
Sample records for actinium c

  1. Spectroscopic and computational investigation of actinium coordination chemistry (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1- ligands (3.2+/-1.1) than AmIII (0.8+/-0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour.

  2. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  3. Spectroscopic and computational investigation of actinium coordination chemistry (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac–Cl and Ac–OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1– ligands (3.2±1.1) than AmIII (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour. PMID:27531582

  4. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    CERN Document Server

    Fry, C


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Spectroscopic and computational investigation of actinium coordination chemistry. (United States)

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  6. Thorium and actinium polyphosphonate compounds as bone-seeking alpha particle-emitting agents. (United States)

    Henriksen, Gjermund; Bruland, Oyvind S; Larsen, Roy H


    The present study explores the use of alpha-particle-emitting, bone-seeking agents as candidates for targeted radiotherapy. Actinium and thorium 1,4,7,10 tetraazacyclododecane N,N',N'',N''' 1,4,7,10-tetra(methylene) phosphonic acid (DOTMP) and thorium-diethylene triamine N,N',N'' penta(methylene) phosphonic acid (DTMP) were prepared and their biodistribution evaluated in conventional Balb/C mice at four hours after injection. All three bone-seeking agents showed a high uptake in bone and a low uptake in soft tissues. Among the soft tissue organs, only kidney had a relatively high uptake. The femur/kidney ratios for 227Th-DTMP, 228-Ac-DOTMP and 227Th-DOTMP were 14.2, 7.6 and 6.0, respectively. A higher liver uptake of 228Ac-DOTMP was seen than for 227Th-DTMP and 227Th-DOTMP. This suggests that some demetallation of the 228Ac-DOTMP complex had occurred. The results indicate that 225Ac-DOTMP, 227Th-DOTMP and 227Th-DTMP have promising properties as potential therapeutic bone-seeking agents.

  7. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    International Nuclear Information System (INIS)

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  8. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  9. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  10. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL (United States)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  11. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    International Nuclear Information System (INIS)

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  12. C

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Schouten, S.; Volkman, J.K.


    A limited suite of C-27, C-29 and C-30 rearranged hopenes identified as neohop-13(18)-enes have been reported in immature Recent and ancient marine/lacustrine sediments and their presence has been explained by dehydration and isomerisation of ubiquitous hopanols or hopenes. Here we investigated the

  13. Production of actinium-225 for alpha particle mediated radioimmunotherapy. (United States)

    Boll, Rose A; Malkemus, Dairin; Mirzadeh, Saed


    The initial clinical trials for treatment of acute myeloid leukemia have demonstrated the effectiveness of the alpha emitter (213)Bi in killing cancer cells. Bismuth-213 is obtained from a radionuclide generator system from decay of 10-days (225)Ac parent. Recent pre-clinical studies have also shown the potential application of both (213)Bi, and the (225)Ac parent radionuclide in a variety of cancer systems and targeted radiotherapy. This paper describes our five years of experience in production of (225)Ac in partial support of the on-going clinical trials. A four-step chemical process, consisting of both anion and cation exchange chromatography, is utilized for routine separation of carrier-free (225)Ac from a mixture of (228)Th, (229)Th and (232)Th. The separation of Ra and Ac from Th is achieved using the marcoporous anion exchange resin MP1 in 8M HNO(3) media. Two sequential MP1/NO(3) columns provide a separation factor of approximately 10(6) for Ra and Ac from Th. The separation of Ac from Ra is accomplished on a low cross-linking cation exchange resin AG50-X4 using 1.2M HNO(3) as eluant. Two sequential AG50/NO(3) columns provide a separation factor of approximately 10(2) for Ac from Ra. A 60-day processing schedule has been adopted in order to reduce the processing cost and to provide the highest levels of (225)Ac possