigen (SAGE ) gnl|UG|Hs#S16886502 AK126202 23/5622_34099.png ...

  3. C++ Crash Course


    Rougier, Nicolas,


    1 Foreword 2 From C to C++ 2.1 Input/Output 2.2 New/Delete 2.3 References 2.4 Default parameters 2.5 Namespaces 2.6 Overloading 2.7 Const & inline 2.8 Mixing C and C++ 2.9 Exercises 3 Classes 3.1 Constructors 3.2 Destructor 3.3 Access control 3.4 Initialization list 3.5 Operator overloading 3.6 Friends 3.7 Exercices 4 Inheritance 4.1 Basics 4.2 Virtual methods 4.3 Abstract classes 4.4 Multiple inheritance 4.5 Exercices 5 Exceptions 5.1 The Zen of Python 5.2 Catch me if you can 5.3 Creating yo...

  4. Hepatitis C and sex. (United States)

    Page, Emma E; Nelson, Mark


    An outbreak of acute hepatitis C among HIV-positive men who have sex with men (MSM) in the last decade has been shown to be sexually transmitted. Initially recreational drug use, in particular drug injection, was not prevalent among those becoming infected with hepatitis C. However more recently chemsex (the use of drugs to enhance sexual experience) and its associated drugs, which are not uncommonly injected, have become more frequently reported among those diagnosed with hepatitis C. It is hoped that the widespread -introduction of direct-acting antivirals and upscaling of numbers treated may have a positive impact on this epidemic. However their introduction may negatively impact on the perceived risk of acquiring hepatitis C and in conjunction with the introduction of HIV transmission prevention strategies may result in increased transmissions and spread to the HIV-negative MSM population. PMID:27037392

  5. cDNA: 43397 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.30035 Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length enri ... FOLATE DEHYDROGENASE (EC (10-FTHFDH) (FBP-CI ) homolog [Rattus norvegicus], full insert sequence ...

  6. A1C Test (United States)

    ... to minimize the complications caused by chronically elevated glucose levels, such as progressive damage to body organs like the kidneys, eyes, cardiovascular system, and nerves. The A1c test result ...

  7. cDNA: 33377 [

    Lifescience Database Archive (English)

    Full Text Available H. sapiens + Hs.181243 Homo sapiens full open reading frame cDNA clone RZPDo834H102D for gene AT ... F4, activating transcription factor 4 (tax -responsive enhancer element B67); complete cds; wi ...

  8. C. difficile Infection (United States)

    ... include fever and abdominal distension and/or tenderness. Screening/Diagnosis C. difficile infection requires documenting the presence ... First, it would be ideal to stop the antibiotic that led to the infection in the first ...

  9. D and C - slideshow (United States)

    ... this page: // D and C - series—Normal anatomy To use the ... Update Date 6/11/2014 Updated by: Cynthia D. White, MD, Fellow American College of Obstetricians and ...

  10. cDNA: 17527 [

    Lifescience Database Archive (English)

    Full Text Available H. sapiens + Hs.134229 Homo sapiens cDNA FLJ44146 fis, clone THYMU2027734, weakly similar to Hom ... o sapiens SA hypertension -associated homolog (rat) (SAH) gnl|UG|Hs#S16886570 ...

  11. cDNA: 47992 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.228067 Mus musculus 15 days embryo male testis cDNA, RIKEN full-length enriched ... lone:8030476B22 product:hypothetical Mitochondrial energy ... transfer proteins (carrier protein) containing pro ...

  12. cDNA: 40711 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.41523 Mus musculus adult male thymus cDNA, RIKEN full-length enriched library, ... lone:5830492N08 product:hypothetical Mitochondrial energy ... transfer proteins (carrier protein) containing pro ...

  13. cDNA: 47994 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.228067 Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched libr ... lone:E130118D21 product:hypothetical Mitochondrial energy ... transfer proteins (carrier protein) containing pro ...

  14. cDNA: 47991 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.228067 Mus musculus adult male diencephalon cDNA, RIKEN full-length enriched li ... lone:9330189G22 product:hypothetical Mitochondrial energy ... transfer proteins (carrier protein) containing pro ...


    U.S. Environmental Protection Agency — LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for...

  16. cDNA: 36928 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.240850 Mus musculus adult male medulla oblongata cDNA, RIKEN full-length enrich ... MA AMPLIFIED SEQUENCE 1 (NOVEL AMPLIFIED IN BREAST CANCER ... 1) (AMPLIFIED AND OVEREXPRESSED IN BREAST CANCER ) ...

  17. cDNA: 36927 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.240850 Mus musculus adult male stomach cDNA, RIKEN full-length enriched library ... MA AMPLIFIED SEQUENCE 1 (NOVEL AMPLIFIED IN BREAST CANCER ... 1) (AMPLIFIED AND OVEREXPRESSED IN BREAST CANCER ) ...

  18. cDNA: 40220 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.207654 Mus musculus adult male olfactory brain ... cDNA, RIKEN full-length enriched ... library, clone:6430704M03 product:similar to BRAIN ... PROTEIN (FRAGMENT) [Homo sapiens], full insert seq ...

  19. Cryptococcosis (C. gattii) (United States)

    ... Zoonotic Infectious Disease Division of Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. gattii Infection Recommend on ... Zoonotic Infectious Disease Division of Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch File Formats Help: How do ...

  20. Parallelization in Modern C++

    CERN Document Server

    CERN. Geneva


    The traditionally used and well established parallel programming models OpenMP and MPI are both targeting lower level parallelism and are meant to be as language agnostic as possible. For a long time, those models were the only widely available portable options for developing parallel C++ applications beyond using plain threads. This has strongly limited the optimization capabilities of compilers, has inhibited extensibility and genericity, and has restricted the use of those models together with other, modern higher level abstractions introduced by the C++11 and C++14 standards. The recent revival of interest in the industry and wider community for the C++ language has also spurred a remarkable amount of standardization proposals and technical specifications being developed. Those efforts however have so far failed to build a vision on how to seamlessly integrate various types of parallelism, such as iterative parallel execution, task-based parallelism, asynchronous many-task execution flows, continuation s...

  1. cDNA: 52275 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.275648 Mus musculus 11 days embryo head cDNA, RIKEN full-length enriched librar ... y, clone:6230400I01 product:SIMILAR TO ENIGMA ... (LIM DOMAIN PROTEIN) homolog [Homo sapiens], full ...

  2. cDNA: 52278 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.275648 Mus musculus adult male tongue cDNA, RIKEN full-length enriched library, ... clone:2310073F10 product:SIMILAR TO ENIGMA ... (LIM DOMAIN PROTEIN) homolog [Homo sapiens], full ...

  3. cDNA: 52277 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.275648 Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched l ... ibrary, clone:1110003B01 product:SIMILAR TO ENIGMA ... (LIM DOMAIN PROTEIN) homolog [Homo sapiens], full ...

  4. cDNA: 52276 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.275648 Mus musculus adult male brain cDNA, RIKEN full-length enriched library, ... clone:0710007K04 product:SIMILAR TO ENIGMA ... (LIM DOMAIN PROTEIN) homolog [Homo sapiens], full ...

  5. Glycine decarboxylase in C3, C4 and C3-C4 intermediate species. (United States)

    Schulze, Stefanie; Westhoff, Peter; Gowik, Udo


    The glycine decarboxylase complex (GDC) plays a central role in photorespiration. GDC is localized in the mitochondria and together with serine hydroxymethyltransferase it converts two molecules of glycine to one molecule of serine, CO2 and NH3. Overexpression of GDC subunits in the C3 species Arabidopsis thaliana can increase the metabolic flux through the photorespiratory pathway leading to enhanced photosynthetic efficiency and consequently to an enhanced biomass production of the transgenic plants. Changing the spatial expression patterns of GDC subunits was an important step during the evolution of C3-C4 intermediate and likely also C4 plants. Restriction of the GDC activity to the bundle sheath cells led to the establishment of a photorespiratory CO2 pump. PMID:27038285

  6. Beginning Objective-C

    CERN Document Server

    Dovey, James


    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  7. H.C. Andersen

    DEFF Research Database (Denmark)

    Nissen, Mogens Rostgaard


    "Mit Liv er et smukt Eventyr, saa rigt og lyksaligt!" Sådan beskrev H.C. Andersens sit eget liv. Det overgik næsten indholdet af hans egne eventyr. Født i fattigdom og social nød, men kæmpede sig op og døde berømt og feteret 70 år senere. H.C. Andersen er Danmarks bedst kendte forfatter. Især hans...

  8. SiC Technology (United States)

    Neudeck, Philip G.


    Silicon carbide (SiC)-based semiconductor electronic devices and circuits are presently being developed for use in high-temperature, high-power, and/or high-radiation conditions under which conventional semiconductors cannot adequately perform. Silicon carbide's ability to function under such extreme conditions is expected to enable significant improvements to a far-ranging variety of applications and systems. These range from greatly improved high-voltage switching [1- 4] for energy savings in public electric power distribution and electric motor drives to more powerful microwave electronics for radar and communications [5-7] to sensors and controls for cleaner-burning more fuel-efficient jet aircraft and automobile engines. In the particular area of power devices, theoretical appraisals have indicated that SiC power MOSFET's and diode rectifiers would operate over higher voltage and temperature ranges, have superior switching characteristics, and yet have die sizes nearly 20 times smaller than correspondingly rated silicon-based devices [8]. However, these tremendous theoretical advantages have yet to be realized in experimental SiC devices, primarily due to the fact that SiC's relatively immature crystal growth and device fabrication technologies are not yet sufficiently developed to the degree required for reliable incorporation into most electronic systems [9]. This chapter briefly surveys the SiC semiconductor electronics technology. In particular, the differences (both good and bad) between SiC electronics technology and well-known silicon VLSI technology are highlighted. Projected performance benefits of SiC electronics are highlighted for several large-scale applications. Key crystal growth and device-fabrication issues that presently limit the performance and capability of high temperature and/or high power SiC electronics are identified.

  9. C# 30 Design Patterns

    CERN Document Server

    Bishop, Judith


    Want to speed up the development of your .NET applications? Tackle common programming problems with C# design patterns. This guide explains what design patterns are and why they're used, with tables and guidelines to help you choose one pattern over another, and plenty of case studies to illustrate how each pattern is used in practice. C# 3.0 features are introduced by example and summarized for easy reference.

  10. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts


    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  11. Dicty_cDB: SLC296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available producing significant alignments: (bits) Value N ( C84710 ) Dictyostelium discoideum slug cDNA, clone SSE70...5. 642 0.0 2 ( AU051981 ) Dictyostelium discoideum slug cDNA, clone SSC841. 642 0....0 2 ( AU034232 ) Dictyostelium discoideum slug cDNA, clone SLC296. 642 0.0 2 ( C92664 ) Dictyostelium discoideum slug... cDNA, clone SSF805. 642 0.0 2 ( AU038147 ) Dictyostelium discoideum slug cDNA, clone SSH330. 642 ...0.0 2 ( C93278 ) Dictyostelium discoideum slug cDNA, clone SSM516. 642 0.0 2 ( C9

  12. Dicty_cDB: SLC487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N ( AU034567 ) Dictyostelium discoideum slug cD...NA, clone SLC487. 359 0.0 2 ( C92009 ) Dictyostelium discoideum slug cDNA, clone SSC771. 359 0.0 2 ( AU03457...0 ) Dictyostelium discoideum slug cDNA, clone SLC492. 359 0.0 2 ( AU034140 ) Dictyostelium discoideum slug c...DNA, clone SLB789. 359 0.0 2 ( C89745 ) Dictyostelium discoideum slug cDNA, clone... SSG743. 359 0.0 2 ( C90200 ) Dictyostelium discoideum slug cDNA, clone SSI241. 359 0.0 2 ( C94225 ) Dictyostelium discoideum slug

  13. Dicty_cDB: SSB358 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N ( C84233 ) Dictyostelium discoideum slug cDNA, clone SS...B358. 375 e-159 2 ( C92151 ) Dictyostelium discoideum slug cDNA, clone SSD151. 367 e-157 2 ( AU037833 ) Dictyostelium discoideum slug... cDNA, clone SSE351. 367 e-157 2 ( AU037479 ) Dictyostelium discoideum slug... cDNA, clone SSD685. 367 e-157 2 ( C91216 ) Dictyostelium discoideum slug cDNA, clone SSJ...829. 361 e-153 2 ( C90895 ) Dictyostelium discoideum slug cDNA, clone SSJ279. 220 e-146 3 ( AU037158 ) Dictyostelium discoideum slug

  14. Dicty_cDB: VSE884 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone PP095G12 similar to RAS RELATED PROTEIN RAB7. 68 6e-08 1 AW290476 |AW290476.1 NXNV027C10F Nsf Xylem Normal wood Vertical...27C10 Nsf Xylem Normal wood Vertical Pinus taeda cDNA clone NXNV027C10 5' similar... |CD018114.1 NXLV_002_C09_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV_002_C09 5' simil

  15. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    J.C. Christensen var kun regeringsleder i tre år, men i en lille menneskealder kunne stort set intet ske i dansk politik uden om ham. I et kvart århundrede var han et magtcentrum. Centralt i J.C. Christensens politiske virke i årene 1890-1924 stod kampen for det parlamentariske folkestyre....... Parlamentarismen har lige siden udgjort fundamentet for vores styreform, og dens fortsatte betydning og grundlovsfæstede status gør den til den betydeligste arv, J.C. Christensen har efterladt sig. Men hvem var J.C. Christensen egentlig? Han satte sit afgørende fingeraftryk på indførelsen af kvindelig valgret......, stiftelsen af Det Radikale Venstre og Venstre, tilblivelsen af det norske kongehus, Albertiaffæren, salget af De Vestindiske Øer, Påskekrisen og genforeningen med Sønderjylland. Nu har J.C. Christensens efterkommere for første gang givet adgang til hans efterladte dagbøger og breve. Det har gjort det muligt...

  16. Bioremediation of bunker C

    International Nuclear Information System (INIS)

    Bioremediation works extremely well for most common hydrocarbons including aviation fuel, heating oil and diesel oil. Bunker C, a high boiling point distillate, is the most recalcitrant hydrocarbon for treatment and is the topic of this paper. Bioremediation, Inc. has had an opportunity to perform two projects involving soil contaminated with bunker C. One was at a bulk terminal site which involved predominantly diesel, but also had bunker C contamination; the other was a paper-mill site which had exclusively bunker C contamination. This paper will address the authors' experiences at the paper-mill site. Bunker C lives up to its reputation of being a very recalcitrant hydrocarbon to biodegrade. They have demonstrated, however, that the soil matrix standards at industrial sites in Washington and Oregon can be achieved using new bioremediation techniques. These techniques are necessary over those typically used to biodegrade jet fuel, heating oil and diesel oil. These extra steps, as discussed later, have been developed for their own use in their treatability laboratory

  17. Interstellar C60+

    CERN Document Server

    Berne, Olivier; Joblin, Christine


    Buckminsterfullerene (C60) was recently detected through its infrared emission bands in the interstellar medium (ISM), including in the proximity of massive stars, where physical conditions could favor the formation of the cationic form, C60+. In addition, C60+ was proposed as the carrier of two diffuse interstellar bands in the near-IR, although a firm identification still awaits for gas-phase spectroscopic data. We examined in details the Spitzer IRS spectra of the NGC 7023 reflection nebula, at a position close (7.5") to the illuminating B star HD 200775, and found four previously unreported bands at 6.4, 7.1, 8.2 and 10.5 \\mu m in addition to the classical bands attributed to Polycylic Aromatic Hydrocarbons (PAHs) and neutral C60. These 4 bands are observed only in this region of the nebula, while C60 emission is still present slightly further away from the star, and PAH emission even further away. Based on this observation, on theoretical calculations we perform, and on laboratory studies, we attribute t...

  18. Study on friction and wear behaviors of C/C-SiC under water lubrication

    International Nuclear Information System (INIS)

    C/C-SiC composites, prepared by a modified thermal gradient chemical vapor infiltration (preparing C/C) combined with reactive melt infiltration (infiltrating Si), were studied on the friction and wear behaviors in this paper. The results show that during block-on-ring tests under water lubrication, the friction coefficient and specific wear rate of C/C-SiC samples increase with increasing load, but decrease with increasing sliding velocity, and sliding velocity has a more influence on friction and wear behaviors than load. The C/C-SiC samples mainly subject to grain wear and fracture wear in the process of friction. (authors)

  19. Practical C++ financial programming

    CERN Document Server

    Oliveira, Carlos


    Practical C++ Financial Programming is a hands-on book for programmers wanting to apply C++ to programming problems in the financial industry. The book explains those aspects of the language that are more frequently used in writing financial software, including the STL, templates, and various numerical libraries. The book also describes many of the important problems in financial engineering that are part of the day-to-day work of financial programmers in large investment banks and hedge funds. The author has extensive experience in the New York City financial industry that is now distilled in

  20. Hepatitis C in India

    Indian Academy of Sciences (India)

    Ashis Mukhopadhya


    Hepatitis C is an emerging infection in India and an important pathogen causing liver disease in India. The high risk of chronicity of this blood-borne infection and its association with hepatocellular carcinoma underscores its public health importance. Blood transfusion and unsafe therapeutic interventions by infected needles are two preventable modalities of spread of hepatitis C infection. In addition, risk factor modification by reducing the number of intravenous drug users will help curtail the prevalence of this infection. This review summarizes the extent, nature and implications of this relatively new pathogen in causing disease in India.

  1. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M


    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  2. On the Y-chromosome haplogroup C3c classification. (United States)

    Malyarchuk, Boris A; Derenko, Miroslava; Denisova, Galina


    As there are ambiguities in classification of the Y-chromosome haplogroup C3c, relatively frequent in populations of Northern Asia, we analyzed all three haplogroup-defining markers M48, M77 and M86 in C3-M217-individuals from Siberia, Eastern Asia and Eastern Europe. We have found that haplogroup C3c is characterized by the derived state at M48, whereas mutations at both M77 and M86 define subhaplogroup C3c1. The branch defined by M48 alone would belong to subhaplogroup C3c*, characteristic for some populations of Central and Eastern Siberia, such as Koryaks, Evens, Evenks and Yukaghirs. Subhaplogroup C3c* individuals could be considered as remnants of the Neolithic population of Siberia, based on the age of C3c*-short tandem repeat variation amounting to 4.5 ± 2.4 thousand years. PMID:22810113

  3. Dicty_cDB: SLA533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N ( AU060184 ) Dictyostelium discoideum slu...g cDNA, clone SLA533. 396 e-133 3 ( C91469 ) Dictyostelium discoideum slug cDNA, SSK317. 396 e-132 3 ( AU037400 ) Dictyostelium discoideum slug cDNA, clone SSD587. 396 e-132 3 ( AU07594...0 ) Dictyostelium discoideum slug cDNA, clone SSA167. 396 e-132 3 ( C92697 ) Dictyostelium discoideum slug... cDNA, clone SSF865. 396 e-132 3 ( C92742 ) Dictyostelium discoideum slug cDNA, clo

  4. Dicty_cDB: CHE836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone... 2154-85, mRNA sequence. 92 2e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalide...hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA

  5. cDNA: 53887 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.196480 Mus musculus adult male testis cDNA, RIKEN full-length enriched library, ... uct:DNA Segment, Chr 15 Massachusetts Institute of Technology ... 260, full insert sequence gnl|UG|Mm#S10837764 AK07 ...

  6. cDNA: 53885 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.196480 Mus musculus adult male testis cDNA, RIKEN full-length enriched library, ... uct:DNA Segment, Chr 15 Massachusetts Institute of Technology ... 260, full insert sequence gnl|UG|Mm#S10837547 AK07 ...

  7. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....

  8. 11C-imaging

    DEFF Research Database (Denmark)

    Thorpe, Michael R; Ferrieri, Abigail P; Herth, Matthias Manfred;


    The long-distance transport and actions of the phytohormone methyl jasmonate (MeJA) were investigated by using the short-lived positron-emitting isotope 11C to label both MeJA and photoassimilate, and compare their transport properties in the same tobacco plants (Nicotiana tabacum L.). There was...

  9. cDNA: 3940 [

    Lifescience Database Archive (English)

    Full Text Available H. sapiens - Hs.7188 Homo sapiens cDNA PSEC0078 fis, clone NT2RP2004036, moderately similar to M ... -Sema F=a factor in neural network ... development. gnl|UG|Hs#S4806431 AK075388 2/887_394 ...

  10. cDNA: 41587 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.30133 Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched li ... brary, clone:1110004A14 product:ethanol ... induced 6, full insert sequence gnl|UG|Mm#S9085518 ...

  11. cDNA: 39377 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.7091 Mus musculus adult pancreas islet cells cDNA, RIKEN fu ll-length enriched l ... R BETA SUBUNIT) (SSR-BETA) homolog [Homo sapiens], fu ... ... gnl|UG|Mm#S10839939 AK050505 3/6436_39377.png ...

  12. cDNA: 46817 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.30092 Mus musculus adult male cerebellum cDNA, RIKEN fu ll-length enriched libra ... 1 PRECURSOR (EC 3.4.21.-) homolog [Homo sapiens], fu ... ... gnl|UG|Mm#S10838326 AK075719 8/7837_46817.png ...

  13. cDNA: 56670 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083407 AK006184 17/9809_56670.png ...

  14. cDNA: 56898 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083407 AK006184 17/9810_56898.png ...

  15. cDNA: 56671 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083172 AK006562 17/9809_56671.png ...

  16. cDNA: 56677 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083407 AK006184 17/9809_56677.png ...

  17. cDNA: 56899 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083172 AK006562 17/9810_56899.png ...

  18. cDNA: 46327 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.292517 Mus musculus 12 days embryo spinal ganglion cDNA, RIKEN fu ll-length enri ... PHA CHAIN) (PHERS) (CML33) homolog [Homo sapiens], fu ... ... gnl|UG|Mm#S10835133 AK084031 8/7824_46327.png ...

  19. cDNA: 56891 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083407 AK006184 17/9810_56891.png ...

  20. cDNA: 56678 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083172 AK006562 17/9809_56678.png ...

  1. cDNA: 41699 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.246636 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... e/G-protein beta WD-40 repeats containing protein, fu ... ... gnl|UG|Mm#S9075317 AK016965 5/6970_41699.png ...

  2. cDNA: 56892 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.10747 Mus musculus adult male testis cDNA, RIKEN fu ll-length enriched library, ... PONSE FACTOR) (MRF-1) homolog [Rattus norvegicus], fu ... ... gnl|UG|Mm#S9083172 AK006562 17/9810_56892.png ...

  3. cDNA: 36690 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.345070 Mus musculus 16 days embryo head cDNA, RIKEN fu ll-length enriched librar ... SPLICEOSOME ASSOCIATED PROTEIN 49) [Homo sapiens], fu ... ... gnl|UG|Mm#S10835972 AK081584 2/6005_36690.png ...

  4. cDNA: 49729 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.286963 Mus musculus 10 days lactation, adult female mammary gland cDNA, RIKEN f ... d library, clone:D730027I09 product:similar to LAK-4P ... [Homo sapiens], full insert sequence gnl|UG|Mm#S10 ...

  5. cDNA: 40377 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.154312 Mus musculus 0 day neonate kidney cDNA, RIKEN full-length enriched libra ... ry, clone:D630023P19 product:HYPERTENSION ... RELATED PROTEIN 1, full insert sequence gnl|UG|Mm# ...

  6. cDNA: 45098 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.334199 Mus musculus adult male aorta and vein cDNA, RIKEN full-length enriched ... library, clone:A530074J19 product:SA rat hypertension -associated homolog, full insert sequence gnl|UG|Mm ...

  7. Fundamentals of C

    CERN Document Server

    Guruprasad, N


    The book presents a contemporary approach to programming. Complte C programs are presented as and when it is required. This Book is not a cookbook . To get the maximum benefit from this book, you should take as active a role as possible. Don`t just read the examples. Enter it into your system and try them out.

  8. C-reactive protein (United States)

    C-reactive protein (CRP) is produced by the liver. The level of CRP rises when there is inflammation throughout the body. It is one of a group of proteins called "acute phase reactants" that go up in response to inflammation. ...

  9. cDNA: 41294 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus + Mm.332387 Mus musculus similar to protocadherin 7, isoform c precursor; BH-pcdh; brain ... rain-heart protocadherin; BH-protocadherin (brain -heart) (Pcdh7), mRNA gnl|UG|Mm#S11102794 XM_132034 ...

  10. cDNA: 51322 [

    Lifescience Database Archive (English)

    Full Text Available M. musculus - Mm.246203 Mus musculus similar to mitogen-activated protein kinase 14 isoform 1; c ... tory drug binding protein; Csaids binding protein; MAP ... kinase Mxi2; p38 mitogen activated protein kinase; ... p38 MAP ... kinase; p38alpha Exip; stress-a ... gnl|UG|Mm#S175 ...

  11. Mutants of complement component C3 cleaved by the C4-specific C1-s protease.


    Mathias, P; Carrillo, C J; Zepf, N E; Cooper, N R; Ogata, R T


    To identify some of the structural features determining specific protease recognition of complement components C3 and C4, we used site-specific mutagenesis to construct mutants of murine C3 that are cleaved by the C4-specific C1-s protease. Insertion of three amino acid residues corresponding to residues at the C1-s cleavage site of human C4 into murine C3 at the analogous C3 convertase cleavage site was adequate to render the mutant protein susceptible to C1-s cleavage. In addition, insertio...

  12. Low temperature sintering of ZrC-SiC composite

    International Nuclear Information System (INIS)

    Highlights: → Zirconium carbide, silicon, and graphite powders were used as raw materials to prepare ZrC-SiC composite. → ZrC-30 vol.%SiC was sintered to a relative density of >96.1% at 1800 deg. C by SPS. → The obtained ZrC-30 vol.%SiC composite exhibited a fine microstructure and excellent mechanical properties. - Abstract: High-energy ball milling and spark plasma sintering were adopted to prepare ZrC-SiC composite. Zirconium carbide, silicon, and graphite powders were used as raw materials. ZrC-30 vol.%SiC was sintered to a relative density of >96.1% at 1800 deg. C. The composite showed a fine microstructure. The fracture strength reached up to 523.4 MPa, Vickers' hardness 18.8 GPa, fracture toughness 4.0 MPa m1/2, and elastic modulus 390.5 GPa.

  13. Dicty_cDB: CHH715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90 1e-13 1 BM0585...78 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clon

  14. Dicty_cDB: SHA256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85, mRNA sequence. 92 3e-14 1 DR447725 |DR4477...94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cD...acted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90 1e-13 1 dna update 2005.12. 5

  15. Dicty_cDB: VHA346 [Dicty_cDB

    Lifescience Database Archive (English)


  16. Dicty_cDB: VSG609 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HLVLNLKKLILVHHTVVVVVVPQLVPLLVQVQVQVHQEQ FTIK*ilnynei--- Frame C: fwfwfwfkwyfrrfwfrfrfrfrlr*rfrfrfrccqwftirfrccqwftir...frcc*wfti wcpnwftircw*cfrcfhw*piwfsisrn*ywfiiqw*w*wcpnwcrywfrfrfrfirns lllnkf*iitks--- Homology vs C

  17. Dicty_cDB: VHI283 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e C: nsniyi**ne*vnnfilnfgfnfshlcstqipiii*rfiik*fk*psnwftiilwftirf klririphn*hrfii...fwfwfwfkwyfrrfwfrfrfrfrlr*rfrfrfrccqwftirfrcc qwftirfrcc*wftiwcpnwftircw*cfrcfhw*piwfsisrn*ywfiiqw*w*wcpnw c

  18. Dicty_cDB: VHM818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GFYRSKYVVNGEXRYIGTTQ--- ---RDKSKH*igyvg*c*yrc*m*ekirsfqsrlfkftirysfystcynrkeww*s*stn hh*sis*iffsr*keflpfgtcf...PTKKIIIHSIDIEIQSVKILNQQATSVTYYEPEXVAILEFQDELPVTENTILSIDFT GILNDKLKGFYRSKYVVNGEXRYIGTTQ--- ---RDKSKH*igyvg*c*yrc*m*ekirsfqsrlfkftir

  19. Dicty_cDB: AFO649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO649 (Link to dictyBase) - - - Contig-U15310-1 AFO649P (Link to Original ... 001 1 CF542178 |CF542178.1 CsC029F cDNA library of cucumber ... cultivar Addis Cucumis sativus cDNA clone CsC029F, ... 001 1 CF542168 |CF542168.1 CsC029R cDNA library of cucumber ... cultivar Addis Cucumis sativus cDNA clone CsC029R, ...

  20. Dicty_cDB: VSH274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available raspanin tspC; 173 4e-42 AE015928_2029( AE015928 |pid:none) Bacteroides thetaiotaomicron VP... 39 0.12 ...sdlcpkdgdkikyeghycgealsdqfsskiyavgaaglaigi ielvailfslfliiricrsprtrsxasilnk*ikqnk*...ces producing significant alignments: (bits) Value N ( AU267180 ) Dictyostelium discoideum vegetative cDNA c...7 ) Dictyostelium discoideum vegetative cDNA clone:VS... 1098 0.0 2 ( C84714 ) Di... Dictyostelium discoideum vegetative cDNA clone:VS... 658 0.0 2 ( C90221 ) Dictyostelium discoideum slug cDN

  1. Dicty_cDB: SLB615 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value N ( AU033920 ) Dictyostelium discoideum slug cDNA, clone SLB615. 579 e-166 2 ( AU052377 ) Dictyostelium discoideum slug... cDNA, clone SLD220. 571 e-163 2 ( AU038245 ) Dictyostelium discoideum slug cDNA, SSH465. 571 e-163 2 ( AU034608 ) Dictyostelium discoideum slug cDNA, clone SL...C616. 571 e-163 2 ( AU054006 ) Dictyostelium discoideum slug cDNA, clone SLK408. 571 e-163 2 ( AU053421 ) Di...ctyostelium discoideum slug cDNA, clone SLI617. 571 e-163 2 ( AU053322 ) Dictyostelium discoideum slug cDNA,

  2. Dicty_cDB: SLH166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 28 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU053235 ) Dictyostelium discoideum slug... cDNA, clone SLI196. 414 e-112 1 ( AU039216 ) Dictyostelium discoideum slug... cDNA, clone SLH166. 414 e-112 1 ( AU037973 ) Dictyostelium discoideum slug cDNA, clone SSH113.... 414 e-112 1 ( AU034614 ) Dictyostelium discoideum slug cDNA, clone SLC625. 414 e-112 1 ( C93961 ) Dictyostelium discoideum slug... cDNA, clone SSC860. 414 e-112 1 ( C92661 ) Dictyostelium discoideum slug cDNA, clone S

  3. Dicty_cDB: SLF627 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : (bits) Value N ( C91955 ) Dictyostelium discoideum slug cDNA, clone SSC567. 446 e-145 2 ( AU053074 ) Dictyostelium discoideum slug... cDNA, clone SLF627. 446 e-145 2 ( AU053394 ) Dictyostelium discoideum slug cDNA, SLI546. 446 e-121 1 ( AU052834 ) Dictyostelium discoideum slug cDNA, clone SL...F185. 446 e-121 1 ( AU052345 ) Dictyostelium discoideum slug cDNA, clone SLD173. 446 e-121 1 ( AU040089 ) Di...ctyostelium discoideum slug cDNA, clone SLA391. 446 e-121 1 ( AU039940 ) Dictyostelium discoideum slug cDNA,

  4. Dicty_cDB: SLE437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e E Sequences producing significant alignments: (bits) Value N ( AU061491 ) Dictyostelium discoideum slug... cDNA, clone SLE437. 535 e-148 1 ( AU051971 ) Dictyostelium discoideum slug cDNA, SSC830. 535 e-148 1 ( AU038276 ) Dictyostelium discoideum slug cDNA, clone SSH508. 535 e-148 1 ( AU03781...4 ) Dictyostelium discoideum slug cDNA, clone SSE328. 535 e-148 1 ( C94316 ) Dictyostelium discoideum slug... cDNA, clone SSK829. 535 e-148 1 ( C93202 ) Dictyostelium discoideum slug cDNA, clo

  5. Dicty_cDB: SSB106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ing significant alignments: (bits) Value N ( AU051988 ) Dictyostelium discoideum slug cDNA, clone SSB106. 57...7 e-177 2 ( C91121 ) Dictyostelium discoideum slug cDNA, clone SSJ652. 480 e-169 ...3 ( C92519 ) Dictyostelium discoideum slug cDNA, clone SSE517. 480 e-169 3 ( AU037690 ) Dictyostelium discoideum slug... cDNA, clone SSE177. 480 e-169 3 ( AU039039 ) Dictyostelium discoideum slug cDNA, clone SSM310. 480... e-169 3 ( AU051804 ) Dictyostelium discoideum slug cDNA, clone SSA256. 480 e-169

  6. Dicty_cDB: SSB387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value N ( AU051876 ) Dictyostelium discoideum slug cDNA, clone... SSB387. 383 e-123 3 ( AU037138 ) Dictyostelium discoideum slug cDNA, clone SSB522. 353 e-110 3 ( C92575 ) D...ictyostelium discoideum slug cDNA, clone SSE785. 351 e-109 3 ( AU037792 ) Dictyostelium discoideum slug cDNA..., clone SSE302. 351 e-109 3 ( C89820 ) Dictyostelium discoideum slug cDNA, clone ...SSG195. 351 e-109 3 ( AU038946 ) Dictyostelium discoideum slug cDNA, clone SSM180. 351 e-109 3 ( AU037963 )

  7. Dicty_cDB: SLH861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A Score E Sequences producing significant alignments: (bits) Value N ( AU039477 ) Dictyostelium discoideum slug... cDNA, clone SLH861. 353 3e-93 1 ( AU038935 ) Dictyostelium discoideum slug cDNA, clone SSM162. 301 8e-78... 1 ( AU038352 ) Dictyostelium discoideum slug cDNA, clone SSH606. 301 8e-78 1 ( A...U038200 ) Dictyostelium discoideum slug cDNA, clone SSH407. 301 8e-78 1 ( C94522 ) Dictyostelium discoideum slug... cDNA, clone SSL157. 301 8e-78 1 ( C94308 ) Dictyostelium discoideum slug cDNA, clone SSK769. 301 8e-78

  8. Dicty_cDB: VHF263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n*xnwkiwntfl*tiy*vfrkkhfficsktrkyfqfki*ixrqfdxcik* *c*sn*lsityn*iekgyhngxcnk**rt*kfyknlfsqnrpydqene*kt*dgkfs...NGTNISYQNKSNYCSITISNGSIGXEYLKNDEPFQLIN*rmw*ieyfc*c ggqwqrkrifn*xnwkiwntfl*tiy*vfrkkhfficsktrkyfqfki*ixrqfdxc

  9. Dicty_cDB: VFC392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 17896.1 EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C...15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon escule...9042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone c...T355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' end

  10. Dicty_cDB: SSK263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequen...ce. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycoper...4 tomato root during/after fruit set, Cornell University Lycopersicon esculentum ...flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' end, mRNA sequence... pennellii cDNA clone cLPP8K18 5' sequence, mRNA sequence. 92 3e-15 2 BG642411 |BG642411.1 EST355887 tomato

  11. Dicty_cDB: AFF396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone ...cTOD1C15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon ... |AW219042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA c...1.1 EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  12. Dicty_cDB: AFN569 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SHNMQ Frame B: ---issxxvvxpcxxxlvnvfnvxpxvlsixvsnxxkn*vvvkxxlshwpstxxlticn Frame ...C: ---yrxxxwfxhvxxfw*tsst*xxtfcrxpyrtxxrirww*nxscpigrqrxlsqyat Homology vs CSM-cDNA Score E Sequences produc

  13. [Hepatitis C in Spain]. (United States)

    Bruguera, Miguel; Forns, Xavier


    Spain has a medium endemicity of hepatitic C infection among central Europe countries and Italy. Prevalence of anti-HCV varies among regions and it ranges from 1.6 to 2.6%, which means that there may be between 480,000 and 760,000 people infected with hepatitis C virus in Spain. The prevalence is very low in people under 20 years of age and it increases from age 30 years. Prisoners and drug addicts have the highest infectious rates, between 40 and 98%. Some populations of immigrants also have a high prevalence of HCV infection, especially people from Asia and sub-Saharan countries, whereas people from Latin America have rates lower than those in the autochtones population. Spanish people with chronic hepatitis C were mainly infected via blood transfusions, IV drug use, or during some medical and surgical hospitalization. The reduction in the use of IV drugs and the programs of needle sharing, as well as the eradication of post-transfusional hepatitis, have led to a progressive reduction in the incidence of new infections (from 6.8 per 100,000 in-habitants in 1997 to 2.3 in 2003). Preliminary data suggest that an important rate of new hepatitis C cases owe to nosocomial transmission. Transmission is almost exclusively vertical in children. In spite of a two-third reduction of incident cases of hepatitis C in Spain in last few years, it is foreseeable that the number of patients with advanced HCV liver disease attended in the health-care system will increase in forthcoming years. This is due to the fact that many, still undiagnosed patients will be likely recognized for the first time as a result of some complication of the disease. All efforts to increase the screening of hidden cases of hepatitis C in primary health-care centers, allowing a prompt treatment before an advanced stage, will have a beneficial impact both in economic and social terms. PMID:16828003

  14. Testing of DLR C/C-SiC for HIFiRE 8 Scramjet Combustor (United States)

    Glass, David E.; Capriotti, Diego P.; Reimer, Thomas; Kutemeyer, Marius; Smart, Michael


    Ceramic Matrix Composites (CMCs) have been proposed for hot structures in scramjet combustors. Previous studies have calculated significant weight savings by utilizing CMCs (active and passive) versus actively cooled metallic scramjet structures. Both a C/C and a C/C-SiC material system fabricated by DLR (Stuttgart, Germany) are being considered for use in a passively cooled combustor design for HIFiRE 8, a joint Australia / AFRL hypersonic flight program, expected to fly at Mach 7 for approximately 30 sec, at a dynamic pressure of 55 kPa. Flat panels of the DLR C/C and the C/C-SiC were tested in the NASA Langley Direct Connect Rig (DCR) at Mach 5 and Mach 6 enthalpy for several minutes. Gaseous hydrogen fuel was used to fuel the scramjet combustor. The test panels were instrumented with embedded Type K and Type S thermocouples. Zirconia felt insulation was used in some of the tests to increase the surface temperature of the C/C-SiC panel for approximately 350degF. The final C/C-SiC panel was tested for 3 cycles totaling over 135 sec at Mach 6 enthalpy. Slightly more erosion was observed on the C/C panel than the C/C-SiC panels, but both material systems demonstrated acceptable recession performance for the HIFiRE 8 flight.

  15. C.A. Nothardbiblioteek

    Directory of Open Access Journals (Sweden)

    J. Swart


    Full Text Available As instructed by the Central Board of the South African Nursing Association during 1985, an investigation was launched into the function of the C.A. Not hard Library, namely to provide optimal information to members. The underlying philosophy concerned with the establishment of the library was to provide a service which is not available elsewhere. The investigation revealed however, that various training institutions in the country meet this need. As a result of the findings, as presented in the article, the C.A. Northard Library was closed on 1 December 1985 as a lending library. A unique Nursing reference library is being established in its place, with the emphasis in the future on the S. A. Nursing Association’s role in the promotion of Nursing research.

  16. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas;

    iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during...... earthworms to mineral soil horizons and the fraction of the organic horizon that is translocated to spodic material in a B-horizon is to be chosen from a range of values. Four cases were selected in that reflect common forested soil types in Denmark. In the four selected cases turnover rates (k, year-1) were...... uncertainty of 1) the turnover rate of soil organic matter, 2) aboveground litter inputs, 3) root litter distribution, and 4) the earthworm effect was evaluated. The simulated changes for typical combinations of subsoil texture class and initial soil carbon content may be compared with observed changes in the...

  17. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval


    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 �- 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924

  18. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval


    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 - 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924

  19. C-Shell Cookbook (United States)

    Currie, Malcolm J.

    This cookbook describes the fundamentals of writing scripts using the UNIX C shell. It shows how to combine Starlink and private applications with shell commands and constructs to create powerful and time-saving tools for performing repetitive jobs, creating data-processing pipelines, and encapsulating useful recipes. The cookbook aims to give practical and reassuring examples to at least get you started without having to consult a UNIX manual. However, it does not offer a comprehensive description of C-shell syntax to prevent you from being overwhelmed or intimidated. The topics covered are: how to run a script, defining shell variables, prompting, arithmetic and string processing, passing information between Starlink applications, obtaining dataset attributes and FITS header information, processing multiple files and filename modification, command-line arguments and options, and loops. There is also a glossary.

  20. Insulin C-peptide test (United States)

    C-peptide ... the test depends on the reason for the C-peptide measurement. Ask your health care provider if ... C-peptide is measured to tell the difference between insulin produced by the body and insulin injected ...

  1. Hot pressing of B4C/SiC composites

    International Nuclear Information System (INIS)

    B4C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B4C/SiC composite samples were lower than monolithic B4C in all experimental conditions. (authors)

  2. The Parallel C Preprocessor


    Eugene D. Brooks III; Gorda, Brent C.; Karen H. Warren


    We describe a parallel extension of the C programming language designed for multiprocessors that provide a facility for sharing memory between processors. The programming model was initially developed on conventional shared memory machines with small processor counts such as the Sequent Balance and Alliant FX/8, but has more recently been used on a scalable massively parallel machine, the BBN TC2000. The programming model is split-join rather than fork-join. Concurrency is exploited to use a ...

  3. Wave Star C5

    DEFF Research Database (Denmark)

    Kramer, Morten; Kristensen, Tom Sten

    Design pile loads in this document are based on the Morison equation. In Chapter 3 and 4 the background for the design loads provided in Chapter 5 are given. In the remaining chapters from Chapter 6 and onward discussions and explanations of the results are given. A historical list of activities ...... to the present revision is given in Appendix A. Calculations of extreme events with wave slamming and plunging wave breaking is included in Appendix B and C....

  4. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  5. Dicty_cDB: VFN130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XSSXXXTPKPKPKPKPTPTTSTPNLSAKSATNSPYKSSIRNASPQP TSKPK Frame B: ---xxxxxxxxxxxhhxxx...qhqnqnqnqnqhqqhqhqiyqpnqqqihhinhqlgmhhhnp hqnqn Frame C: ---xxxxxxnxxxxiixxxntktktktktntnnintkfisqisnkfti*ii

  6. Dicty_cDB: SLJ752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA sequence. ...acted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 60 1e-05 1 CA916753 |CA916753.1

  7. Dicty_cDB: SSC156 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s balsamifera subsp. trichocarpa cDNA, mRNA sequence. 62 4e-17 2 CB086276 |CB086276.1 hj82c12.g1 Hedyotis ce...ntranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj82c12, mRNA sequence. 56 1e-16 3 d

  8. Dicty_cDB: CHB132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available inas Lactuca sativa cDNA clone QGB24M14, mRNA sequence. 56 4e-19 4 CB086276 |CB086276.1 hj82c12.g1 Hedyotis ...centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj82c12

  9. Dicty_cDB: VFC319 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC319 (Link to dictyBase) - - - Contig-U16603-1 VFC319P (Link to Original ... E825000 |BE825000.1 C0508A09-3 NIA Mouse E13.5 VMB Dopamine ... cell cDNA Library Mus musculus cDNA clone C0508A09 ...

  10. Dicty_cDB: VSI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ldfytdvldlkyldafldkdprlkkyskl nkaiagviedfslvsfiplnimdkksvanliasidksngyiygsldtntaileiqeretq wnfdkyqetqekyyksy...edfslvsfiplnimdkksvanliasidksngyiygsldtntaileiqeretq wnfdkyqetqekyyksyedddvifendqdedydefskylnr*INNNKIIIIIKKK... E Sequences producing significant alignments: (bits) Value N ( AU268302 ) Dictyostelium discoideum vegeta...tive cDNA clone:VS... 928 0.0 1 ( AU268301 ) Dictyostelium discoideum vegetative cDNA c...lone:VS... 928 0.0 1 ( AU261301 ) Dictyostelium discoideum vegetative cDNA clone:

  11. Dicty_cDB: CHF675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 48 0.15 1 BG453581 |BG453581.1 NF092A07LF1F1050 Developing leaf Medicago truncatula cDNA...15 1 BG453480 |BG453480.1 NF092C08LF1F1055 Developing leaf Medicago truncatula cDNA clone NF092C08LF 5', mRN

  12. Dicty_cDB: CHA105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73-367476 strain AX4, complete sequence. 38 0.39 6 BE317387 |BE317387.2 NF068C10LF1F1070 Developing...49770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA sequence. 36 0.5

  13. Dicty_cDB: VFD346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.041 1 BE459099 |BE459099.1 EST414391 tomato developing...BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLE

  14. Dicty_cDB: SLD371 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) tag22f08.y1 Hydra EST -Kiel 1 Hydra vulgaris cDNA... 38 1.3 2 ( DN302284 ) PL04025A2C08 cDNA from sexually... mature hermaphodi... 34 3.2 2 ( DN308666 ) PL05017A2B08 cDNA from sexually mature hermaphodi... 34 3.2 2 d

  15. Dicty_cDB: AFK713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cD...NA clone NXLV_039_C04 5', mRNA sequence. 46 0.018 2 BM158719 |BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical

  16. Dicty_cDB: VHG190 [Dicty_cDB

    Lifescience Database Archive (English)


  17. Dicty_cDB: CFB889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llii cDNA clone cLPP11A1 5' sequence, mRNA sequence. 66 9e-10 2 CF811515 |CF811515.2 NA716 cDNA non acclim...ated Bluecrop library Vaccinium corymbosum cDNA 5', mRNA sequence. 70 7e-09 2 AF352

  18. Dicty_cDB: SLJ322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 BG732108 |BG732108.1 ps20c12.y4 Trichinella spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' simil...54 0.002 1 BG353063 |BG353063.1 ps20c12.y1 Trichinella spiralis ML CMVsport jasmer Trichinella spiralis cDNA

  19. Dicty_cDB: CFJ845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3754.1 EST321699 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB13E3 5... EST402393 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY19A14

  20. Dicty_cDB: SSJ182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE342564.1 EST395408 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA20O8, mRNA sequence...2683 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES17M3, mRN

  1. Dicty_cDB: SFH171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA c...82264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA se

  2. Dicty_cDB: CFJ532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2039 |AW622039.1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cD...1828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5', ... 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell Lycopersicon esculent

  3. Dicty_cDB: AFI206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ19K... AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRN

  4. Dicty_cDB: AFG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ielielpeyvlsllfgsvmfvfififiiiayrfkeidqsvldelngdt pmtddnananskeldvvtqkdlssssnpiinn...nnnnnnstlgns Frame C: kkennyyykkwr*kknhqilvyqhqlii*ghqlmervhlkvnkviwkvlimkflfmegmk iifhhqlnilwvmkfvkgihtml*e

  5. Dicty_cDB: SFD774 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence. 34 0.002 14 BF298760 |BF298760.1 021PbB01 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium b...erghei cDNA 5', mRNA sequence. 36 0.005 3 BF298776 |BF298776.1 021PbC06 Pb cDNA #20, Charles

  6. Dicty_cDB: SLD561 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N ( AU052592 ) Dictyostelium discoideum slug cDNA, clone SLD561. 206 3e-53 2 ( AU054168 ) Dictyostelium discoideum slug... cDNA, clone SLK851. 206 3e-53 2 ( AU038671 ) Dictyostelium discoideum slug cDNA, clone SSL...330. 206 3e-53 2 ( AU053081 ) Dictyostelium discoideum slug cDNA, clone SLF641. 206 3e-53 2 ( AU052708 ) Dictyostelium discoideum slu...g cDNA, clone SLD809. 206 3e-53 2 ( AU053627 ) Dictyostelium discoideum slug... cDNA, clone SLJ259. 206 3e-53 2 ( AU054174 ) Dictyostelium discoideum slug cDNA, clone

  7. Dicty_cDB: SLB652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLB652. 531 e-150 2 ( AU054012 ) Dictyostelium discoideum slug cD...NA, clone SLK416. 515 e-145 2 ( AU038238 ) Dictyostelium discoideum slug cDNA, clone SSH455. 515 e-145 2 ( A...U053479 ) Dictyostelium discoideum slug cDNA, clone SLI735. 515 e-145 2 ( AU05333...5 ) Dictyostelium discoideum slug cDNA, clone SLI413. 515 e-145 2 ( AU054088 ) Dictyostelium discoideum slug... cDNA, clone SLK575. 515 e-145 2 ( AU052377 ) Dictyostelium discoideum slug cDNA, clone SLD220. 515 e-145 2

  8. Dicty_cDB: SLG159 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alue N ( AU039673 ) Dictyostelium discoideum slug cDNA, clone SLG159. 515 e-157 2 ( AU052248 ) Dictyostelium discoideum slug... cDNA, clone SLA424. 476 e-145 2 ( C92456 ) Dictyostelium discoideum slug... cDNA, clone SSE569. 476 e-145 2 ( AU039018 ) Dictyostelium discoideum slug cDNA, clone SSM280. 476 ...e-145 2 ( AU039112 ) Dictyostelium discoideum slug cDNA, clone SSM404. 476 e-145 2 ( AU039077 ) Dictyostelium discoideum slug... cDNA, clone SSM351. 476 e-145 2 ( AU037964 ) Dictyostelium discoideum slug

  9. Dicty_cDB: SLG229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLG229. 313 e-120 2 ( AU052966 ) Dictyostelium discoideum slug cDN...A, clone SLF396. 313 e-107 4 ( AU053262 ) Dictyostelium discoideum slug cDNA, clone SLI263. 313 e-107 4 ( AU...034176 ) Dictyostelium discoideum slug cDNA, clone SLC144. 313 e-107 4 ( AU033450 ) Dictyostelium discoideum slug... cDNA, clone SLA841. 313 e-107 4 ( AU033594 ) Dictyostelium discoideum slug ...cDNA, clone SLB210. 313 e-107 4 ( AU039267 ) Dictyostelium discoideum slug cDNA, clone SLH314. 313 e-107 4 (

  10. Dicty_cDB: SLF725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value N ( AU053114 ) Dictyostelium discoideum slug cDNA, clon...e SLF725. 472 e-138 2 ( AU034546 ) Dictyostelium discoideum slug cDNA, clone SLC450. 472 e-138 2 ( C93134 ) ...Dictyostelium discoideum slug cDNA, clone SSM592. 472 e-138 2 ( AU034374 ) Dictyostelium discoideum slug... cDNA, clone SLC770. 472 e-138 2 ( AU053515 ) Dictyostelium discoideum slug cDNA, SLI819. 472 e-138 2 ( AU033378 ) Dictyostelium discoideum slug cDNA, clone SLA695. 472 e-138 2 ( AU039244

  11. Dicty_cDB: SLC575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U034586 ) Dictyostelium discoideum slug cDNA, clone SLC575. 216 8e-54 2 ( AU053333 ) Dictyostelium discoideum slug... cDNA, clone SLI409. 216 1e-53 2 ( AU038601 ) Dictyostelium discoideum slug... cDNA, clone SSL233. 216 1e-53 2 ( AU052355 ) Dictyostelium discoideum slug cDNA, clone SLD187. 216 2e-53 2 ...( AU053301 ) Dictyostelium discoideum slug cDNA, clone SLI347. 216 2e-53 2 ( AU039583 ) Dictyostelium discoideum slug... cDNA, clone SLE787. 216 2e-53 2 ( AU062090 ) Dictyostelium discoideum slug cDNA, clone SLH520. 216

  12. Dicty_cDB: SSB384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -33 1 ( AU075020 ) Dictyostelium discoideum slug cDNA, clone SSM743. 153 2e-33 1 ( AU073395 ) Dictyostelium discoideum slug... cDNA, clone SSG889. 153 2e-33 1 ( AU072094 ) Dictyostelium discoideum slug... cDNA, clone SSD411. 153 2e-33 1 ( AU071392 ) Dictyostelium discoideum slug cDNA, clone SSB384. 153... 2e-33 1 ( AU052600 ) Dictyostelium discoideum slug cDNA, clone SLD572. 153 2e-33 1 ( AU051943 ) Dictyostelium discoideum slug... cDNA, clone SSC441. 153 2e-33 1 ( AU051917 ) Dictyostelium discoideum slug cDNA, clone SS

  13. Dicty_cDB: SLE833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU035014 ) Dictyostelium discoideum slug... cDNA, clone SLE492. 428 e-136 2 ( AU033641 ) Dictyostelium discoideum slug cDNA, clone SLB259.... 428 e-136 2 ( C89992 ) Dictyostelium discoideum slug cDNA, clone SSG816. 428 e-136 2 ( AU034728 ) Dictyostelium discoideum slug... cDNA, clone SLE246. 428 e-136 2 ( AU033790 ) Dictyostelium discoideum slug... cDNA, clone SLB442. 428 e-136 2 ( AU052850 ) Dictyostelium discoideum slug cDNA, clone SLF20

  14. C/EBPalpha downregualtes c-jun expression


    Rangatia, Janki


    The transcription factor C/EBPa is crucial for the differentiation of granulocytes. Conditional expression of C/EBPa triggers neutrophilic differentiation and C/EBPa can block TPA induced monocytic differentiation of bipotential myeloid cells. In C/EBPa knockout mice, no mature granulocytes are present. A dramatic increase of c-jun mRNA in C/EBPa knockout mice fetal liver was observed. c-jun, a component of the AP-1 transcription factor complex and a co-activator of the transcription factor P...

  15. Dicty_cDB: SFE435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1C5, mRNA se...on esculentum cDNA clone cTOF19D15 5' sequence, mRNA sequence. 38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell...sculentum cDNA clone cTOE14I10 5' sequence, mRNA sequence. 38 0.10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Cornell

  16. Dicty_cDB: SLB686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73 ) D. discoideum EF1-I gene for elongation factor 1 al... 620 e-174 1 ( AU285051 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AC... 620 e-174 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... ...620 e-174 1 ( AU285015 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 620... e-174 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 620 e-174 1 ( AU284420 ) Dictyostelium discoideum gamete... cDNA clone:FC-AT2... 620 e-174 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA c

  17. Dicty_cDB: VHE451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 0.0 1 DY633979 |DY633979.1 PU1_plate4_E02 PU1 Prunus persica cDNA similar to acetyl-CoA C-acyltransferase,... PU2_plate5_K13 PU2 Prunus persica cDNA similar to acetyl-CoA C-acyltransferase, ...544 |DY637544.1 PU2_plate14_K10 PU2 Prunus persica cDNA similar to acetyl-CoA C-acyltransferase, putative / ...60 9e-14 2 DY642152 |DY642152.1 PU3_plate6_P14 PU3 Prunus persica cDNA similar to acetyl-CoA C-acyltransfera...Y648712 |DY648712.1 PU4_plate11_J11 PU4 Prunus persica cDNA similar to similar to acetyl-CoA C-acyltransfera

  18. Dicty_cDB: VSD715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone:VS... 88 5e-14 1 ( AU053803 ) Dictyostelium discoideum slug cDNA, clone S...LJ717. 88 5e-14 1 ( AU039403 ) Dictyostelium discoideum slug cDNA, clone SLH725. 88 5e-14 1 ( AU038090 ) Dictyostelium discoideum slu...g cDNA, clone SSH260. 88 5e-14 1 ( C94389 ) Dictyostelium discoideum slug cDNA, SSK608. 88 5e-14 1 ( C93239 ) Dictyostelium discoideum slug cDNA, clone SSM862.... 88 5e-14 1 ( C92872 ) Dictyostelium discoideum slug cDNA, clone SSF603. 88 5e-14 1 ( C83898 ) Dictyostelium discoideum slug

  19. Dicty_cDB: SHL853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL853 (Link to dictyBase) - - - Contig-U11096-1 SHL853P (Link to Original ... e. 107 1e-30 4 EC289560 |EC289560.1 BRAINF089623B7 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... ce. 88 5e-28 3 EC286335 |EC286335.1 BRAINF089834J4 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... . 88 5e-28 3 EC364387 |EC364387.1 IMMUNEF093542N20 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... . 98 1e-27 3 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  20. Dicty_cDB: VHB738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB738 (Link to dictyBase) - - - Contig-U11096-1 | Contig-U12663-1 VHB738P ... 3. 109 9e-44 3 EC286335 |EC286335.1 BRAINF089834J4 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... . 92 8e-40 4 EC364387 |EC364387.1 IMMUNEF093542N20 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... ce. 92 1e-39 4 EC289560 |EC289560.1 BRAINF089623B7 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... 100 1e-32 5 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  1. Photorespiration connects C3 and C4 photosynthesis. (United States)

    Bräutigam, Andrea; Gowik, Udo


    C4 plants evolved independently more than 60 times from C3 ancestors. C4 photosynthesis is a complex trait and its evolution from the ancestral C3 photosynthetic pathway involved the modification of the leaf anatomy and the leaf physiology accompanied by changes in the expression of thousands of genes. Under high temperature, high light, and the current CO2 concentration in the atmosphere, the C4 pathway is more efficient than C3 photosynthesis because it increases the CO2 concentration around the major CO2 fixating enzyme Rubisco. The oxygenase reaction and, accordingly, photorespiration are largely suppressed. In the present review we describe a scenario for C4 evolution that not only includes the avoidance of photorespiration as the major driving force for C4 evolution but also highlights the relevance of changes in the expression of photorespiratory genes in inducing and establishing important phases on the path from C3 to C4. PMID:26912798

  2. Dicty_cDB: VSK384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pighian tubule cDNA library Ctenocephalides felis cDNA clone 3232-81, mRNA sequence. 40 0.60 2 BM059302 |BM0...59302.1 2243-04 hindgut and Malpighian tubule cDNA library Ctenocephalides felis cDNA clone 2243-04, mRNA se...quence. 40 0.63 2 BF779703 |BF779703.1 3232-82 hindgut and Malpighian tubule cDNA library Ctenocephalides

  3. Dicty_cDB: VHD773 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85...uence. 88 7e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...hian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRN

  4. Dicty_cDB: AFK408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2154...-85, mRNA sequence. 92 1e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...ut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90

  5. Dicty_cDB: VHO325 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0313 Homo sapiens cDNA, mRNA sequence. 38 1.3 2 CB077403 |CB077403.1 hj53c10.g1 Hedyotis terminalis flower - Stage 2 (NYBG) Hedyotis... terminalis cDNA clone hj53c10, mRNA sequence. 38 4.2 2 CB076908 |CB076908.1 hj46b11.g1 Hedyotis... terminalis flower - Stage 2 (NYBG) Hedyotis terminalis cDNA clone hj

  6. Free C_+ -actions on C^3 are translations


    Kaliman, Shulim


    Let X' be a smooth contractible three-dimensional affine algebraic variety with a free algebraic C_+ -action on it such that S =X'// C_+ is smooth. We prove that X' is isomorphic to $S \\times \\C$ and the action is induced by a translation on the second factor. As a consequence we show that any free algebraic C_+ -action on C^3 is a translation in a suitable coordinate system.

  7. Dicty_cDB: VHB845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB845 (Link to dictyBase) - - - Contig-U16216-1 - (Link to Original site) ... s. 40 0.77 4 DY605186 |DY605186.1 IMMUNEF045816M22 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... nce. 46 1.3 1 EC307169 |EC307169.1 OVARYF089559N15 POSSUM _01-POSSUM -C-OVARY-2KB Trichosurus vulpecula cDNA c ...

  8. Dicty_cDB: CHO881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone (ACO) mRNA, complete cds. 66 9e-15 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9

  9. Dicty_cDB: AHB122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ot during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5', mRNA sequence...e QHJ21N12, mRNA sequence. 54 1e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...T311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5

  10. Dicty_cDB: VFG581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDN...A clone cTOD1C15, mRNA sequence. 92 3e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycop...524 tomato root during/after fruit set, Cornell University Lycopersicon esculentu...o flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cT

  11. Dicty_cDB: CHS483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ey sequence. 38 0.14 2 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA...490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic acid...34.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38 0.15

  12. Dicty_cDB: AFB456 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AI773934 |AI773934.1 EST255034 tomato resistant, Cornell...AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic ac...AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1C5, mRNA sequence. 38

  13. Dicty_cDB: SSE709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sicon esculentum cDNA clone cLEI12C1 5', mRNA sequence. 54 0.003 1 BF187220 |BF187220.1 EST443507 potato stolon, Cornell...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5', ... 1 BE473010 |BE473010.1 EST417863 potato stolon, Cornell University Solanum tuber

  14. Hepatitis C und Psyche

    Directory of Open Access Journals (Sweden)

    Moser G


    Full Text Available Hepatitis C ist ein globales gesundheitliches Problem und eine der häufigsten infektiösen Erkrankungen weltweit. Nur die Hälfte der Betroffenen leidet nach einer Infektion unter Symptomen, die sie ärztliche Hilfe aufsuchen läßt, weshalb es oft Zufallsbefunde sind, die zu einer Diagnose führen. Die häufigsten Beschwerden der Betroffenen in frühen Stadien der Erkrankung sind unspezifisch und führen zu einer reduzierten Lebensqualität mit verminderter Leistungsfähigkeit und psychischer Beeinträchtigung. Wird dann die Diagnose gestellt, fühlen sich die Patienten durch die infektiöse Erkrankung häufig stigmatisiert, manche leiden unter immensen Schuldgefühlen und viele erleben ihre Erkrankung als fatal. In zahlreichen Studien konnte gezeigt werden, daß Patienten mit Hepatitis C unter einer deutlich reduzierten Lebensqualität sowie häufigen Depressionen und Angstsymptomen leiden, welche durch die derzeit gängige Therapie der Hepatitis C mit Interferon-alpha und Ribavirin zusätzlich induziert oder noch verstärkt werden können. Aber mehrere Studien weisen auch darauf hin, daß die Lebensqualität der Betroffenen weniger mit dem Grad der Hepatitis als mit den psychosozialen Folgen wie der psychiatrischen Co-Morbidität, dem Krankheitsverstehen und den krankheitsbezogenen Sorgen wie Stigmatisierung korreliert. Umso wichtiger scheint nach Mitteilung der Diagnose die Evaluation der psychosozialen Situation der Betroffenen. Abgesehen von einer medikamentösen Therapie der Hepatitis ist es entsprechend dem bio-psycho-sozialen Modell der Erkrankung daher wichtig, bei Bedarf eine integrierte psychosomatische Betreuung anzubieten und/oder eine interdisziplinäre Kooperation mit FachärztInnen der Psychiatrie zu etablieren.

  15. The 4C model

    DEFF Research Database (Denmark)

    Knox, Jeanette Bresson Ladegaard


    -care unit, my project was to develop a method that could stimulate systematically dialogical moral inquiry within everyday clinical practice. My four months of ethnographic fieldwork at the neonatal intensive-care unit generated four fundamental themes that make up the scaffold of the developed model for...... ethical deliberation and decision making. The model is a reflective tool to be used by health care professionals in situ. It provides a structured and a systematic framework for dialogue that can clarify the obscurities of a case and give argumentative support for ethical decisions. This article explains...... how the 4C model was developed and whereof it consists....

  16. Programming with C++

    CERN Document Server

    Juneja, BL


    About the Book: Authors have taken special care to present the various topics in Programming with C++ in an easy-to-learn style. Almost every topic is followed by well designed live programmes so that it becomes easy to grasp the underlying principle or programming technique. A total of more than 450 live programmes are included in the book. It is also taken care that programmes are short and do not include such details which do not relate to the topic on hand. This makes them easy to be tested and suitable for practice students. Authors are confident that the book will prove its worth for th

  17. C programming language essentials

    CERN Document Server

    Ackermann, Ernest C


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. C Programming Language discusses fundamental notions, data types and objects, expressions, statements, declarations, function and program structure, the preprocessor, and the standar

  18. CLR via C#

    CERN Document Server

    Richter, Jeffrey


    Dig deep and master the intricacies of the common language runtime (CLR) and the .NET Framework 4.0. Written by a highly regarded programming expert and consultant to the Microsoft® .NET team, this guide is ideal for developers building any kind of application-including Microsoft® ASP.NET, Windows® Forms, Microsoft® SQL Server®, Web services, and console applications. You'll get hands-on instruction and extensive C# code samples to help you tackle the tough topics and develop high-performance applications.

  19. Braided C*-quantum groups


    Roy, Sutanu


    We propose a general theory of braided quantum groups in the C*-algebraic framework. More precisely, we construct braided quantum groups using manageable braided multiplicative unitaries over a regular C*-quantum group. We show that braided C*-quantum groups are equivalent to C*-quantum groups with projection.

  20. Glucocorticosteroids for viral hepatitis C

    DEFF Research Database (Denmark)

    Brok, J; Mellerup, M T; Krogsgaard, K;


    Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection.......Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection....

  1. Understanding hepatitis C. (United States)

    Yim, C K


    Chronic hepatitis C virus (HCV) infection affects over 170 million people worldwide and is a common cause for liver transplantation in Canada. The prevalence of HCV infection in the dialysis population is estimated to be 20% to 50%. Today, intravenous drug use remains the most common route of transmission. The risk of acquiring HCV infection in patients on long-term hemodialysis is expected to decrease because of the screening of blood products for HCV. The diagnostic tests for hepatitis C include anti-HCV, HCV RNA, serum ALT levels, and liver biopsy. Liver biopsy is the definitive diagnostic procedure. Of patients acutely infected with the virus 50% to 85% will become carriers. HCV infection progresses slowly and the minority of patients develop cirrhosis over 20 years. The risk of hepatocellular carcinoma is increased once cirrhosis is present. The current standard of treatment that employs interferon and ribavirin has its limitations and is not indicated for many patients groups, such as patients on long-term hemodialysis. Interferon monotherapy is possible but is poorly tolerated by patients on dialysis. Patient and family education, as well as counselling, are important in that patients infected with HCV should be partners with health care providers in the management of their disease. PMID:11785189

  2. Bioremediation of Bunker C

    International Nuclear Information System (INIS)

    In the states of Washington and Oregon, the highest priority for waste management is now given to recycling, reuse and permanent solutions as opposed to landfill disposal. Bioremediation is recognized as a treatment of choice over other technologies that do not provide permanent solutions. From a business point of view, it is usually the most cost-effective. Bioremediation works extremely well for most common hydrocarbons including aviation fuel, heating oil and diesel oil. Bunker C, a high boiling point distillate, is the most recalcitrant hydrocarbon for treatment and is the topic of this paper. Bunker C lives up to its reputation of being a very recalcitrant hydrocarbon to biodegrade. The authors have demonstrated, however, that the soil matrix standards at industrial sites in Washington and Oregon can be achieved using new bioremediation techniques. These techniques are necessary over those typically used to biodegrade jet fuel, heating oil and diesel oil. These extra steps have been developed for our own use in our treatability laboratory

  3. Friction and wear behaviors of C/C-SiC under water lubrication

    International Nuclear Information System (INIS)

    C/C-SiC composites,prepared by a modified thermal gradient chemical vapor infiltration (preparing C/C) combined with reactive melt infiltration (infiltrating Si), were studied for the friction and wear behaviors in this paper. The results show that during block-on-ring tests under water lubrication, the friction coefficient and specific wear rate of C/C-SiC samples increase with the increasing of load, but decrease with the increasing of sliding velocity,and the sliding velocity is with greater effect on the friction and wear behaviors than the load does. The C/C-SiC samples mainly subject to the grain wear and fracture wear in the process of friction. (authors)

  4. Synthesis and separation of fullerenes C60/C70

    International Nuclear Information System (INIS)

    C60/C70 was synthesized by vaporizing graphite rods. It was extracted from soot with benzene or toluene. After slowly evaporating the solution, a brown or black solid material was left. The yield was 9%. Mass spectroscopy shows that it contains mainly C60 and small amount of C70. In transmitted light the crystals appear red-brown in color and have some kinds of crystallitic forms. The mixture of C60/C70 was subjected to column chromatography using neutral alumina or graphite. Column chromatography on neutral alumina with n-hexane as eluant gave satisfactory separation in milligram quantities. Pure factions containing C60 (>99%) were obtained. Column chromatography on graphite with n-hexane-toluene as eluant gave an excellent separation in more than 100 milligram quantities. Pure fractions containing C60 (>99%) were obtained quickly. The result showed that improved column chromatography on graphite is a simple and effective separation method to obtain the pure C60

  5. Dicty_cDB: AFO372 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n esculentum cDNA clone cLED17D1, mRNA sequence. 74 2e-09 1 AW649196 |AW649196.1 EST327650 tomato germinating seedling...c, DNA sequence. 80 3e-11 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersico...ato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 similar to calreticulin, putative, m...2 |AI771812.1 EST252912 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA sequence. 74 2e...-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersicon esculentum cDNA clone cLEG27F24

  6. Dicty_cDB: AFO854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 74 5e-09 1 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersicon esculentum cDNA c... 5', mRNA sequence. 74 5e-09 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi...c, DNA sequence. 74 6e-20 4 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon escul...entum cDNA clone cLEC72A21 5' end, mRNA sequence. 74 3e-10 2 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersico...1 AW932476 |AW932476.1 EST358319 tomato fruit mature green, TAMU Lycopersicon esculentum cDNA clone cLEF48O8

  7. Dicty_cDB: AFM469 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BJ346942 ) Dictyostelium discoideum cDNA clone:dda25j18, 3' ... 212 2e-51 1 ( AU038195 ) Dictyostelium discoideum slug... cDNA, clone SSH396. 137 7e-39 2 ( AU037315 ) Dictyostelium discoideum slug cDNA, clone SSB757....7 1e-28 1 ( AU060182 ) Dictyostelium discoideum slug cDNA, clone SLA529. 137 1e-28 1 ( AU053491 ) Dictyostelium discoideum slug... cDNA, clone SLI758. 137 1e-28 1 ( AU034407 ) Dictyostelium discoideum slug cDNA, clone S...LC832. 137 1e-28 1 ( C94037 ) Dictyostelium discoideum slug cDNA, clone SSG310. 137 1e-28 1 ( C84047 ) Dictyostelium discoideum slug

  8. Low-Cost, Large C-SiC Blisk Fabrication (United States)

    Kowbel, W.; Effinger, M.


    C-SiC composites offer unique properties for propulsion applications. However, fabrication of low-cost, thick, large scale C-SiC disk for integrally bladed disk (blisk) applications has not been established yet. MER has demonstrated a new process to address this issue. Polymer-based processing was employed for interfacial coatings, consolidation and densification. Up to 40" O.C., 2" thick C-SiC composite processing was established, yielding in excess of 1.8 g/cu cm density. Computer tomography (CT) scans on the 40" O.D., 2" thick C-SiC disk showed no visible delamination, and good density uniformity. Stress-rupture testing in air was conducted at 2200 F, 2400 F and 2550 F.

  9. Dicty_cDB: VSA863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 Sequence 1 from patent US 6503729. 34 2e-05 13 BG523152 |BG523152.1 29-47 Stevia field grown leaf cDNA Stevia rebaudian...a cDNA 5', mRNA sequence. 60 2e-05 1 BG525215 |BG525215.1 45-7 Stevia field grown leaf cDNA Stevia rebaudian... field grown leaf cDNA Stevia rebaudiana cDNA 5', mRNA sequence. 60 2e-05 1 BG524924 |BG524924.1 1-26 Stevia... field grown leaf cDNA Stevia rebaudiana cDNA 5', mRNA sequence. 60 2e-05 1 BG524136 |BG524136.1 39-26 Stevia... field grown leaf cDNA Stevia rebaudiana cDNA 5', mRNA sequence. 60 2e-05 1 AC

  10. Dicty_cDB: VFF530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon escul...19042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone ...ST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' en...sculentum cDNA clone cTOE2D11 5' sequence, mRNA sequence. 92 2e-16 3 AW217896 |AW217896.1 EST296610 tomato flower buds, anthesis, Cor...nell University Lycopersicon esculentum cDNA clone cTOD1

  11. Dicty_cDB: VFK428 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 0.004 1 AI772499 |AI772499.1 EST253599 tomato resistant, Cornell Lycopersicon e...3 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT3...0 cSTD Solanum tuberosum cDNA clone cSTD13M7 5' sequence, mRNA sequence. 54 0.004 1 BF187223 |BF187223.1 EST443510 potato stolon, Cor...nell University Solanum tuberosum cDNA clone cSTA39F1 5' sequence, mRNA sequence. 5...Lycopersicon esculentum cDNA clone cLEG70A23 5' end, mRNA sequence. 54 0.004 1 BE353311 |BE353311.1 EST40044

  12. Meningococcal disease serogroup C

    Directory of Open Access Journals (Sweden)

    Cuevas IE


    Full Text Available Félix O Dickinson1, Antonio E Pérez1, Iván E Cuevas21Department of Epidemiology, “Pedro Kourí” Institute, Havana, Cuba; 2Pharmacovigilance Group, Finlay Institute, Havana, CubaAbstract: Despite current advances in antibiotic therapy and vaccines, meningococcal disease serogroup C (MDC remains a serious threat to global health, particularly in countries in North and Latin America, Europe, and Asia. MDC is a leading cause of morbidity, mortality, and neurological sequelae and it is a heavy economic burden. At the individual level, despite advances in antibiotics and supportive therapies, case fatality rate remains nearly 10% and severe neurological sequelae are frequent. At the population level, prevention and control of infection is more challenging. The main approaches include health education, providing information to the public, specific treatment, chemoprophylaxis, and the use of vaccines. Plain and conjugate meningococcal C polysaccharide vaccines are considered safe, are well tolerated, and have been used successfully for over 30 years. Most high-income countries use vaccination as a part of public health strategies, and different meningococcal C vaccination schedules have proven to be effective in reducing incidence. This is particularly so with conjugate vaccines, which have been found to induce immunogenicity in infants (the age group with the highest incidence rates of disease, stimulate immunologic memory, have longer effects, not lead to hyporesponsiveness with repeated dosing, and decrease acquisition of nasopharyngeal carriage, inducing herd immunity. Antibiotics are considered a cornerstone of MDC treatment and must be administered empirically as soon as possible. The choice of which antibiotic to use should be made based on local antibiotic resistance, availability, and circulating strains. Excellent options for a 7-day course are penicillin, ampicillin, chloramphenicol, and third-generation cephalosporins (ceftriaxone and

  13. Dicty_cDB: AHA269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clo...BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis 2154-85, mRNA sequence. 92 2e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 8e-14 1

  14. Dicty_cDB: SLH514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value N ( AU039548 ) Dictyostelium discoideum slug cDNA, clone SLE732.... 454 e-136 2 ( AU039718 ) Dictyostelium discoideum slug cDNA, clone SLG254. 454 e-136 2 ( AU039306 ) Dictyo...stelium discoideum slug cDNA, clone SLH514. 454 e-136 2 ( BJ374238 ) Dictyostelium discoideum cDNA clone:ddc...6i02, 3' e... 454 e-133 2 ( BJ340018 ) Dictyostelium discoideum cDNA clone:dda11f...12, 3' ... 454 e-133 2 ( BJ339734 ) Dictyostelium discoideum cDNA clone:dda10o01, 3' ... 454 e-133 2 ( BJ399349 ) Dict

  15. Photosynthetic carbon assimilation in C3- and C4-plants

    International Nuclear Information System (INIS)

    The photosynthetic mechanisms of plants have become to be well understood by the use of radioactive and stable isotopes. This review included the distribution of 14C in photosynthetic intermediates by assimilation with 14CO2, resultant CO2 receptors, Calvin cycle, C4 photosynthetic pathway, differences between the photosynthetic pathway for C3-plants and that for C4-plants, photorespiration, glycolate pathway, the yield of photosynthetic quanta and the relationship between assimilation with 14CO2 and 13C values. Reference was made to the photosynthetic mechanism in 13C-NMR follow-up with 13CO2. (Chiba, N.)

  16. Dicty_cDB: VSH575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GLDEKPNIGLDSMATANALN APKKVVEGLGXVXKGIGGKPTYAVFGADGQPTGEQQEQQQYX Frame B: nfipik*kcllqlnvvlalkppih*nqlllttihttrvvsnaqlail...... 946 0.0 1 ( AU269617 ) Dictyostelium discoideum vegetative cDNA clone:VS... 9...46 0.0 1 ( AU269523 ) Dictyostelium discoideum vegetative cDNA clone:VS... 946 0.0 1 ( AU269062 ) Dictyostelium discoideum vegeta...tive cDNA clone:VS... 946 0.0 1 ( AU267642 ) Dictyostelium discoideum vegetative cDNA c...lone:VS... 946 0.0 1 ( AU266984 ) Dictyostelium discoideum vegetative cDNA clone:VS... 946 0.0 1 ( BJ330316

  17. Dicty_cDB: VHC552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available estuca arundinacea cDNA, mRNA sequence. 58 3e-04 1 CJ845953 |CJ845953.1 Triticum aestivum cDNA clone:whatlal...39n16, 3' end. 58 3e-04 1 CJ787559 |CJ787559.1 Triticum aestivum cDNA clone:whatl18a10, 3' end. 58 3e-04 1 C...J787558 |CJ787558.1 Triticum aestivum cDNA clone:whatl18a09, 3' end. 58 3e-04 1 C

  18. Dicty_cDB: SLE194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E Sequences producing significant alignments: (bits) Value N ( AU034692 ) Dictyostelium discoideum slug cDNA..., clone SLE194. 268 2e-91 2 ( AU033787 ) Dictyostelium discoideum slug cDNA, clon...e SLB438. 260 1e-86 2 ( AU040025 ) Dictyostelium discoideum slug cDNA, clone SLH472. 260 1e-86 2 ( AU033785 ...) Dictyostelium discoideum slug cDNA, clone SLB436. 260 1e-86 2 ( AU033617 ) Dictyostelium discoideum slug c...DNA, clone SLB234. 260 1e-86 2 ( AU039989 ) Dictyostelium discoideum slug cDNA, clone SLH386. 260 1e-86 2 (

  19. Dicty_cDB: SLD238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N ( AU052389 ) Dictyostelium discoideum slug cDNA, clone SLD238. 533 e-156... 2 ( AU052473 ) Dictyostelium discoideum slug cDNA, clone SLD384. 533 e-156 2 ( AU053348 ) Dictyostelium discoideum slug... cDNA, clone SLI436. 533 e-156 2 ( AU052949 ) Dictyostelium discoideum slug cDNA, clone SLF368. ...533 e-156 2 ( AU033974 ) Dictyostelium discoideum slug cDNA, clone SLB679. 533 e-...156 2 ( AU052416 ) Dictyostelium discoideum slug cDNA, clone SLD280. 533 e-156 2 ( AU052488 ) Dictyostelium discoideum slug

  20. Dicty_cDB: SLE859 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lignments: (bits) Value N ( AU073002 ) Dictyostelium discoideum slug cDNA, clone SSF684. 278 1e-70 1 ( AU039...623 ) Dictyostelium discoideum slug cDNA, clone SLE859. 278 1e-70 1 ( AU039285 ) Dictyostelium discoideum slug... cDNA, clone SLH350. 278 1e-70 1 ( AU038051 ) Dictyostelium discoideum slug cDNA, clone SSH205. 278 1e-70 ...1 ( AU037986 ) Dictyostelium discoideum slug cDNA, clone SSH126. 278 1e-70 1 ( AU...036928 ) Dictyostelium discoideum slug cDNA, clone SSB829. 278 1e-70 1 ( AU034464 ) Dictyostelium discoideum slug

  1. Dicty_cDB: SLC274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ng significant alignments: (bits) Value N ( AU034219 ) Dictyostelium discoideum slug cDNA, clone SLC274. 642... 0.0 2 ( AU037813 ) Dictyostelium discoideum slug cDNA, clone SSE327. 634 0.0 2 (... AU052987 ) Dictyostelium discoideum slug cDNA, clone SLF452. 642 e-180 1 ( AU039141 ) Dictyostelium discoideum slug... cDNA, clone SSM439. 642 e-180 1 ( AU038903 ) Dictyostelium discoideum slug cDNA, clone SSM121. 642 ...e-180 1 ( AU038342 ) Dictyostelium discoideum slug cDNA, clone SSH587. 642 e-180 1 ( AU034237 ) Dictyostelium discoideum slug

  2. Dicty_cDB: SLC461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bits) Value N ( AU052389 ) Dictyostelium discoideum slug cDNA, clone SLD238. 531 ...e-155 2 ( AU034553 ) Dictyostelium discoideum slug cDNA, clone SLC461. 531 e-155 2 ( AU052473 ) Dictyostelium discoideum slug... cDNA, clone SLD384. 531 e-155 2 ( AU053348 ) Dictyostelium discoideum slug cDNA, clone SLI...436. 531 e-155 2 ( AU052949 ) Dictyostelium discoideum slug cDNA, clone SLF368. 5...31 e-155 2 ( AU033974 ) Dictyostelium discoideum slug cDNA, clone SLB679. 531 e-155 2 ( AU052416 ) Dictyostelium discoideum slug

  3. Dicty_cDB: SLD814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N ( AU053560 ) Dictyostelium discoideum slu...g cDNA, clone SLJ113. 74 1e-09 1 ( AU053233 ) Dictyostelium discoideum slug cDNA, c...lone SLI189. 74 1e-09 1 ( AU052710 ) Dictyostelium discoideum slug cDNA, clone SLD814. 74 1e-09 1 ( AU034917... ) Dictyostelium discoideum slug cDNA, clone SLE688. 74 1e-09 1 ( AU034895 ) Dictyostelium discoideum slug...927 ) Dictyostelium discoideum cDNA clone:dda4n09, 3' e... 72 5e-09 1 ( AU039941 ) Dictyostelium discoideum slug

  4. Dicty_cDB: SLI263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ng significant alignments: (bits) Value N ( AU052966 ) Dictyostelium discoideum slug cDNA, clone SLF396. 313... e-133 3 ( AU053262 ) Dictyostelium discoideum slug cDNA, clone SLI263. 313 e-133 3 ( AU034176 ) Dictyostelium discoideum slug... cDNA, clone SLC144. 313 e-133 3 ( AU033450 ) Dictyostelium discoideum slug cDNA, clone SL...A841. 313 e-133 3 ( AU033594 ) Dictyostelium discoideum slug cDNA, clone SLB210. ...313 e-133 3 ( AU039267 ) Dictyostelium discoideum slug cDNA, clone SLH314. 313 e-133 3 ( AU034754 ) Dictyostelium discoideum slug

  5. Dicty_cDB: SLA715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s: (bits) Value N ( AU033392 ) Dictyostelium discoideum slug cDNA, clone SLA715. 430 e-134 2 ( AU061433 ) Di...ctyostelium discoideum slug cDNA, clone SLE229. 125 1e-24 1 ( AU052935 ) Dictyostelium discoideum slug... cDNA, clone SLF348. 125 1e-24 1 ( AU052765 ) Dictyostelium discoideum slug cDNA, clone... SLK604. 125 1e-24 1 ( AU052509 ) Dictyostelium discoideum slug cDNA, clone SLD436. 125 1e-24 1 ( AU052458 )... Dictyostelium discoideum slug cDNA, clone SLD352. 125 1e-24 1 ( AU052357 ) Dictyostelium discoideum slug

  6. Dicty_cDB: SLA579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nts: (bits) Value N ( AU052130 ) Dictyostelium discoideum slug cDNA, clone SLA579. 313 e-144 4 ( AU034239 ) ...Dictyostelium discoideum slug cDNA, clone SLC311. 313 e-134 4 ( AU052966 ) Dictyostelium discoideum slug... cDNA, clone SLF396. 313 e-134 4 ( AU053398 ) Dictyostelium discoideum slug cDNA, SLI557. 313 e-133 4 ( AU034057 ) Dictyostelium discoideum slug cDNA, clone SLB864. 313 e-133 4 ( AU033607... ) Dictyostelium discoideum slug cDNA, clone SLB224. 313 e-133 4 ( AU052240 ) Dictyostelium discoideum slug

  7. Dicty_cDB: SLD591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU052612 ) Dictyostelium discoideum slug... cDNA, clone SLD591. 394 e-106 1 ( AU040016 ) Dictyostelium discoideum slug... cDNA, clone SLH448. 365 e-100 2 ( AU040010 ) Dictyostelium discoideum slug cDNA, clone SLH434.... 365 e-100 2 ( AU039914 ) Dictyostelium discoideum slug cDNA, clone SLG735. 365 e-100 2 ( AU039555 ) Dictyostelium discoideum slug... cDNA, clone SLE743. 365 e-100 2 ( AU033990 ) Dictyostelium discoideum slug cDNA, clon

  8. Dicty_cDB: SLI465 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value N ( AU053548 ) Dictyostelium discoideum slug cDNA, clone S...LI884. 841 0.0 1 ( AU053363 ) Dictyostelium discoideum slug cDNA, clone SLI465. 841 0.0 1 ( AU053267 ) Dictyostelium discoideum slug... cDNA, clone SLI280. 841 0.0 1 ( AU052974 ) Dictyostelium discoideum slug... cDNA, clone SLF417. 841 0.0 1 ( AU052524 ) Dictyostelium discoideum slug cDNA, clone SLD467.... 841 0.0 1 ( AU039588 ) Dictyostelium discoideum slug cDNA, clone SLE804. 841 0.0 1 ( AU039561 ) Dictyostelium discoideum slug

  9. Dicty_cDB: SLG207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9696 ) Dictyostelium discoideum slug cDNA, clone SLG207. 359 e-165 3 ( AU052383 )... Dictyostelium discoideum slug cDNA, clone SLD229. 359 e-165 3 ( AU053303 ) Dictyostelium discoideum slug cD...NA, clone SLI350. 359 e-165 3 ( AU053244 ) Dictyostelium discoideum slug cDNA, clone SLI220. 359 e-165 3 ( A...U033975 ) Dictyostelium discoideum slug cDNA, clone SLB680. 359 e-165 3 ( AU03471...4 ) Dictyostelium discoideum slug cDNA, clone SLE226. 359 e-165 3 ( AU039609 ) Dictyostelium discoideum slug

  10. Dicty_cDB: SLC852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 422 ) Dictyostelium discoideum slug cDNA, clone SLC852. 400 e-111 2 ( AU053615 ) Dictyostelium discoideum slug... cDNA, clone SLJ236. 400 e-111 2 ( AU038588 ) Dictyostelium discoideum slug cDN...A, clone SSL212. 400 e-111 2 ( AU038481 ) Dictyostelium discoideum slug cDNA, clone SSH773. 400 e-111 2 ( AU...052369 ) Dictyostelium discoideum slug cDNA, clone SLD208. 400 e-111 2 ( AU033953 ) Dictyostelium discoideum slug... cDNA, clone SLB652. 400 e-111 2 ( AU054012 ) Dictyostelium discoideum slug

  11. Dicty_cDB: SLF671 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 04.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU061433 ) Dictyostelium discoideum slu...g cDNA, clone SLE229. 335 5e-88 1 ( AU053094 ) Dictyostelium discoideum slug cDNA, ...clone SLF671. 335 5e-88 1 ( AU052935 ) Dictyostelium discoideum slug cDNA, clone SLF348. 335 5e-88 1 ( AU052...765 ) Dictyostelium discoideum slug cDNA, clone SLK604. 335 5e-88 1 ( AU052509 ) ...Dictyostelium discoideum slug cDNA, clone SLD436. 335 5e-88 1 ( AU052458 ) Dictyostelium discoideum slug cDN

  12. Dicty_cDB: VFD577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA cl...tical) Pinus taeda cDNA clone NXLV_039_C04 5', mRNA sequence. 46 0.017 2 BM158719 |...p library Pinus taeda cDNA clone ST11A05, mRNA sequence. 46 0.016 2 BM158718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Ver

  13. Isomerisation of c4-c6 aldoses with zeolites

    DEFF Research Database (Denmark)


    The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevat...... the catalyst. The ketoses obtained are used as sweeteners in the food and/or brewery industry, or treated to obtain downstream platform chemicals such as lactic acid, HMF, levulinic acid, furfural, MMHB, and the like....

  14. Dicty_cDB: AFA547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA sequence. 74 ...e, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ19K24 5', mRNA sequence. 7...on esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 2e-09 1 AW626316 |AW626316.1 EST320223 tomato radicl

  15. Dicty_cDB: SLH214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 51 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 498 e-137 1 ( AU285021 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 498 e-137 1 ( AU285015 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 498 e-137 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 498 e...-137 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 498 e-137 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 498 e-137 1 ( AU284225 ) Dictyostelium discoideum gamete

  16. Dicty_cDB: SLB733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-163 1 ( C23695 ) Dictyostelium discoideum gamete cDNA, clone FC-AK02. 561 e-156 2 ( AC116100 ) Dictyostel...ium discoideum chromosome 2 map 6163571... 561 e-156 1 ( AU284631 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 561 e-156 1 ( AU284520 ) Dictyostelium discoideum gamete cDNA clone:...FC-BB0... 561 e-156 1 ( AU284518 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 561 e-156 1 ( AU2844...49 ) Dictyostelium discoideum gamete cDNA clone:FC-AW0... 561 e-156 1 ( AU284378

  17. Dicty_cDB: SLE664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 521 e-144 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 521 e-144 1 ( AU285021 ) D...ictyostelium discoideum gamete cDNA clone:FCL-AA... 521 e-144 1 ( AU285015 ) Dictyostelium discoideum game...te cDNA clone:FCL-AA... 521 e-144 1 ( AU284628 ) Dictyostelium discoideum gamete cD...NA clone:FC-BF1... 521 e-144 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 521 e-144 1... ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 521 e-144 1 (

  18. Dicty_cDB: SLC589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available te cDNA clone:FCL-AC... 456 e-124 1 ( AU285021 ) Dictyostelium discoideum gamete cD...NA clone:FCL-AA... 456 e-124 1 ( AU285015 ) Dictyostelium discoideum gamete cDNA ...clone:FCL-AA... 456 e-124 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 456 e-124 1 ( ...AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 456 e-124 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 456 e-124 1 ( AU284225 ) Dictyostelium discoideum gamete

  19. Dicty_cDB: SLA544 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-139 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 505 e-1...39 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 505 e-139 1 ( AU285015 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 505 e-139 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone...:FC-BF1... 505 e-139 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC...-AT2... 505 e-139 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 505 e-139 1 ( AU284225

  20. Dicty_cDB: SLF652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elongation factor 1 al... 450 e-122 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 450... e-122 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 450 e-122 1 ( AU285015 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 450 e-122 1 ( AU284628 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 450 e-122 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clon...e:FC-AT2... 450 e-122 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 450 e-122 1 ( AU28

  1. Dicty_cDB: SLG134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 ) Dictyostelium discoideum gamete cDNA, clone FC-AK02. 529 e-158 2 ( AU284631 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 529 e-158 2 ( AU284449 ) Dictyostelium discoideum gamete... cDNA clone:FC-AW0... 529 e-158 2 ( AU284368 ) Dictyostelium discoideum gamete cDNA clone:FC-AP1... 529 e-...158 2 ( AU284518 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 529 e-158 2 ( AU284520 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 529 e-158 2 ( AU284378 ) Dictyostelium discoideum gamete

  2. Dicty_cDB: SLB720 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E Sequences producing significant alignments: (bits) Value N ( AU284939 ) Dictyostelium discoideum gamete c...DNA clone:FC-BQ1... 529 e-146 1 ( AU284921 ) Dictyostelium discoideum gamete cDNA clone:FC-BP2... 529 e-146 ...1 ( AU284887 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1... 529 e-146 1 (... AU284668 ) Dictyostelium discoideum gamete cDNA clone:FC-BG1... 529 e-146 1 ( AU284515 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 529 e-146 1 ( AU284299 ) Dictyostelium discoideum gamete cDNA clone:FC-AJ

  3. Dicty_cDB: SLF323 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available factor 1 al... 531 e-147 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 531 e-147 1 ( A...U285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 531 e-147 1 ( AU28...5015 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 531 e-147 1 ( AU284628 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 531 e-147 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... ...531 e-147 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 531

  4. Dicty_cDB: SLG875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ctyostelium discoideum gamete cDNA clone:FCL-AC... 498 e-137 1 ( AU285021 ) Dictyostelium discoideum gamete ...cDNA clone:FCL-AA... 498 e-137 1 ( AU285015 ) Dictyostelium discoideum gamete cDN...A clone:FCL-AA... 498 e-137 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 498 e-137 1 ...( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 498 e-137 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 498 e-137 1 ( AU284225 ) Dictyostelium discoideum gamete

  5. 8C.02

    DEFF Research Database (Denmark)

    Jensen, B L; Frederiksen-Moller, B; Jorgensen, J S;


    OBJECTIVE: The serine protease prostasin (PRSS8, CAP1) and its activator matriptase and inhibitor nexin-1 are necessary for normal placental development in mice. Prostasin is regulated by aldosterone in the kidney and may activate the epithelial sodium channel (ENaC). Preeclampsia is characterized...... delivery (control = 39 and preeclampsia 40 weeks). Prostasin, matriptase, nexin-1 and HAIs were measured by qPCR and western immunoblotting (prostasin, matriptase, nexin-1) and ELISA (prostasin). Aldosterone was measured in plasma and urine by ELISA. RESULTS: Women with preeclampsia displayed lower levels...... of aldosterone in plasma and in spot urine normalized for creatinine (p = 0.0001). Placental weight was not different between groups. Prostasin, matriptase, HAI 1 and 2, and nexin mRNA abundances were not different in placental tissue between groups. Prostasin and nexin protein level in placental...

  6. Mammalian phospholipase C. (United States)

    Kadamur, Ganesh; Ross, Elliott M


    Phospholipase C (PLC) converts phosphatidylinositol 4,5-bisphosphate (PIP(2)) to inositol 1,4,5-trisphosphate (IP(3)) and diacylglycerol (DAG). DAG and IP(3) each control diverse cellular processes and are also substrates for synthesis of other important signaling molecules. PLC is thus central to many important interlocking regulatory networks. Mammals express six families of PLCs, each with both unique and overlapping controls over expression and subcellular distribution. Each PLC also responds acutely to its own spectrum of activators that includes heterotrimeric G protein subunits, protein tyrosine kinases, small G proteins, Ca(2+), and phospholipids. Mammalian PLCs are autoinhibited by a region in the catalytic TIM barrel domain that is the target of much of their acute regulation. In combination, the PLCs act as a signaling nexus that integrates numerous signaling inputs, critically governs PIP(2) levels, and regulates production of important second messengers to determine cell behavior over the millisecond to hour timescale. PMID:23140367

  7. C*-algebras associated with Hilbert C*-quad modules of C*-textile dynamical systems

    CERN Document Server

    Matsumoto, Kengo


    A $C^*$-textile dynamical system $({\\cal A}, \\rho,\\eta,\\Sigma^\\rho,\\Sigma^\\eta, \\kappa)$ connsists of a unital $C^*$-algebra ${\\cal A}$, two families of endomorphisms ${\\rho_\\alpha}_{\\alpha \\in \\Sigma^\\rho}$ and ${\\eta_a}_{a \\in \\Sigma^\\eta}$ of ${\\cal A}$ and certain commutation relations $\\kappa$ among them. It yields a two-dimensional subshift and multi structure of Hilbert $C^*$-bimodules, which we call a Hilbert $C^*$-quad module. We introduce a $C^*$-algebra from the Hilbert $C^*$-quad module as a two-dimensional analogue of Pimsner's construction of $C^*$-algebras from Hilbert $C^*$-bimodules. We study the $C^*$-algebras defined by the Hilbert $C^*$-quad modules and prove that they have universal properties subject to certain operator relations. We also present its examples arising from commuting matrices.

  8. New Volleyballenes: Y20C60, La20C60, and Lu20C60


    Wang, Jing; Liu, Ying(College of Nuclear Science and Technology, Beijing Normal University, 100875, Beijing, China)


    New stable Volleyballenes Y20C60, La20C60, and Lu20C60 molecular clusters have been proposed using first-principles density functional theory studies. In conjunction with recent findings for the scandium system, these findings establish Volleyballene M20C60 molecules as a stable general class of fullerene family. All M20C60 (M=Y, La, and Lu) molecules have Th point group symmetries and relatively large HOMO-LUMO gaps.

  9. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  10. Dicty_cDB: CHQ769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al

  11. Dicty_cDB: AHA345 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PLSKRLGFRANQR*tifrylvkr*skh*igyvg*c*y rc*m*ekirsfqsrlfkftirysfystcynrkeww*s*stnhh*sis*iffsr*keflpf gtcfgskrg...nfcn*k**wy--- ---LIEDHPYSSRFNEIFVQLLKPLSKRLGFRANQR*tifrylvkr*skh*igyvg*c*y rc*m*ekirsfqsrlfkftirysfystcynrke

  12. Dicty_cDB: SLB553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value N ( AU033875 ) Dictyostelium discoideum slug cDNA, clone SLB553.... 519 e-174 2 ( BJ399383 ) Dictyostelium discoideum cDNA clone:dds5o14, 3' e... 511 e-172 2 ( BJ382433 ) Dict...yostelium discoideum cDNA clone:ddc44a20, 3' ... 511 e-172 2 ( BJ382397 ) Dictyostelium discoideum cDNA clon...e:ddc44i17, 3' ... 511 e-172 2 ( AU061817 ) Dictyostelium discoideum slug cDNA, c...lone SLG216. 511 e-172 2 ( BJ395534 ) Dictyostelium discoideum cDNA clone:dds39p05, 5' ... 511 e-172 2 ( C89950 ) Dict

  13. Dicty_cDB: SSM844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycw*icl*n*kaydqs*c*kshlfvc**yyptnccfnfsnl*tl*g*rwifihylqw *kyfw**fityynp*mysctlrerrppnvyrskq**fak*METLISFSYD...e A: s*yycw*icl*n*kaydqs*c*kshlfvc**yyptnccfnfsnl*tl*g*rwifihylqw *kyfw**fityynp*

  14. Hemoglobin C, S-C, and E Diseases (United States)

    ... Anemia Vitamin Deficiency Anemia Anemia of Chronic Disease Aplastic Anemia Autoimmune Hemolytic Anemia Sickle Cell Disease Hemoglobin C, S- ... Anemia Vitamin Deficiency Anemia Anemia of Chronic Disease Aplastic Anemia Autoimmune Hemolytic Anemia Sickle Cell Disease Hemoglobin C, S- ...

  15. Dicty_cDB: SLK426 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d pieces. 46 0.73 4 BM411447 |BM411447.1 EST585774 tomato breaker fruit Lycopersicon esculentum cDNA clone c...lii trichome, Cornell University Lycopersicon pennellii cDNA clone cLPT15H15 5', mRNA sequence. 34 1.1 2 AI4...87200 |AI487200.1 EST245522 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED9O12, mRNA sequence. 3...4 1.3 2 BM535783 |BM535783.1 EST588805 tomato breaker fruit Lycopersicon cDNA clone cLEG68I2 5' end, mRNA sequence. 34 1.3 2 BE460297 |BE460297.1 EST411632 tomato breaker fruit, TIGR Lycopersi

  16. Dicty_cDB: AFE540 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fruit Lycopersicon esculentum cDNA clone cLEG60D11 5' end, mRNA sequence. 58 5e-05 1 AW...649114 |AW649114.1 EST327568 tomato germinating seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M3 5...', mRNA sequence. 58 5e-05 1 AI488943 |AI488943.1 EST247282 tomato ovary, TAMU Lycopersi...con esculentum cDNA clone cLED18N11, mRNA sequence. 58 5e-05 1 BM536267 |BM536267.1 EST589289 tomato breaker fruit Lycopersi...93.1 EST588115 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64D19 5' end, mRNA sequence. 58 5

  17. Dicty_cDB: SFE354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-14 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clone cLEC72A21 5' end, mRN...ity Lycopersicon esculentum cDNA clone cLEZ19K24 5', mRNA sequence. 68 3e-07 1 BE45...9798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM8G1...3, mRNA sequence. 68 3e-07 1 AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersi...minating seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 68 3e-07

  18. Dicty_cDB: AFK102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 4e...7 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi...lar to calreticulin, putative, mRNA sequence. 74 4e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersico...tal stress. 92 2e-14 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clone cLEC7...n esculentum cDNA clone cLED17D1, mRNA sequence. 74 4e-09 1 AW649196 |AW649196.1 EST327650 tomato germinating

  19. Dicty_cDB: AFI106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM8... seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 4e-0...G13, mRNA sequence. 74 4e-09 1 AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon escul...entum cDNA clone cLES18L5, mRNA sequence. 74 4e-09 1 AW649196 |AW649196.1 EST327650 tomato germinating...9 1 AW932476 |AW932476.1 EST358319 tomato fruit mature green, TAMU Lycopersicon esculentum cDNA clone cLEF48

  20. Dicty_cDB: AFA118 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM8G13, mRNA sequ...AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi...lar to calreticulin, putative, mRNA sequence. 74 3e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lyco...c, DNA sequence. 80 1e-11 2 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDN...ence. 74 3e-09 1 AI771812 |AI771812.1 EST252912 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38

  1. Dicty_cDB: AFH520 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM8G13, mRNA ...nce, mRNA sequence. 70 4e-08 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi...W626316 |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentu...m cDNA clone cLEZ19K24 5', mRNA sequence. 68 2e-07 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersico...sequence. 68 2e-07 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cL

  2. Dicty_cDB: AFE612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 5e-09... 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi...ideum calreticulin mRNA, complete cds. 1059 0.0 5 BD248385 |BD248385.1 Gene participating in tolerance again...489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED17D1, mRNA sequence. ...74 5e-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersicon esculentum cDNA clone cLEG

  3. The C-12/C-13 Ratio as a Chemistry Indicator (United States)

    Wirstroem, Eva; Geppert, Wolf; Persson, Carina; Charnley, Steven


    Isotopic ratios of elements are considered powerful tools, e.g. in tracing the origin of solar system body materials, or the degree of nucleosynthesis processing throughout the Galaxy. In interstellar molecules, some isotopic ratios like H/D and C-12/C-13 can also be used as indicators of their chemical origin. Isotope fractionation in gas-phase chemical reactions and gas-dust interaction makes observations of the ratio between C-12 and C-13 isotopologues suitable to distinguish between different formation scenarios. We will present observations of the C-12/C-13 ratio in methanol and formaldehyde towards a sample of embedded, massive young stellar objects. In relation to this we also present results from theoretical modeling showing the usefulness of the C-12/C-13 ratio as a chemistry indicator.

  4. Dicty_cDB: SSD544 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ts) Value N ( AU037369 ) Dictyostelium discoideum slug cDNA, clone SSD544. 696 0.0 1 ( AU052987 ) Dictyostelium discoideum slug... cDNA, clone SLF452. 680 0.0 1 ( AU039141 ) Dictyostelium discoideum slug... cDNA, clone SSM439. 680 0.0 1 ( AU038903 ) Dictyostelium discoideum slug cDNA, clone SSM121. 680... 0.0 1 ( AU034237 ) Dictyostelium discoideum slug cDNA, clone SLC307. 680 0.0 1 ( AU033908 ) Dictyostelium discoideum slug... cDNA, clone SLB601. 680 0.0 1 ( C94120 ) Dictyostelium discoideum slug cDNA, clone SSG432. 68

  5. Dicty_cDB: VHB238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tmvfkkvyhmxlcxlsifpkkhnf Frame C: pmhhnktfliyslinirtyk*rerctnssisrycfke*ysl*k*rkk*nfn*tmgin*tk c*krh*kysftrfrit...yqr*itkckisryssimlcirickekf *y*rtkrlyyesyy**frit--- ---astxketh*tirstnvgxfiqriqesinhhlrrgspchwchhlgfgc*frtll

  6. C-SiC Honeycomb for Advanced Flight Structures Project (United States)

    National Aeronautics and Space Administration — The proposed project is to manufacture a C-SiC honeycomb structure to use as a high temperature material in advanced aircraft, spacecraft and industrial...

  7. Dicty_cDB: VFI753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vqeyiisndfennynvtisriiniryke diik*f**hikaswkilkn*nhqklh*ykfikntf Frame C: fkffqs*k*lysvikwyhkakmm*kyn*myknisyqmilk...*lysvikwyhkakmm*kyn*myknisyqmilkiitm*qfqelltfdikk i**nsfnnt*klhgkf*kiktikncininslkih Homology vs CSM-cDNA Sc

  8. Dicty_cDB: VHA852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA852 (Link to dictyBase) - - - Contig-U11096-1 VHA852P (Link to Original ... in. 76 7e-37 8 EC286335 |EC286335.1 BRAINF089834J4 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... . 92 8e-36 4 EC364387 |EC364387.1 IMMUNEF093542N20 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... ce. 92 1e-35 4 EC289560 |EC289560.1 BRAINF089623B7 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ...

  9. Dicty_cDB: SFI877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ighclpnixkminhxxliwxxyhhqlxxkxkvhqvxrfiqtlxt Frame C: *wk*vyfik*DLHXTXYIHILIFSNEN...rir**ffikeis*im*f*rixnyx y*ikglyiwrixxs*ldivypiyxr**iixi*fgxxttinxxkrxrfiksxxlfkh*xr Homology vs CSM-cDNA Sc

  10. Dicty_cDB: SSF506 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kki Frame B: ---iiiiiiiiiiapiliktqanikk*sin*lilfi*ikkkh*ivnysknfkitnlrk* Frame C: ---*********slpf*skprris...ksdqsin*yclyeskknik**iivkilksli*en Homology vs CSM-cDNA Score E Sequences producing

  11. Dicty_cDB: VSF150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce *c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thfwl lcftrr*lhclwflqrwfr*nckpsrywwnfngiprqylisftt...QGKXLXVX Frame B: *c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thfwl lcftrr*lhclwflqrwfr*nckpsryww

  12. Dicty_cDB: VSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftrr*lhclwf...GXTXNPXEIGGTSXEXQXKXXLVLQQNGNXERLSXFXPDXGPNKKN Frame B: ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftr

  13. Demonstration of SiC Pressure Sensors at 750 C (United States)

    Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender


    We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

  14. Dicty_cDB: SSL136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BU873627.1 Q057F04 Populus flower cDNA library Populus balsamifera subsp. trichocarpa cDNA 5 prime, mRNA sequence...ulus balsamifera subsp. trichocarpa cDNA 5 prime, mRNA sequence. 60 4e-05 1 BU832...mmmkitkiim mmmmkvlmkkmmikin*i*k*nnkntinmniqkkkkknktfiiktnfyy*fifvi Frame C: ---*gwyfsnsneisk*fsnesaslnfpiril.... 60 4e-05 1 BU872705 |BU872705.1 Q045H12 Populus flower cDNA library Populus balsamifera subsp. trichocarpa cDNA 5 pri...592 |BU832592.1 T035H12 Populus apical shoot cDNA library Populus tremula x Populus tremuloides cDNA 5 prime, mRNA sequence

  15. Dicty_cDB: SFI706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42 0.036 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1...NA clone cTOF19D15 5' sequence, mRNA sequence. 38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Corn...lone cTOE14I10 5' sequence, mRNA sequence. 38 0.10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Corn...ell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic acid 4-hydroxyla...ell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38 0.10 2 AE003601 |

  16. Dicty_cDB: VFF382 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esc...root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clon...i cDNA clone cLPP8K18 5' sequence, mRNA sequence. 92 3e-15 2 BG642411 |BG642411.1 EST355887 tomato flower buds, anthesis, Cornell... flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequence. 92 2e... esculentum cDNA clone cTOE2D11 5' sequence, mRNA sequence. 92 2e-16 3 AW217896 |AW217896.1 EST296610 tomato

  17. Dicty_cDB: SLF813 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available discoideum chromosome 2 map 6163571... 468 e-137 2 ( C23695 ) Dictyostelium discoideum gamete cDNA, clone F...C-AK02. 468 e-137 2 ( AU284631 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 468 e-137 2 ( AU284449... ) Dictyostelium discoideum gamete cDNA clone:FC-AW0... 468 e-137 2 ( AU284368 ) ...Dictyostelium discoideum gamete cDNA clone:FC-AP1... 468 e-137 2 ( AU284518 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 468 e-137 2 ( AU284520 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 468 e-1

  18. Dicty_cDB: VSH364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ome 2 map 5515173... 254 2e-73 2 ( AU284312 ) Dictyostelium discoideum gamete cDNA clone:FC-AK1... 254 2e-73... 2 ( C23652 ) Dictyostelium discoideum gamete cDNA, clone FC-AG13. 254 2e-73 2 ( AU284996 ) Dictyostelium discoideum gamete... cDNA clone:FC-BS1... 254 2e-73 2 ( AU284930 ) Dictyostelium discoideum gamete... cDNA clone:FC-BQ0... 254 2e-73 2 ( AU284889 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1...... 254 2e-73 2 ( C92427 ) Dictyostelium discoideum slug cDNA, clone SSE533. 254 2e-73 2 ( AU284467 ) Dictyostelium discoideum gamete

  19. Dicty_cDB: CFC518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxdnkkxvetxrcvsithvlhy*lnn Translated Amino Acid sequ...ence (All Frames) Frame A: ---ervkfknt*istmvxvfnxsp*slitslxlsqn*dlvvslssxfqkhtihhsxrnyn xlh*klkxxwtl*rnytf*x...YTSLRXKLQX SSLEIKEXLDTLEKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxd

  20. Dicty_cDB: AFB770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c fhrfrw*ryqsyv*s*twysfwxc*tiipsiscxftcxlsfxls Translated Amino Acid sequence (All Frames) Frame A: ttlqkdnn...grpfefkdrclwlss*s*kirsl*yhqic fhrfrw*ryqsyv*s*twysfwxc*tiipsiscxftcxlsfxls Frame C: nttkrq*LLIRMVLQFVDDSSCKX

  1. Dicty_cDB: SFH756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PVSDNQ CQCSVGFSGDDCRQCDNGMVLWASDNGIPMCSPLNSLGKPKTCYAAY Frame B: ---xxxxxxxxxxxxxxxxxxkxxxxx*xxivnwhxxqvlvgsl...vhh*ihwvnqkpvmll Frame C: ---xxxxxxxxkxxxxxxxaxxxxxxxsxx*xigxxxkc*wvrfxk*lyvlxv*w

  2. Dicty_cDB: CHA864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ---XXXXXXXXXXXXXXXXXXXXXXMXXXIEXXXAAXESXXHGSXXFXYIMRDGXLERXX Frame B: ---xxxxxxxxxxxlxxxxxxxxxxcxvx*rxxx...qqxspxxmdxpfsxil*emvnwkexx Frame C: ---xxxxxxxxxvxxxxxxxxxxxxaxxyre

  3. Dicty_cDB: CFH318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: ---VXQXXLXXGIFXSXXVXKPGIFXIXXXGTGAXPGACWKLKKXAKXKXXXX Frame B: ---xxxxxxxxgfsfpxxxknpgflxlxxx...glgpxxghvgn*kxxxkxxsix Frame C: ---xxxxxxxxdfxfxxsxktrdf*xxlxxdwgpsxgmleiekxxxx

  4. Dicty_cDB: CHA554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIQILNSYFIFLYIVTFHKKKKKKKNLKXXXFXKKK--- ---xxxxxxxxxxxxxxxxxxxxvxxxmsxxxxxcxg*xwxxlcxxxxrxixr*fixrxi rwssr F...GXS GGHP Frame C: ihfyytnikfifyfsiycnis*kkkkkkkfkxxxfxkkk--- ---xxxxxxxxxxxsxxxxxxscxxxyvxlxxxvxrivmxxx

  5. Dicty_cDB: CFJ554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: ---LFPHCSENXLXXXQREXTTXPXRNXPRXGHXSALXXXXRXXXXRPSCTN Frame B: ---sfltvpktxxxxprexxqhxpxexnqdxdtxahxxxxxxxxxx...ghlvq Frame C: ---lsslfrkxaxxxperxxntpx*kxtkxwtlxrtxxxxsxxxxxailyk Hom

  6. Dicty_cDB: CHG233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 66 2e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...pighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, ...mRNA sequence. 90 9e-14 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  7. Dicty_cDB: VSG402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M058328 |BM058328.1 2189-54 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA...d cDNA library Ctenocephalides felis cDNA clone 2163-12, mRNA sequence. 42 3.7 1 ... clone 2189-54, mRNA sequence. 42 3.7 1 BM057177 |BM057177.1 2163-12 hindgut and Malpighian tubule subtracte

  8. Dicty_cDB: SHG302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ;, mRNA sequence. 66 3e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...ighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, m...RNA sequence. 82 3e-11 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  9. Dicty_cDB: VSD850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available exiguus. 42 0.13 2 BF779702 |BF779702.1 3232-81 hindgut and Malpighian tubule cDNA library Ctenocephalides ...e cDNA library Ctenocephalides felis cDNA clone 2243-04, mRNA sequence. 40 0.26 2...felis cDNA clone 3232-81, mRNA sequence. 40 0.24 2 BM059302 |BM059302.1 2243-04 hindgut and Malpighian tubul

  10. Dicty_cDB: SHA868 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 66 3e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...bule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA seque...nce. 90 1e-13 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  11. Dicty_cDB: SSD274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one QHM6D05, mRNA sequence. 58 1e-04 1 CB084130 |CB084130.1 hq10c11.b1 Hedyotis centranthoides flower - Stage 2 (NYBG) Hedyotis... centranthoides cDNA clone hq10c11, mRNA sequence. 50 0.026 1 CB084528 |CB084528.1 hq16g12.b1 Hedyotis... centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA

  12. Dicty_cDB: SSJ373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 58 7e-05 1 CB084130 |CB084130.1 hq10c11.b1 Hedyotis centranthoides flower - Stage 2 (NYBG) Hedyotis ...centranthoides cDNA clone hq10c11, mRNA sequence. 50 0.016 1 CB084528 |CB084528.1 hq16g12.b1 Hedyotis centra...nthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hq16g12, mRNA

  13. Dicty_cDB: SHD121 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42 5.7 2 BF299070 |BF299070.1 065PbF11 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA ..., and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequence. 42 8.2 1 BF295814 |BF295814.1 028PbF06 Pb cD

  14. Myostatin Stimulates, Not Inihibits, C2C12 Myoblast Proliferation


    Rodgers, Buel D.; Wiedeback, Benjamin D.; Hoversten, Knut E.; Jackson, Melissa F; Walker, Ryan G.; Thompson, Thomas B.


    The immortal C2C12 cell line originates from dystrophic mouse thigh muscle and has been used to study the endocrine control of muscle cell growth, development, and function, including those actions regulated by myostatin. Previous studies suggest that high concentrations of recombinant myostatin generated in bacteria inhibit C2C12 proliferation and differentiation. Recombinant myostatin generated in eukaryotic systems similarly inhibits the proliferation of primary myosatellite cells, but con...

  15. Dicty_cDB: SHA333 [Dicty_cDB

    Lifescience Database Archive (English)


  16. Dicty_cDB: VFA149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence lpiyxlniggishrfqixdktstsytlqfhgskipvtvlspeedllcqympvkktvdssn slispmpgtilslav...VEAMKMQNVLRAPKDC*iksinvkpvk sflx*vxxf Frame C: lpiyxlniggishrfqixdktstsytlqfhgskipvtvlspeed

  17. Dicty_cDB: CHR344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 576.1 NF031C11ST1F1000 Developing stem Medicago truncatula cDNA clone NF031C11ST 5', mRNA sequence. 42 4.0 1... GR__Ea21F12.f GR__Ea Gossypium raimondii cDNA clone GR__Ea21F12 5', mRNA sequence. 42 4.0 1 AW690576 |AW690

  18. Dicty_cDB: SHA139 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- ---IDSKLFNSLRENYKNNITFLPTLERIKKXXSYQLMKTISEX*kttfxiliii Frame C: *iqnclilcvki...tkti*lfyqhlkdqkmisyqlmkqfqklknsfkiliiisni*yliypl kkk--- ---*iqnclilcvkitkti*lfyqhlkeskkxxhin**kqfqkxkklllxf*

  19. Dicty_cDB: SHH224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHH224 (Link to dictyBase) - - - Contig-U11458-1 SHH224P (Link to Original ... 2 Plasmodium falciparum 3D7 cDNA clone from Sugano malaria ... cDNA library: XPFn6930. 48 0.48 1 AU088296 |AU0882 ... 1 Plasmodium falciparum 3D7 cDNA clone from Sugano malaria ... cDNA library: XPFn6884. 48 0.48 1 AU087831 |AU0878 ...

  20. Dicty_cDB: SHA609 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IVDFGLCVDANERKLVHMAGSPFWMSPEMIRGESYGCPTDIWSFAICLLELANGEPPHR KSSLPXYVHXCN*gxcrxgqt*kmdrtlysflkslfrngsfkeincrt...CPTDIWSFAICLLELANGEPPHR KSSLPXYVHXCN*gxcrxgqt*kmdrtlysflkslfrngsfkeincrttfktslx*fi*k Frame C: ykfisishivfis*

  1. Dicty_cDB: VSG886 [Dicty_cDB

    Lifescience Database Archive (English)


  2. Dicty_cDB: VSC875 [Dicty_cDB

    Lifescience Database Archive (English)


  3. Dicty_cDB: VSE856 [Dicty_cDB

    Lifescience Database Archive (English)


  4. Dicty_cDB: VHE125 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE125 (Link to dictyBase) - - - Contig-U10968-1 VHE125P (Link to Original ... . 52 0.036 1 EG629938 |EG629938.1 EMBRYOF088217M13 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ... s. 34 0.32 2 EC319940 |EC319940.1 EMBRYOF088886F18 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  5. Dicty_cDB: VSJ379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FDKKSYTGYIKAYMKEVLAKLADNNPSRVDAFKKD AADFVKSVLGKFDEYKFYTGENMDADGHVALMY--- ---tekvite*efskillvihmmnyaqmptq*lks...ltitq avltpskrmplilsnqfsvnstntnstlvkiwmlmvmsl*cttnqvkliqsfytsktv*n qlnikiifskcynk Frame C: e*efskillvihmmnya

  6. Dicty_cDB: SSJ391 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**nr...** lk Frame C: ---gxgi*gcvdiqvrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**

  7. Dicty_cDB: SFD878 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ftinefnsmwwwlwk writrwswwsrwwsscwywcncwfcftrsrfhfnwrfkqlwl*lklknykyilnklkink v*lf...vnvkkk--- ---ytkqnknktkqnk*ndnlrfnlfnw*c*infkik*fiiiikfiifftinefnsmwww lwkwritrwswwsrwwsscwywcncwfcftrsrfhfn

  8. Dicty_cDB: CFF880 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2191 |BQ512191.1 EST619606 Generation of a set of potato cDNA clones for microarray analyses mixed potato ti... |BQ512190.1 EST619605 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissue...8865.1 EST556401 potato roots Solanum tuberosum cDNA clone cPRO2F7 5' end,mRNA sequence. 52 9e-14 4 BQ512190

  9. Dicty_cDB: VSB133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 12191 |BQ512191.1 EST619606 Generation of a set of potato cDNA clones for microarray analyses mixed potato t...0 |BQ512190.1 EST619605 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissu...8865.1 EST556401 potato roots Solanum tuberosum cDNA clone cPRO2F7 5' end, mRNA sequence. 52 2e-14 4 BQ51219

  10. Dicty_cDB: SSC489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---LLDPQDPIFGKIHPXGTFQGTLRKXYMFMNRISELLDX*nqqdvpnsnhskxkkpny lkkvf*yktklfxpnwfylqvklkkfplhklniifmf...rame C: ---LLDPQDPIFGKIHPXGTFQGTLRKXYMFMNRISELLDX*nqqdvpnsnhskxkkpny lkkvf*yktklfxpnwfylqvklkkfplhklniifmfiy

  11. Dicty_cDB: CFG834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one BACR23H21, complete sequence. 42 0.038 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycope...38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 si....10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, m

  12. Dicty_cDB: AFF758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC Library) complete sequence. 42 0.070 5 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersi... 0.074 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 sim... EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1,

  13. Dicty_cDB: CHD312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mplete sequence. 42 0.056 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum...6 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic...I773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38

  14. Dicty_cDB: AFL147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ' sequence, mRNA sequence. 42 0.16 2 BE471638 |BE471638.1 EST416491 potato stolon, Cornell University Solanu...ST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA sequence. 42 0.17 2 ...m tuberosum cDNA clone cSTA29J22, mRNA sequence. 42 0.16 2 BE343505 |BE343505.1 E

  15. Dicty_cDB: AFK872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ACR23H21, complete sequence. 42 0.051 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersico...12 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar... AI773934 |AI773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA s

  16. Dicty_cDB: VFI438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available S12 Capsicum annuum cDNA, mRNA sequence. 54 0.004 1 BF187220 |BF187220.1 EST443507 potato stolon, Cornell Un...uds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone 54 0.004 1 BE473010 |BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone

  17. Dicty_cDB: CHA214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2D11 5' sequence, mRNA sequence. 92 6e-16 3 AW217896 |AW217896.1 EST296610 tomato flower buds, anthesis, Cornell...-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES3N17...root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA sequence. 9

  18. Dicty_cDB: AHB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5...i aconitase mRNA, partial cds. 58 6e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...1 EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10

  19. Dicty_cDB: VSA196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YKLTTMEGEQLQTAPYNPRFPQQNQTKHCWANYVDYYGCVKHYNGDNSKCQTFFNSM NSLCPAAWISEWDEQKAADLFPSDRV*iyninn***yq*fiqkkrkkkkn...imi* Frame C: t*hin*qqwkennyklhhttqdshnktklnivglttlitmvvsnitmvttqnvklfstq* thyvql

  20. Dicty_cDB: CHE410 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QXKXWLVLXXIXNIQKXINXPFGPQIKXVVCKFFVKNINW *gpslxklrgxdnienvkxkiqdkegippdqqrlifxgkqledgrtlxdyniqkestlhl vlrlrggmqifvktltgktitle...vegsdnienvkakiqdkegippdqqrlifagkqledg rtlsdyniqkestlhlvlrlrggmqifvktltgktitle...iqdkegippdqqrlifxgkqledgrtlxdyniqkestlhl vlrlrggmqifvktltgktitlevegsdnienvkakiqdkegippdqqrlifagkqledg rtlsdy...niqkestlhlvlrlrggmqifvktltgktitlevegsdnienvxtkiqdkeg Frame C: ywxnsfllyky*ihilffy

  1. Dicty_cDB: VFF404 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available own leaf cDNA Stevia rebaudiana cDNA 5', mRNA sequence. 48 0.037 1 CB078353 |CB078353.1 hj66e12.g1 Hedyoti...s terminalis flower - Stage 2 (NYBG) Hedyotis terminalis cDNA clone hj66e12, mRNA s

  2. Dicty_cDB: VSI691 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pulus leaf cDNA library Populus tremula x Populus tremuloides cDNA, mRNA sequence. 64 7e-16 2 CB083063 |CB083063.1 hn65h03.g1 Hedyoti...s centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hn65h03

  3. Dicty_cDB: CHA579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2918 Q42918 ACETYL-COA C-ACYLTRANSFERASE ;, mRNA sequence. 52 0.006 1 CB086716 |CB086716.1 hj89c06.g1 Hedyotis... centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj89

  4. Dicty_cDB: VFE365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s chromosome 3 clone RP11-551L4 map 3p, complete sequence. 32 0.12 6 CB077397 |CB077397.1 hj53c04.g1 Hedyotis... terminalis flower - Stage 2 (NYBG) Hedyotis terminalis cDNA clone hj53c04, mRNA

  5. Dicty_cDB: VFF768 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available flower cDNA library Populus balsamifera subsp. trichocarpa cDNA, mRNA sequence. 66 2e-18 2 CB086276 |CB086276.1 hj82c12.g1 Hedyotis... centranthoides flower - Stage 2 (NYBG) Hedyotis centranth

  6. Dicty_cDB: VSJ556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lus tremula x Populus tremuloides cDNA, mRNA sequence. 64 7e-16 2 CB083063 |CB083063.1 hn65h03.g1 Hedyotis c...entranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hn65h03, mRNA sequence. 76 3e-15 2

  7. Dicty_cDB: CHA846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 52 0.005 1 AJ504889 |AJ504889.1 Pyrus communis EST, clone L696. 52 0.005 1 CB086716 |CB086716.1 hj89c06.g1 Hedyotis... centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj89c06, mRNA s

  8. Dicty_cDB: CFG804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nome. 68 2e-14 3 BU041060 |BU041060.1 PP_LEa0008C18f Peach developing fruit mesocarp Prunus persica cDNA clo...iheyensis genomic DNA, section 11/13. 50 2e-05 10 BU040467 |BU040467.1 PP_LEa0006C14f Peach developing fruit

  9. Dicty_cDB: CFC796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 58 9e-07 2 CF806266 |CF806266.1 psHB007xC07f USDA-IFAFS:Expression of Phytophthora sojae genes during infection and propaga...tion Phytophthora sojae cDNA clone sHB007C07 5, mRNA seq

  10. Dicty_cDB: AFH216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BM260251.1 baa17f06.x1 Cassava EYC library1 Manihot esculenta cDNA 3' similar to...SC cDNA library Populus alba x Populus glandulosa cDNA clone PopSC00059, mRNA sequence. 46 1e-06 2 BM260251

  11. Dicty_cDB: VFD860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon...9099.1 EST414391 tomato developing/immature green fruit Lycopersicon esculentum c... Cornell University Lycopersicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.038 1 BE459099 |BE45

  12. Dicty_cDB: SHB481 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5_075 Brachypodium distachyon developing spike EST library Brachypodium distachyon cDNA clone 5484_C09_E18, ...257_H11_P21, mRNA sequence. 42 7.6 1 DV474787 |DV474787.1 5484_C09_E18ZE5_075 Brachypodium distachyon developing

  13. Dicty_cDB: SHJ738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9.1 PL05017A1F05 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 3', mRNA sequence. 34 1....7 2 DN301936 |DN301936.1 PL04024A1H02 cDNA from sexually mature hermaphodites Sc

  14. Dicty_cDB: SHF685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 994.1 PL05007A2E05 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 3', mRNA sequence. 52... 0.011 1 DN295438 |DN295438.1 PL03019B2F09 cDNA from sexually mature hermaphodite

  15. Dicty_cDB: SHD287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 17 1 DN307050 |DN307050.1 PL05012B2H02 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 3...', mRNA sequence. 48 0.069 1 DN299510 |DN299510.1 PL04016A2B03 cDNA from sexually mature hermaphodites Schmi

  16. Dicty_cDB: SHJ718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 44 0.89 1 DN307545 |DN307545.1 PL05014A2B03 cDNA from sexually mature hermaphodites Schmidtea medite...rranea cDNA 3', mRNA sequence. 44 0.89 1 DN300133 |DN300133.1 PL04018A2E08 cDNA from sexually

  17. Dicty_cDB: SFB745 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ypanosoma cruzi strain Colombian... 563 e-159 FJ807243_1( FJ807243 |pid:none) Peranema trichophorum strain C...rypanosoma cruzi strain Dm 28 c c... 563 e-159 AY785657_1( AY785657 |pid:none) Tr

  18. Dicty_cDB: VSI818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 21N12 in linkage group 20. 42 2.6 1 BQ198350 |BQ198350.1 NXLV127_F04_F NXLV (Nsf Xylem Late wood Vertical) P... NXLV112_C05_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV112_C05 5', mRNA sequence. 42

  19. Dicty_cDB: AFE557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 46 0.018 2 BM158718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Vertical...5_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV_039_C05 5', mRNA sequence. 46 0.019 2 AW

  20. Dicty_cDB: SHL750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL750 (Link to dictyBase) - - - Contig-U16471-1 SHL750P (Link to Original ... nce. 34 0.33 7 EG609925 |EG609925.1 BRAINF100765M9 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ...

  1. Dicty_cDB: CHE273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sgvnssi*vesfcl kikhsnfseillillsxqrnccwftkt*willsfx*xnfx*t Frame C: hlmhrlhqhhqrxfe*khivklf*mhellhhlsfysli...dariasppfillin*sikvpfcgissssspwccccc c*teidg*vdcggfceieiedfevgvigetpdfgailieepeadgtd...ffxixqfplnx Frame B: afnasiaptppapf*vktycealldariasppfillin*sikvpfcgissssspwccccc c*teidg*vdcggfceieiedfevgvigetpdfgaili...f ehflfpfeliqlyv*ihf*ilkhvgrilqvmkf*hlhhrivrln*--- ---xrkxhhvvxhh**nypmixqsxefdgmnyyfwfplnllimr*ylvlil... Frames) Frame A: si*cidctnttsaxlsenil*sssrctncfttfhfth*lihkstilwyiiivvamvllll llnrn*wls*lwwfl

  2. Dicty_cDB: VHE717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d21, 5' end. 70 3e-13 3 EV830481 |EV830481.1 TTSB084TH Tetrahymena thermophila SB210 cDNA library (Heavy metals...trahymena thermophila SB210 cDNA library (Heavy metals) Tetrahymena thermophila c

  3. Dicty_cDB: VSD136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c

  4. Dicty_cDB: SFJ540 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato pollen Lycopersicon pennellii cDNA clonecLPP11A1 5' sequence, mRNA sequence. 66 8e-10 2 CF811515 |CF811515.1 NA716 cDNA non accli...mated Bluecrop library Vaccinium corymbosum cDNA 5', mRNA sequence. 68 2e-08 2 AF35

  5. Dicty_cDB: SHE451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu

  6. Dicty_cDB: CHA810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available **, 2 unordered pieces. 34 0.12 5 CD036316 |CD036316.1 mgmt015xC16f.b Mated Magnaporthe grisea cDNA clone mgmt015xC16 5', mRNA sequence. 48 0.16 1 AC015216 |AC015216.1 Drosophila me

  7. Dicty_cDB: VFF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Solanum tuberosum cDNA clone cPRO2F7 5' end, mRNA sequence. 46 0.001 2 BQ512190 |BQ512190.1 EST619605 Generation... Solanum tuberosum cDNA clone STMHW74 5' end, mRNA sequence. 46 0.001 2 BQ512191 |BQ512191.1 EST619606 Generation

  8. Dicty_cDB: VSD594 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 624-220200-032-B08 BT0624 Homo sapiens cDNA, mRNA sequence. 40 2.6 1 BG731932 |BG731932.1 ps07c01.y4 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' similar to contains

  9. Dicty_cDB: SLJ667 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ulus cDNA clone IMAGE:4945728 5', mRNA sequence. 32 1.7 3 BG520163 |BG520163.1 ps37c04.y1 Trichinella spiralis ML CMVsport jasmer Tri...chinella spiralis cDNA 5' similar to contains element TA

  10. Dicty_cDB: SSK654 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AW928683.1 EST337471 tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEC36D22, mRNA sequence. 54 0.002 1 BE473010 |BE473010.1 EST417863 potato stolon, Cornell Uni

  11. Dicty_cDB: VSE232 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library, clone Tse45c12_p1c. 50 0.016 1 AI772551 |AI772551.1 EST253651 tomato resistant, Cornell...RNA sequence. 50 0.016 1 AI774601 |AI774601.1 EST255701 tomato resistant, Cornell Lycopersicon esculentum cD

  12. Dicty_cDB: SFJ301 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone ... |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA sequenc

  13. Dicty_cDB: VFD589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', m...RNA sequence. 68 1e-12 2 BF299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowel

  14. Dicty_cDB: AFB336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA se...quence. 68 3e-13 2 BF299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowell and

  15. Dicty_cDB: VFF578 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available berghei genomic 3', DNA sequence. 68 1e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and ...9139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA sequence. 68 1

  16. Dicty_cDB: CFH434 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and Jane Carlt...on Plasmodium berghei cDNA 5', mRNA sequence. 68 3e-12 2 BF299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles

  17. Dicty_cDB: AFG366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m berghei genomic 3', DNA sequence. 68 2e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and...99139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA sequence. 68

  18. Dicty_cDB: AFF451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Plasmodium berghei genomic 3', DNA sequence. 68 3e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles...299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA se

  19. Dicty_cDB: CHS321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS321 (Link to dictyBase) - - - Contig-U11810-1 - (Link to Original site) ... vesca heat stressed seedlings cDNA library in pCMV-SPORT ... 6.1 Fragaria vesca cDNA clone V01006C10 5, mRNA se ...

  20. The Necessary Maximality Principle for c.c.c. forcing is equiconsistent with a weakly compact cardinal


    Hamkins, Joel David; Woodin, W. Hugh


    The Necessary Maximality Principle for c.c.c. forcing asserts that any statement about a real in a c.c.c. extension that could become true in a further c.c.c. extension and remain true in all subsequent c.c.c. extensions, is already true in the minimal extension containing the real. We show that this principle is equiconsistent with the existence of a weakly compact cardinal.

  1. Chronic Hepatitis C. (United States)

    Tran, Tram T.; Martin, Paul


    Infection with hepatitis C virus (HCV) accounts for 40% of cases of chronic liver disease in the United States and is now the most common indication for liver transplantation. Estimates suggest that 4 million people (1.8%) of the American population are or have been infected with HCV. Currently, the treatment of choice for patients with chronic HCV infection is recombinant interferon alfa with ribavirin. Pegylated interferons are a promising new development, and in combination with ribavirin, they will rapidly become the standard of care. The goals of therapy are to slow disease progression, improve hepatic histology, reduce infectivity, and reduce the risk of hepatocellular carcinoma. Sustained virologic response, which generally implies the absence of viremia for 6 months or more following completion of therapy, is increasingly being regarded as a cure, with evidence of slowing or even regression of fibrosis on follow-up liver biopsy. A number of factors have been shown to be predictive of a sustained response, including viral genotype other than 1, low serum HCV RNA levels, absence of cirrhosis, younger age, female gender, and shorter duration of infection. Disease severity as assessed by liver biopsy, comorbidities, and possible contraindications to therapy should be weighed in the decision to begin treatment. Counseling patients regarding transmission, natural history, and drug and alcohol abstinence also should be included in management. Close monitoring should be done during treatment for side effects of interferon, including depression and bone marrow suppression. Hemolytic anemia is the major side effect of ribavirin. PMID:11696276

  2. A Novel Method for Preparation of TaC Coating on C/C Composite Material

    Institute of Scientific and Technical Information of China (English)

    Hanwei HE; Kechao ZHOU; Xiang XIONG


    A new method for preparation of TaC coating on C/C composite material is reported. The amorphous ethylate tantalum jellied as the precursor is prepared and spread densely on the surface of the C/C composite material so as to form a multilayer film. In a graphitization furnace the multilayer film is transformed into TaC coating at various temperatures. Ethylate tantalum film is characterized by FT-IR (Fourier transform infrared) spectra, XRD (X-ray diffraction) and SEM (scanning electron microscopy) and TaC coating is characterized by XRD and SEM. At 1200℃the coating contained TaC and Ta2O5, and at above 1400℃ only TaC is formed. The coating formed at 1600℃ is a continuous stratum structure, and that formed at 1600℃ is a porous net structure. Analysis on thermodynamics and formation mechanism of TaC indicates that, after ethylate tantalum is decomposed, Ta2O5 is first produced and then transformed into Ta2C, and newly formed Ta2C is transformed into TaC by the sufficient C at last.

  3. Dicty_cDB: SHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides feli...9 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDN...2018A03 5', mRNA sequence. 88 6e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 1e-13 1 BM058379 |BM058379.1 2191-2

  4. Dicty_cDB: CHQ652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA sequence. 90 ...1e-13 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides f...d cDNA library Ctenocephalides felis cDNA clone 2154-85, mRNA sequence. 92 3e-14 1 DR447725 |DR447725.1 AR10.... 66 4e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracte

  5. Dicty_cDB: VHM627 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l=UPF0681 protein KIAA1033; 126 6e-41 AK145000_1( AK145000 |pid:none) Mus musculus mammary gland RCB-052... ...rcplt*n nsrvvpiwiqsfiifqiiyqrvlntlrcw*tfsxqsfeislinx*rixissylpwpqits ii*sivkinslrnqkqsvlklyyslmmal...qlvwlis*ny*ikikisilfigsivfn*nvk xikrec Frame C: ---iildf*slilvmlwvildwsdpvvytivvmlsefvpdlkkipkfqdltskdals...ue N BU746157 |BU746157.1 CH3#002_C07T7 Canine heart normalized cDNA Library in pBluescriptCanis familiaris... cDNA clone CH3#002_C07 5', mRNA sequence. 38 0.005 2 BY464171 |BY464171.1 Mus musculus 15 days pregnant adult female am

  6. Dicty_cDB: SLD655 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *lmysdsidq*fgnmqd*i*liqfyqkerlll*fkikl*mvgmiqd*vh*mhsvek vihqkqliyyviqlv*hvlmvqpfhmny*--- Frame B: l*lvn*ctrtl*tsslgic...uences producing significant alignments: (bits) Value N ( AU061273 ) Dictyostelium discoideum slug cDNA, SLD655. 531 e-147 1 ( BJ350334 ) Dictyostelium discoideum cDNA clone:dda39b18, 3' ... 248 1e-64 2 ( BJ441216 ) Dict...yostelium discoideum cDNA clone:ddv46d04, 3' ... 252 6e-63 1 ( BJ436851 ) Dictyostelium discoideum... cDNA clone:ddv32n08, 3' ... 252 6e-63 1 ( BJ354544 ) Dictyostelium discoideum cD

  7. Dicty_cDB: SFC512 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10...RNA sequence. 74 5e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lyco...ato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 similar to calreticulin, putative...c, DNA sequence. 72 5e-15 3 BI921109 |BI921109.1 EST541012 tomato callus Lycopersico... 5', mRNA sequence. 74 5e-09 1 AW932476 |AW932476.1 EST358319 tomato fruit mature green, TAMU Lycopersico

  8. Dicty_cDB: SLK291 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d, mRNA sequence. 44 1.2 1 BM412569 |BM412569.1 EST586896 tomato breaker fruit Lycopersicon esculentum cDNA ...clone cLEG60B3 5' end, mRNA sequence. 44 1.2 1 BF112934 |BF112934.1 EST440617 tomato breaker fruit Lycopersico...DLKAQKLKSSKSKX*ikkxxxpk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Valu...ato breaker fruit Lycopersicon esculentum cDNA clone cLEG57G15 5' E Sequences producing significant alignments: (bits) Value N L49527 |L49527.1 Dictyostelium discoideum co

  9. Dicty_cDB: VSH568 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lqlnvvlalkppih*nqlllttihttrvvsnaqlaillsmsklsnhskvn sivqsthqkfqlpllliqlp*rmpsmhqrkllkv*vmptev*mknqtlvltqwpllm...) m... 886 0.0 1 ( AU269617 ) Dictyostelium discoideum vegetative cDNA clone:VS... 886 0.0 1 ( AU269523 ) Di...ctyostelium discoideum vegetative cDNA clone:VS... 886 0.0 1 ( AU269062 ) Dictyostelium discoideum vegeta...tive cDNA clone:VS... 886 0.0 1 ( AU267651 ) Dictyostelium discoideum vegetative cDN...A clone:VS... 886 0.0 1 ( AU267642 ) Dictyostelium discoideum vegetative cDNA clone:VS... 886 0.0 1 ( AU2669

  10. Dicty_cDB: SHH289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s: (bits) Value N DN294228 |DN294228.1 PL030016A20H07 cDNA from sexually mature hermaphodites Schmidtea medi...terranea cDNA 5', mRNA sequence. 68 3e-13 2 DN295122 |DN295122.1 PL03019A1B06 cDNA from sexually...3 2 DN295182 |DN295182.1 PL03019A1H01 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 5'

  11. Dicty_cDB: SHK287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _ON40P21 3', mRNA sequence. 46 0.82 1 DN301510 |DN301510.1 PL04022B2C12 cDNA from sexually mature hermaphodi... PL04007B1D10 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 5', mRNA sequence. 46 0.82...tes Schmidtea mediterranea cDNA 5', mRNA sequence. 46 0.82 1 DN296890 |DN296890.1

  12. Dicty_cDB: SHD524 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scoideum ABC transporter AbcH.3 (abcH.3) gene, complete cds. 38 1e-04 5 DN305866 |DN305866.1 PL05009B2B05 cDNA from sexually...97327.1 PL04009A1C05 cDNA from sexually mature hermaphodites Schmidtea mediterran...ea cDNA 5', mRNA sequence. 48 0.25 1 DN296025 |DN296025.1 PL04003X1G07 cDNA from sexually mature hermaphodit

  13. Dicty_cDB: SLC278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s DNA Score E Sequences producing significant alignments: (bits) Value N ( AU052905 ) Dictyostelium discoideum slug... cDNA, clone SLF296. 597 e-166 1 ( AU039792 ) Dictyostelium discoideum slug... cDNA, clone SLG435. 597 e-166 1 ( AU039401 ) Dictyostelium discoideum slug cDNA, clone SLH719. 597 e-166 1... ( AU038129 ) Dictyostelium discoideum slug cDNA, clone SSH309. 597 e-166 1 ( AU037068 ) Dictyostelium discoideum slug... cDNA, clone SSB272. 597 e-166 1 ( AU034766 ) Dictyostelium discoideum slug

  14. Dicty_cDB: SLC680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU034321 ) Dictyostelium discoideum slug... cDNA, clone SLC680. 728 0.0 1 ( AU052905 ) Dictyostelium discoideum slug... cDNA, clone SLF296. 720 0.0 1 ( AU039792 ) Dictyostelium discoideum slug cDNA, clone SLG435. 720... 0.0 1 ( AU039401 ) Dictyostelium discoideum slug cDNA, clone SLH719. 720 0.0 1 ( AU038129 ) Dictyostelium discoideum slug... cDNA, clone SSH309. 720 0.0 1 ( AU037068 ) Dictyostelium discoideum slug

  15. Dicty_cDB: SHF845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF845 (Link to dictyBase) - - - Contig-U11241-1 - (Link to Original site) ... its) Value N DY614703 |DY614703.1 IMMUNEF045805H24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... e. 40 0.68 2 DY596878 |DY596878.1 KIDNEYF074988H10 POSSUM _01-POSSUM -KIDNEY-2KB Trichosurus vulpecula cDNA cl ... ence. 40 0.76 2 DY593007 |DY593007.1 GUTF031289C19 POSSUM _01-POSSUM -GUT-2KB Trichosurus vulpecula cDNA clone ...

  16. Dicty_cDB: CHF611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF611 (Link to dictyBase) - - - Contig-U15926-1 - (Link to Original site) ... 707422 |CX707422.1 gmrtDrNS01_24-C_M13R_B07_061.s1 Water ... stressed 5h segment 1 gmrtDrNS01 Glycine max cDNA ... 707618 |CX707618.1 gmrtDrNS01_26-C_M13R_C09_075.s1 Water ... stressed 5h segment 1 gmrtDrNS01 Glycine max cDNA ...

  17. Dicty_cDB: CHM549 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHM549 (Link to dictyBase) - G01696 DDB0233431 Contig-U15926-1 CHM549P (Lin ... 707422 |CX707422.1 gmrtDrNS01_24-C_M13R_B07_061.s1 Water ... stressed 5h segment 1 gmrtDrNS01 Glycine max cDNA ... 707618 |CX707618.1 gmrtDrNS01_26-C_M13R_C09_075.s1 Water ... stressed 5h segment 1 gmrtDrNS01 Glycine max cDNA ...

  18. Dicty_cDB: VSF189 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kwywclgwiwymlsnffrflymyf**tirim*tiqkrlfrmsp*c*ri*esiirklp*rw *gkn*qs*rsn*kssri*skkrki*insifflivi...e B: kwywclgwiwymlsnffrflymyf**tirim*tiqkrlfrmsp*c*ri*esiirklp*rw *gkn*qs*rsn*kssri*skkrki*insifflivinnnn**l...iiiiiii*FSDNTIKHKQ QKK--- ---kwywclgwiwymlsnffrflymyf**tirim*tiqkrlfrmsp*c*ri*esiirklp *rw*gkn*qs*rsnxks Fra... Value EF084615_1( EF084615 |pid:none) Picea sitchensis clone WS02714_K03... 50 5e-05 AK121358_1( AK121358 |...C299 chromosome... 48 2e-04 EF144605_1( EF144605 |pid:none) Populus trichocarpa c

  19. Dicty_cDB: SHA718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00020 |CP000020.1 Vibrio fischeri ES114 chromosome I, complete sequence. 46 0.69 1 BG521055 |BG521055.1 ps05c09.y3 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' simil...50920.1 Ciona intestinalis cDNA, clone:cicl05g22, 5' end, single read. 42 0.81 2 BG519938 |BG519938.1 ps05c09.y2 Trichinella... spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' similar

  20. Dicty_cDB: VFC303 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 48 1e-04 2 BF187729 |BF187729.1 EST444016 potato stolon, Cornell University Solanum tuberosum cDNA clone cS...TA42I13 5' sequence, mRNA sequence. 56 0.001 1 AW907097 |AW907097.1 EST343129 potato stolon, Cornell...0 |AW906350.1 EST342472 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA3C3, mRNA sequenc...5' sequence, mRNA sequence. 56 0.001 1 AW906668 |AW906668.1 EST342790 potato stolon, Cornell University Sola

  1. Dicty_cDB: CHH556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tum cDNA clone cTOB22E7 5' end, mRNA sequence. 58 2e-15 3 AW622039 |AW622039.1 EST312837 tomato root during/after fruit set, Cornell...equence. 58 2e-15 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell Lyco...t during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5', mRNA sequence.

  2. Dicty_cDB: VHG139 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ctyostelium discoideum cDNA clone:ddv43m09, 3' ... 196 1e-46 1 ( AU285046 ) Dictyostelium discoideum gamete ...cDNA clone:FCL-AC... 188 3e-44 1 ( AU284456 ) Dictyostelium discoideum gamete cDNA clone:FC-AW2... 188 3e-44... 1 ( AU284442 ) Dictyostelium discoideum gamete cDNA clone:FC-AV2... 188 3e-44 1 ...( AU284361 ) Dictyostelium discoideum gamete cDNA clone:FC-AO2... 188 3e-44 1 ( AU284355 ) Dictyostelium discoideum gamete

  3. CoC Dashboard Reports (United States)

    Department of Housing and Urban Development — Continuum of Care (CoC) Homeless Assistance Programs Dashboard Reports are available for each CoC and include information on each CoC’s awards by award amount,...

  4. Preventing hepatitis B or C (United States)

    ... ency/patientinstructions/000401.htm Preventing hepatitis B or C To use the sharing features on this page, please enable JavaScript. Hepatitis B and hepatitis C infections cause irritation and swelling of the liver. ...

  5. C-section - series (image) (United States)

    ... anesthesia, which renders the patient unconscious, for emergency C-sections because it can be administered quickly and takes effect almost immediately. When the C-section is planned, the doctor may order regional ...

  6. Hepatitis C Virus Genotypes

    Directory of Open Access Journals (Sweden)

    Kayhan Azadmanesh


    Full Text Available IntroductionHepatitis C virus (HCV is an important cause of chronic liver disease. HCV causes 20% of acute hepatitis cases, 70% of all chronic hepatitis cases, 40% of all cases of liver cirrhosis, 60% of hepatocellular carcinomas, and 30% of liver transplants in Europe(1. It is also recognized as the leading cause of liver transplantation in the world(2. Only 20% of infected individuals will recover from this viral infection, while the rest become chronically infected(3. While the majority of chronically infected individuals never exhibit symptoms, approximately 10-30% of these patients will eventually develop cirrhosis or hepatocellular carcinoma, both of which are associated with significant morbidity and mortality(4.More than 170 million people worldwide are chronically infected with HCV. According to WHO report in 2002, chronic liver diseases were responsible for 1.4 million deaths, including 796,000 due to cirrhosis and 616,000 due to primary liver cancer. At least 20% of these deaths are probably attributable to HCV infection- more than 280,000 deaths(5, 6. The prevalence of chronic HCV infection in general population varies greatly in different parts of the world, being estimated between 0.1 and 5%, with a peak prevalence of 20- 25% in Egypt. HCV prevalence seems to be less than 1% in Iran, which is much lower than most of the neighboring countries(7. HCV was the first virus discovered by molecular cloning method without the direct use of biologic or biophysical methods. This was accomplished by extracting, copying into cDNA, and cloning all the nucleic acid from the plasma of a chimpanzee infected with non- A, non-B hepatitis by contaminated factor XIII concentrate(8. The HCV genome is a positive-sense, singlestranded RNA genome approximately 10 kb long. It has marked similarities to those of members of the genera Pestivirus and Flavivirus. Different HCV isolates from around the world show substantial nucleotide sequence variability

  7. Presumptive identification of Candida species other than C. albicans, C. krusei, and C. tropicalis with the chromogenic medium CHROMagar Candida

    Directory of Open Access Journals (Sweden)

    Horvath Lynn L


    Full Text Available Abstract Background CHROMagar Candida (CaC is increasingly being reported as a medium used to differentiate Candida albicans from non-albicans Candida (NAC species. Rapid identification of NAC can assist the clinician in selecting appropriate antifungal therapy. CaC is a differential chromogenic medium designed to identify C. albicans, C. krusei, and C. tropicalis based on colony color and morphology. Some reports have proposed that CaC can also reliably identify C. dubliniensis and C. glabrata. Methods We evaluated the usefulness of CaC in the identification of C. dubliniensis, C. famata, C. firmetaria, C. glabrata, C. guilliermondii, C. inconspicua, C. kefyr, C. lipolytica, C. lusitaniae, C. norvegensis, C. parapsilosis, and C. rugosa. Results Most NAC produced colonies that were shades of pink, lavender, or ivory. Several isolates of C. firmetaria and all C. inconspicua produced colonies difficult to differentiate from C. krusei. Most C. rugosa isolates produced unique colonies with morphology like C. krusei except in a light blue-green color. C. glabrata isolates produced small dark violet colonies that could be differentiated from the pink and lavender colors produced by other species. All seventeen isolates of C. dubliniensis produced green colonies similar to those produced by C. albicans. Conclusion C. glabrata and C. rugosa appear distinguishable from other species using CaC. Some NAC, including C. firmetaria and C. inconspicua, could be confused with C. krusei using this medium.

  8. C3 glomerulopathy: consensus report.


    Lavin, Peter


    PUBLISHED C3 glomerulopathy is a recently introduced pathological entity whose original definition was glomerular pathology characterized by C3 accumulation with absent or scanty immunoglobulin deposition. In August 2012, an invited group of experts (comprising the authors of this document) in renal pathology, nephrology, complement biology, and complement therapeutics met to discuss C3 glomerulopathy in the first C3 Glomerulopathy Meeting. The objectives were to reach a consensus on: the ...

  9. Generation of a C3c specific monoclonal antibody and assessment of C3c as a putative inflammatory marker derived from complement factor C3

    DEFF Research Database (Denmark)

    Palarasah, Yaseelan; Skjødt, Karsten; Brandt, Jette;


    complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m......Ab was tested in different ELISA combinations with various types of in vitro activated sera and with plasma or serum samples from factor I deficient patients. The specificity of the mAb was evaluated in immunoprecipitation techniques and by analysis of eluted fragments of C3 after immunoaffinity...... chromatography. The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust...

  10. Dicty_cDB: SLA767 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequences producing significant alignments: (bits) Value N ( AU061952 ) Dictyostelium discoideum slug cDNA,... clone SLG757. 174 1e-75 2 ( AU039513 ) Dictyostelium discoideum slug cDNA, clone SLA767. 174 1e-75 2 ( BJ356068 ) Dict...yostelium discoideum cDNA clone:dda59k02, 3' ... 174 1e-75 2 ( BJ337834 ) Dict...yostelium discoideum cDNA clone:dda59l02, 5' ... 174 1e-75 2 ( BJ341325 ) Dictyostelium discoideum c...DNA clone:dda6l05, 3' e... 174 2e-75 2 ( BJ399383 ) Dictyostelium discoideum cDNA clone:dds5o14, 3' e... 174 2e-75 2 ( C89888 ) Dict

  11. Dicty_cDB: VFL817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value N ( BJ415870 ) Dictyostelium discoideum cDNA clone:ddv24b06, 5' ... 234 8e-84 2 ( BJ387278 ) Dict...yostelium discoideum cDNA clone:dds1c09, 5' e... 226 3e-81 2 ( BJ325655 ) Dictyosteliu...m discoideum cDNA clone:dda1h20, 5' e... 226 1e-80 2 ( BJ326331 ) Dictyostelium d...iscoideum cDNA clone:dda16h06, 5' ... 226 5e-76 3 ( BJ360457 ) Dictyostelium discoideum cDNA clone:ddc6n04, ...5' e... 226 5e-73 2 ( BJ323720 ) Dictyostelium discoideum cDNA clone:dda11o20, 5' ... 226 7e-73 2 ( BJ388343 ) Dict

  12. Dicty_cDB: VFC850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cds. 1126 0.0 7 AW093338 |AW093338.1 EST286518 tomato mixed elicitor, BTI Lycopersicon esculentum cDNA clon...0 1e-04 3 AI899153 |AI899153.1 EST268596 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED37K14, mR...NA sequence. 34 0.002 4 BI935707 |BI935707.1 EST555596 tomato flower, anthesis Lycopersi... fruit, TIGR Lycopersicon esculentum cDNA clone cLEG10E22, mRNA sequence. 34 0.003 4 AI771567 ...|AI771567.1 EST252667 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED3

  13. Dicty_cDB: AFK242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato germinating seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA seque... 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 similar to calreticulin...c, DNA sequence. 78 3e-21 4 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA c..., putative, mRNA sequence. 74 5e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lyco...nce. 74 5e-09 1 AW626316 |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lyc

  14. Dicty_cDB: AFK432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sculentum clone 132068F, mRNA sequence. 74 3e-10 2 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersico...ntum cDNA clone cLEZ19K24 5', mRNA sequence. 74 5e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lyco...c, DNA sequence. 80 8e-11 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clon...ato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA sequence. 74 5e-09 1 dna update 2004. 7.30 Hom...rkiscrksc*krsrrs**rrrrsr*rrlvktrqkrrsqkinqks Homology vs CSM-cDNA Score E Sequences producing

  15. Dicty_cDB: SHJ334 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 0.011 1 CN448467 |CN448467.1 GUO_cDNA_13_39 Flower bud cDNA library from Lycoris longituba Lycoris longitu...8466.1 GUO_cDNA_22_60 Flower bud cDNA library from Lycoris longituba Lycoris longituba cDNA clone GUO_cDNA_2...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SHJ334 (SHJ334Q) ...2_60.T3_062.ab1, mRNA sequence. 52 0.011 1 AF003151 |AF003151.3 Caenorhabditis elegans cosmid D1007, complet...ology vs Protein Score E Sequences producing significant alignments: (bits) Value AP004648_

  16. Dicty_cDB: VFA820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 4e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersicon esculentum cDNA...d, mRNA sequence. 74 7e-11 2 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi... Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1059 0.0 5 BD248385 |BD2.... 72 2e-14 2 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clone cLEC72A21 5' en...89195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED17D1, mRNA sequence. 7

  17. Dicty_cDB: AFI576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce 1. 42 3.9 1 AW443476 |AW443476.1 EST308406 tomato mixed elicitor, BTI Lycopersicon esculentum cDNA clone ... mRNA sequence. 42 3.9 1 BE461842 |BE461842.1 EST413261 tomato breaker fruit, TIGR Lycopersicon esculentum c...3.9 1 BM411759 |BM411759.1 EST586086 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57H14 5' en...cLET44G10 5', mRNA sequence. 42 3.9 1 BI926280 |BI926280.1 EST546169 tomato flower, buds 0-3 mm Lyco...o flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22O4 5' end, mRNA sequence. 42 3.9

  18. Dicty_cDB: AFE411 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3e-09 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 similar to calreticulin...uence. 80 5e-11 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon escul...entum cDNA clone cLEC72A21 5' end, mRNA sequence. 74 3e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersico...n esculentum cDNA clone cLED17D1, mRNA sequence. 74 3e-09 1 AW649196 |AW649196.1 EST327650 tomato germinating seedling...RNA sequence. 74 3e-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersicon esculentum c

  19. Dicty_cDB: VFD121 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 68 3e-07 ...c, DNA sequence. 68 4e-13 2 BI921109 |BI921109.1 EST541012 tomato callus Lycopersico...n esculentum cDNA clone cLEC72A21 5' end, mRNA sequence. 68 4e-09 2 AW649196 |AW649196.1 EST327650 tomato germinating...1 AW626316 |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon escule...3e-07 1 AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18

  20. Dicty_cDB: AFJ750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C72A21 5' end, mRNA sequence. 74 6e-11 2 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersico...921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clone cLE...n esculentum cDNA clone cLEM8G13, mRNA sequence. 74 4e-09 1 AI771812 |AI771812.1 EST252912 tomato ovary, TAMU Lyco...-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersicon esculentum cDNA clone cLEG27F24..., mRNA sequence. 74 4e-09 1 AW932476 |AW932476.1 EST358319 tomato fruit mature green, TAMU Lycopersicon escu

  1. Dicty_cDB: VFD449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available D17D1, mRNA sequence. 74 5e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersico...c, DNA sequence. 80 8e-11 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDN...A clone cLEC72A21 5' end, mRNA sequence. 74 8e-11 2 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersico...equence. 74 5e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLE...e-09 1 AI771812 |AI771812.1 EST252912 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA s

  2. Dicty_cDB: VFE671 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI...5e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersicon esculentum cDNA c... mRNA, complete cds. 1019 0.0 5 BD248385 |BD248385.1 Gene participating in tolerance again...lone cLEM8G13, mRNA sequence. 74 5e-09 1 AI771812 |AI771812.1 EST252912 tomato ovary, TAMU Lycopersico...ato breaker fruit, TIGR Lycopersicon esculentum cDNA clone cLEG27F24, mRNA sequence. 74 5e-09 1 dna update 2003. 9.17 Hom

  3. Dicty_cDB: AFO626 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM8G13, mRNA seq... AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi... seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 5e-09 1... mRNA, complete cds. 1009 0.0 4 BD248385 |BD248385.1 Gene participating in tolerance again...c, DNA sequence. 74 2e-19 4 BI921109 |BI921109.1 EST541012 tomato callus Lyco

  4. Dicty_cDB: VFE720 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA library (subtracted) Beta vulgaris cDNA 5', mRNA sequence. 50 0.031 1 BI643292 |BI643292.1 RS3_C04 Sugar beet root...nipes entomopoxvirus, complete genome. 38 0.016 9 BI643417 |BI643417.1 RS1_B03 Sugar beet root...ry particle-like (e-60), mRNA sequence. 50 0.031 1 BI643279 |BI643279.1 RS3_E12 Sugar beet root... cDNA library (subtracted) Beta vulgaris cDNA 5' similar to 26S proteasome regulato... cDNA library (subtracted) Beta vulgaris cDNA 5' similar to 26S proteasome regulatory particle

  5. Dicty_cDB: AFL735 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scoideum cAMP-inducible prespore pr... 230 1e-56 1 ( AU053508 ) Dictyostelium discoideum slug cDNA, clone SL...I803. 230 1e-56 1 ( AU053438 ) Dictyostelium discoideum slug cDNA, clone SLI655. 230 1e-56 1 ( AU040058 ) Di...ctyostelium discoideum slug cDNA, clone SLA333. 230 1e-56 1 ( AU039982 ) Dictyostelium discoideum slug cDNA,... clone SLH374. 230 1e-56 1 ( AU039772 ) Dictyostelium discoideum slug cDNA, clone... SLG381. 230 1e-56 1 ( AU039205 ) Dictyostelium discoideum slug cDNA, clone SLH142. 230 1e-56 1 ( AU034359 )

  6. Dicty_cDB: SLC511 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value N ( AU034577 ) Dictyostelium discoideum slug cDNA, clon...e SLC511. 210 3e-51 2 ( AU053732 ) Dictyostelium discoideum slug cDNA, clone SLJ5...71. 210 3e-51 2 ( AU035005 ) Dictyostelium discoideum slug cDNA, clone SLE476. 210 5e-51 2 ( AU034483 ) Dictyostelium discoideum slug... cDNA, clone SLC205. 210 5e-51 2 ( AU040035 ) Dictyostelium discoideum slug cDNA, c...lone SLH495. 210 5e-51 2 ( AU060899 ) Dictyostelium discoideum slug cDNA, clone SLC137. 210 7e-51 2 ( AU0369

  7. Dicty_cDB: SFK594 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 105 3e-19 1 ( AU076317 ) Dictyostelium discoideum slug cDNA, clone SSA149. 105 3e-19 1 ( AU062165 ) Dictyostelium discoideum slug... cDNA, clone SLI120. 105 3e-19 1 ( AU061979 ) Dictyostelium discoideum slug... cDNA, clone SLG851. 105 3e-19 1 ( AU061204 ) Dictyostelium discoideum slug cDNA, clone SLD53...2. 105 3e-19 1 ( AU061170 ) Dictyostelium discoideum slug cDNA, clone SLD468. 105 3e-19 1 ( AU060802 ) Dictyostelium discoideum slug... cDNA, clone SLB538. 105 3e-19 1 ( AU060689 ) Dictyostelium discoideum slug cDNA, cl

  8. Dicty_cDB: SLD230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alue N ( AU052384 ) Dictyostelium discoideum slug cDNA, clone SLD230. 268 6e-68 2 ( AU052130 ) Dictyostelium discoideum slug... cDNA, clone SLA579. 268 7e-68 2 ( AU033673 ) Dictyostelium discoideum slug cDNA, clone SLB2...96. 268 7e-68 2 ( AU034239 ) Dictyostelium discoideum slug cDNA, clone SLC311. 26...8 7e-68 2 ( AU052966 ) Dictyostelium discoideum slug cDNA, clone SLF396. 268 7e-68 2 ( AU053398 ) Dictyostelium discoideum slug... cDNA, clone SLI557. 268 7e-68 2 ( AU034057 ) Dictyostelium discoideum slug cDNA, clone S

  9. Dicty_cDB: AFO104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y Beta vulgaris cDNA 5' similar to UDP-glucose pyrophosphorylase, mRNA sequence. 70 4e-... Beet germination cDNA library Beta vulgaris cDNA 5' similar to UTP-glucose-1-phosphate uridylt...y Beta vulgaris cDNA clone J-18-8, mRNA sequence. 62 6e-07 2 BQ490192 |BQ490192.1 49-E9435-006-010-A14-T3 Sugar... beet MPIZ-ADIS-006 Lambda Zap II library Beta vulgaris cDNA clone A-14-10, mRNA sequenc...y Beta vulgaris cDNA clone M-10-9, mRNA sequence. 62 8e-07 2 BI096068 |BI096068.1 PIP2ER_C07 Sugar

  10. Dicty_cDB: VSF607 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *r s*sqtipncfps*xqfiil*cfsqiklqfrktixlvniktprxqgxhxrsttnlkitxnr srfqlnexx*kxsr*xccppitxrq**xxnkfkkkkq*kkiiii...aa14a04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' s...498261.1 PfESToab94h09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW...-37 5 BI815642 |BI815642.1 PfESToaa31a10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDN...quence. 92 1e-37 5 BI815554 |BI815554.1 PfESToaa29h11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium

  11. Synthesis of paclitaxel-C3`-{sup 14}C

    Energy Technology Data Exchange (ETDEWEB)

    Walker, D.G.; Standridge, R.T.; Swigor, J.E. [Bristol-Myers-Squibb Co., Syracuse, NY (United States). Pharmaceutical Research Inst.


    Reductive cleavage of the C13 side chain of paclitaxel (3) followed by regioselective silylation gave 7-triethylsilybaccatin lll (6). Successive reaction of L-threonine methyl ester hydrochloride (7) with tertbutoxydiphenylchlorosilane, benzaldehyde-C7-{sup 14}C and acetoxyacetyl chloride/triethylamine gave a 92:8 ratio (NMR) of azetidinones in 57% yield from 7. Removal of the chiral auxiliary, and 3-O-triethylsilylation and N-benzoylation provided (3R,4S)-cis-1-benzoyl-3-O-(triethylsilyl)-4-phenylazetidin-2-one-C 4-{sup 14}C (18). Coupling of 18 and 6 followed by deprotection gave 1.12 g of paclitaxel-C3`-{sup 14}C having a specific activity of 16.4 mCi/mmol and a radiochemical purity of 96%. (Author).

  12. Dicty_cDB: CHA114 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hfwylwy*ncryw*stiinafns*nlwccxyhsginxfkkfx qlqn Homology vs CSM-cDNA Score E Sequences producing signific...56680 |BG356680.1 OV2_26_E12.g1_A002 Ovary 2 (OV2) Sorghum bicolor cDNA, mRNA seq...uence. 38 5e-04 3 BE355215 |BE355215.1 DG1_10_A09.g1_A002 Dark Grown 1 (DG1) Sorghum bicolor cDNA, mRNA sequ...ato fruit mature green, TAMU Lycopersicon esculentum cDNA clone cLEF58A5 5', mRNA sequence. 40 0.005 2 BE353...582 |BE353582.1 EST353863 tomato flower buds 0-3 mm, Cornell University Lycopersicon esculentum cDNA clone c

  13. Lightweight C/SiC mirrors for space application (United States)

    Zhou, Hao; Zhang, Chang-rui; Cao, Ying-bin; Zhou, Xin-gui


    Challenges in high resolution space telescopes have led to the desire to create large primary mirror apertures. Ceramic mirrors and complex structures are becoming more important for high precision lightweight optical applications in adverse environments. Carbon-fiber reinforced silicon carbide (C/SiC) has shown great potential to be used as mirror substrate. This material has a high stiffness to weight ratio, dimensional stability from ambient to cryo temperatures, and thermal conductivity, low thermal expansion as well. These properties make C/SiC very attractive for a variety of applications in precision optical structures, especially when considering space-borne application. In this paper, lightweight C/SiC mirror prepared for a scan mirror of a high resolution camera is presented. The manufacturing of C/SiC mirror starts with a porous rigid felt made of short chopped carbon fibers. The fibers are molded with phenolic resin under pressure to form a carbon fiber reinforced plastic blank, followed by a pyrolization process by which the phenolic resin reacts to a carbon matrix. The C/C-felt can be machined by standard computer controlled milling techniques to any virtual shape. This is one of the most significant advantages of this material, as it drastically reduces the making costs and enables the manufacture of truly ultra-lightweight mirrors, reflectors and structures. Upon completion of milling, the C/C-felt preform is mounted in a high-temperature furnace together with silicon and heated under vacuum condition to 1500°C at which the silicon changes into liquid phase. Subsequently, the molten silicon is infiltrated into the porous preform under capillary forces to react with carbon matrix and the surfaces of the carbon fibers to form a density C/SiC substrate. The C/SiC material retains the preform shape to within a tight tolerance after sintering means the ceramization process is a nearly net shaping process. Reactive melt infiltrated C/SiC, followed by

  14. Dicty_cDB: VFG365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES3N17,...oot during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA sequence. 92...uence, mRNA sequence. 92 4e-15 2 BG642411 |BG642411.1 EST355887 tomato flower buds, anthesis, Cornell...flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequence. 92 3e-...D11 5' sequence, mRNA sequence. 92 4e-16 3 AW217896 |AW217896.1 EST296610 tomato

  15. Dicty_cDB: SLG494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lug cDNA, clone SLG494. 807 0.0 2 ( C23695 ) Dictyostelium discoideum gamete cDNA, clone FC-AK02. 783 0.0 2 ...( AU284631 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 783 0.0 2 ( AU2...84368 ) Dictyostelium discoideum gamete cDNA clone:FC-AP1... 783 0.0 2 ( AU034139 ) Dictyostelium discoideum... AU284449 ) Dictyostelium discoideum gamete cDNA clone:FC-AW0... 783 0.0 2 ( AU284518 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 783 0.0 2 ( AU284520 ) Dictyostelium discoideum gamete

  16. Dicty_cDB: VFI685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 51 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 305 3e-79 1 ( AU285021 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 305 3e-79 1 ( AU285015 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 30...5 3e-79 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 305 3e-79 1 ( AU284420 ) Dictyostelium discoideum gamete... cDNA clone:FC-AT2... 305 3e-79 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 305 3e-79 1 ( AU284225 ) Dictyostelium discoideum gamete cDNA clo

  17. Dicty_cDB: SLD194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum gamete cDNA clone:FCL-AC... 161 7e-36 1 ( AU285021 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 161 7e-36 1 ( AU285015 ) Dictyostelium discoideum gamete ...cDNA clone:FCL-AA... 161 7e-36 1 ( AU284890 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1... 161 7e-36... 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 161 7e-36 1 ( AU284420 ) Dictyostelium discoideum gamete... cDNA clone:FC-AT2... 161 7e-36 1 ( AU284396 ) Dictyostelium discoideum gamete cDNA clone:F

  18. Heritability and expression of C4 photosynthesis in hybrids between C3-C4 and C4 Flaveria

    International Nuclear Information System (INIS)

    In general, leaves of C4 plants are considered to be more efficient at fixing atmospheric CO2 than those of C3 plants. Such efficiency in carbon assimilation is attributed to unique C4 features in anatomy, physiology and biochemistry of leaves. In these studies I investigated whether these C4 characteristics can be inherited and expressed in C3-C4 species through artificial hybridization with C4 species in genus Flaveria. The expression of C4 photosynthesis in the parent C4 parent F. brownii is influenced by the light intensity during growth. Characterization of these F1 hybrids demonstrates that several C4 traits are heritable. The expression of Kranz leaf anatomy, and the activities and/or quantities of key C4 enzymes in the F1 hybrids are intermediate between levels in the parents. Enzyme localization studies with isolated leaf mesophyll and bundle sheath protoplasts indicated that these hybrids lack a complete compartmentation of major photosynthetic enzymes, but they do exhibit a differential distribution of these enzymes between the two cell types. Furthermore, 14CO2 labeling experiments showed that they all possess a high degree of functional C4 photosynthesis, which may in part contribute to the reduced photorespiration observed in the F1 hybrids

  19. Complement component 3 (C3) (United States)

    ... page: // Complement component 3 (C3) To use the sharing features on this page, ... be some throbbing. Why the Test is Performed C3 and C4 are the most commonly measured complement components. A complement test may be used to monitor ...

  20. Scheduling a C-Section (United States)

    ... Pregnancy > Labor & birth > Scheduling a c-section Scheduling a c-section E-mail to a friend Please fill in all fields. Please enter ... and develop before she’s born. Why can scheduling a c-section for non-medical reasons be a ...

  1. Biological variation of cystatin C

    DEFF Research Database (Denmark)

    Reinhard, Mark; Erlandsen, Erland; Randers, Else


    available for analysis. Serum cystatin C was measured using Dade Behring N Latex Cystatin C assay and serum creatinine by an enzymatic method (Roche). Results: The mean serum concentration of cystatin C was 0.70 mg/l (range 0.44-1.09) and the mean serum creatinine was 77 µmol/l (range 54-100). The...

  2. Remote mechanical C line

    International Nuclear Information System (INIS)

    Westinghouse Hanford Company is developing a desk-top simulation based training program on the operation of the Remote Mechanical C (RMC) Line process in the Plutonium Finishing Plant on the Hanford site, Richland, Washington. Simulations display aod contioually update current values of system parameters on computer graphics of RMC line equipment. Students are able to operate a variety of controllers to maintain proper system status. Programmed faults, selectable by the course instructor, can be used to test student responses to off-normal events. Prior to operation of the simulation, students are given computer-based tutorials on the function, processes, operation, and error conditions associated with individual components. By including the capability of operating each individual component - valves, heaters, agitators, etc. - the computer-based training (CBT) lessons become an interactive training manual. From one perspective RMC represents one step in the diffusion of the well-known and well-documented simulator training activities for nuclear reactor operators to other training programs, equally critical, perhaps, but less well scrutinized in the past. Because of the slowly responding nature of the actual process, RMC can retain many of the capabilities of practice and testing in a simulated work environment while avoiding the cost of a full scale simulator and the exposure and waste developed by practice runs of the RMC line. From another perspective RMC suggests training advances even beyond the most faithful simulators. For example, by integrating CBT lessons with the simulation, RMC permits students to focus in on specific processes occurring inside chosen components. In effect, the interactive training manual is available on-line with the simulation itself. Cost are also discussed

  3. Human complement component C3

    DEFF Research Database (Denmark)

    Behrendt, N


    The two common genetic variants of human C3, C3 S and C3 F, were purified and characterized by SDS-PAGE, agarose gel electrophoresis, isoelectric focusing and amino acid analysis. The difference in electrophoretic mobility between the two variants was conserved after purification, and by...... isoelectric focusing of the hemolytically active proteins, pI values of 5.86 and 5.81 were determined for C3 S and C3 F, respectively. Any difference in amino acid composition was too small to be detected by amino acid analysis, and the two proteins had the same molecular weight as determined by SDS-PAGE....

  4. Java to C: A Primer

    DEFF Research Database (Denmark)

    McDowell, Charlie; Villadsen, Jørgen

    This book is designed to be used as a quick introduction to C for programmers already familiar with Java. It is not a replacement for a reference book on C but is instead a supplement. For the programmer already familiar with Java, the typical book on C requires the reader to wade through many...... details of already-familiar material. In this book, we quickly present the main concepts needed to begin writing serious programs in C, highlighting the differences between C and Java....

  5. Internal friction and gas desorption of {C}/{C} composites (United States)

    Serizawa, H.; Sato, S.; Kohyama, A.


    {C}/{C} composites are the most promising candidates as high heat flux component materials, where temperature dependence of mechanical properties and gas desorption behavior at elevated temperature are important properties. At the beginning, the newly developed internal friction measurement apparatus, which enables the accurate measurement of dynamic elastic properties up to 1373 K along with the measurement of gas desorption behavior, was used. The materials studied were unidirectional (UD) {C}/{C} composites reinforced with mesophase pitch-based carbon fibers, which were heat treated at temperatures ranging from 1473 to 2773 K which produced a variety of graphitized microstructures. Two-dimensional (2D) {C}/{C} composites reinfored with flat woven fabrics of PAN type carbon fibers were also studied. These materials were heat treated at 1873 K. From the temperature spectrum of internal friction of 2D {C}/{C} composites, these internal friction peaks were detected and were related to gas desorption. Also the temperature dependence of Young's modulus of UD {C}/{C} composites, negative and positive dependence of Young's modulus were observed reflecting microstructure changes resulting from the heat treatments.

  6. Hepatology after Hepatitis C. (United States)

    Fitz, J Gregory


    The ∼90% probability of curing individual patients with hepatitis C virus (HCV)using direct-acting antivirals represents one of the most dramatic medical success stories of the modern era, and the journey from viral discovery to treatment occurred over just ∼25 years. The realities of the global burden of disease (2-3% of the world's population is infected), limited access to care and cost of treatment mean that HCV will continue to be a major problem for the next 25 years. But what if HCV (and hepatitis B) could be eradicated? Since liver transplantation and HCV management have been the mainstays of academic hepatology practice, where do we go from here? Unfortunately, we are in an era where the incidence and prevalence of liver diseases around the globe is increasing, and death from complications of cirrhosis is now among the top 10 causes in most countries; so hepatologists are expected to play a major role in the future. Despite remarkable progress, success at the population level is limited by the resource-intensive nature of caring for patients with end-stage disease. Accordingly, the major advances in the next decade are likely to focus on (i) the earlier identification of individuals and populations at higher risk for liver diseases, and (ii) initiation in high-risk populations of specific strategies for early detection and treatment of fibrosis, cancer and cirrhosis. The answers will lie in large part in the further exploration of the human genome in carefully phenotyped patients. Risk variants in the PNPLA3 gene represent the best example to date. The risk variants are common and are enriched in certain populations around the globe; and individuals that possess risk variants are more likely to have liver injury from fatty liver disease (even as children), alcohol and viral hepatitis. Further, those with liver injury are more likely to progress to cirrhosis and hepatoma. Similarly, in those with established liver disease, use of biomarkers and other

  7. ECSTM study of adsorption of C60,C70,C86 and Y@C82 on Au(111)

    Institute of Scientific and Technical Information of China (English)


    The adsorption of a variety of fullerenes (C60,C70,C86,Y@C82) on Au(111) electrode surfaces was comprehensively investigated in 0.1 M HClO4 by electrochemical scanning tunneling microscopy (ECSTM).In the ordered C60’s adlayer,C60 molecules formed either (2(1/3) × 2 3~(1/3))or "in-phase" structure.The high resolution STM image shows that the C60 cage is not simply round but shows a bifurcated feature.The adsorption orientation of C60 on Au(111) is tentatively suggested.In the ordered C70’s adlayer,the perpendicular fullerene molecules are the main adsorption mode and form (2 3~(1/3) × 2 3~(1/3)) structure.However,for C86 and Y@C82,the ordered adlayer could not be obtained on Au(111) under the present condition.These differences may be due to the different molecular shapes and sizes,and the encapsulated metal atom which affects the lattice matches with the substrate.The adsorption of fullerene molecules on Au(111) from disorder to order could be tuned simply by steering the dimensional sizes or shapes of the fullerenes used.

  8. Effective modern C++ 42 specific ways to improve your use of C++11 and C++14

    CERN Document Server

    Meyers, Scott


    At first glance, C++11 and C++14 are defined by the new features they introduce, e.g., auto type declarations, move semantics, lambda expressions, and concurrency support. Information on these features is easy to come by, but learning to apply them effectively (such that the resulting software is correct, efficient, maintainable, and portable) is more challenging. That’s the role of this book. It describes how to write effective software using C++11 and C++14, i.e., using modern C++. Topics include: * The pros and cons of uniform initialization, noexcept specifications, perfect forwarding, and smart pointer make functions. * The relationships among std::move, std::forward, rvalues references, and universal references. * The most effective forms of lambda capture. * How best practices in “old” C++ programming (i.e., C++98) require revision for modern C++. Effective Modern C++ follows the proven format of Scott Meyers’ earlier Effective books (Effective C++, More Effective C++, and Effective STL), but c...

  9. Tribological characteristics of C/C-SiC braking composites under dry and wet conditions

    Institute of Scientific and Technical Information of China (English)

    LI Zhuan; XIAO Peng; XIONG Xiang; ZHU Su-hua


    C/C-SiC braking composites, based on reinforcement of carbon fibers and rnatrices of carbon and silicon carbide, were fabricated by warm compaction and in situ reaction process. The tribological characteristics of C/C-SiC braking composites under dry and wet conditions were investigated by means of MM-1000 type of friction testing machine. The influence of dry and wet conditions on the tribological characteristics of the C/C-SiC composites was ascertained. Under dry condition, C/C-SiC braking composites show superior tribological characteristics, including high coefficient of friction (0.38), good abrasive resistance (thickness loss is 1.10 μm per cycle) and steady breaking. The main wear mechanism is plastic deformation and abrasion caused by plough. Under wet condition, frictional films form on the worn surface. The coefficient of friction (0.35) could maintain mostly, and the thickness loss (0.70 μm per cycle) reduces to a certain extent. Furthermore, braking curves are steady and adhesion and oxidation are the main wear mechanisms.

  10. Simulation of interaction of circular clusters C7, C12, C13 with nanographene

    International Nuclear Information System (INIS)

    Interaction of circular carbon clusters C7, C12 and C13 with graphene consisting of 272 atoms has been studied by computer simulation based on the Monte Carlo method. The mutual arrangement of the cluster atoms and graphene and their cohesive energy before and after their interaction have been investigated. (author)

  11. Effectiveness of Diffusion Barrier Coatings for Mo-Re Embedded in C/SiC and C/C (United States)

    Glass, David E.; Shenoy, Ravi N.; Wang, Zeng-Mei; Halbig, Michael C.


    Advanced high-temperature cooling applications may often require the elevated-temperature capability of carbon/silicon carbide or carbon/carbon composites in combination with the hermetic capability of metallic tubes. In this paper, the effects of C/SiC and C/C on tubes fabricated from several different refractory metals were evaluated. Though Mo, Nb, and Re were evaluated in the present study, the primary effort was directed toward two alloys of Mo-Re, namely, arc cast Mo-41Re and powder metallurgy Mo-47.5Re. Samples of these refractory metals were subjected to either the PyC/SiC deposition or embedding in C/C. MoSi2(Ge), R512E, and TiB2 coatings were included on several of the samples as potential diffusion barriers. The effects of the processing and thermal exposure on the samples were evaluated by conducting burst tests, microhardness surveys, and scanning electron microscopic examination (using either secondary electron or back scattered electron imaging and energy dispersive spectroscopy). The results showed that a layer of brittle Mo-carbide formed on the substrates of both the uncoated Mo-41Re and the uncoated Mo-47.5Re, subsequent to the C/C or the PyC/SiC processing. Both the R512E and the MoSi2(Ge) coatings were effective in preventing not only the diffusion of C into the Mo-Re substrate, but also the formation of the Mo-carbides. However, none of the coatings were effective at preventing both C and Si diffusion without some degradation of the substrate.

  12. Dicty_cDB: SSD539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1.1 ( P58324 ) RecName: Full=Electron transport complex protein rnfC; ... 34 1.4 AP009240_1649( AP009240 |pid:none) Escheric...ant alignments: (bits) Value N ( U25143 ) Dictyostelium discoideum cAMP-inducible prespore pr... 444 e-128 2 ( BJ355918 ) Dict...yostelium discoideum cDNA clone:dda58k17, 3' ... 444 e-128 2 ( BJ385458 ) discoideum cDNA clone:ddc55d04, 3' ... 444 e-128 2 ( BJ354904 ) Dictyostelium ...discoideum cDNA clone:dda55j05, 3' ... 444 e-128 2 ( BJ403095 ) Dictyostelium discoideum cDNA clone:dds24d04

  13. Dicty_cDB: VFO445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value N ( BJ417087 ) Dictyostelium discoideum cDNA... clone:ddv29j12, 5' ... 404 e-109 1 ( BJ327544 ) Dictyostelium discoideum cDNA clone:dda20g20, 5' ... 268 2e-94 2 ( BJ359603 ) Dict...yostelium discoideum cDNA clone:ddc15e17, 5' ... 268 2e-94 2 ( BJ362692 ) discoideum cDNA clone:ddc23f06, 5' ... 268 2e-94 2 ( BJ329271 ) Dictyostelium discoideum cDNA clone:dda24...l07, 5' ... 268 2e-94 2 ( BJ386698 ) Dictyostelium discoideum cDNA clone:dds10m05

  14. Dicty_cDB: CHK352 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 385 e-103 1 BJ595202 |BJ595202.1 Physcomitrella patens subsp. patens cDNA clone:pphb47p15, 3' end, single 46 0.24 1 BJ597539 |BJ597539.1 Physcomitrella patens subsp. patens cDNA clone:pphn20l09, 3' end, singl...e read. 46 0.24 1 BJ610489 |BJ610489.1 Physcomitrella patens subsp. patens cDNA clone:pphn12d12, 3' en...d, single read. 46 0.24 1 BJ604911 |BJ604911.1 Physcomitrella patens subsp. patens cDNA clone:pphn32c10, 3' en...d, single read. 46 0.24 1 BJ598960 |BJ598960.1 Physcomitrella patens subsp. patens cD

  15. Dicty_cDB: VFE846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ty Lycopersicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.038 1 BE459099 |BE4...59099.1 EST414391 tomato developing/immature green fruit Lycopersicon esculentum ...cDNA clone cLEM5D1, mRNA sequence. 50 0.038 1 AW650034 |AW650034.1 EST328488 tomato germinating seedlings, TAMU Lycopersi...istem Lycopersicon esculentum cDNA clone cTOF20D10 5' sequence, mRNA sequence. 50 0.038 1 ...BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersico

  16. Dicty_cDB: AFO633 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oeba histolytica genomic, DNA sequence. 80 8e-11 1 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon...6316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone ...cLEZ19K24 5', mRNA sequence. 74 5e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersi... |AI771812.1 EST252912 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA sequence. 74 5e-...09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lycopersicon esculentum cDNA clone cLEG27F24,

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 48 0.002 2 AW928461 |AW928461.1 EST337249 tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersi...developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM5D1, mRNA ...sequence. 50 0.042 1 AW650034 |AW650034.1 EST328488 tomato germinating seedlings, TAMU Lycopersicon cDNA clone cLEI11F15 5', mRNA sequence. 50 0.042 1 BG128445 |BG128445.1 EST474091 tomato shoot/meristem Lycopersi...1 BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone c

  18. Dicty_cDB: AFB811 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available esculentum cDNA clone cLED17D1, mRNA sequence. 68 2e-07 1 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lyco...Entamoeba histolytica genomic, DNA sequence. 68 2e-07 1 AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersico...37 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1116 0.0 2 BD248385 |BD248385.1 Gene participating in...BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clone cLEC72A21 5' end, mRNA seque...n esculentum cDNA clone cLES18L5, mRNA sequence. 68 2e-07 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lyco

  19. Dicty_cDB: AFH733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLEM8G1...ce. 74 3e-10 2 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 simi...36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 868 0.0 4 BD248385 |BD248385.1 Gene participating in...09 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA clone cLEC72A21 5' end, mRNA sequence. 7...lar to calreticulin, putative, mRNA sequence. 74 5e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersico

  20. Dicty_cDB: AFO187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 similar to calreticulin,... putative, mRNA sequence. 74 3e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lycopersico...n esculentum cDNA clone cLED17D1, mRNA sequence. 74 3e-09 1 AW649196 |AW649196.1 EST327650 tomato germinating... seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 3e-09 1... AW626316 |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculen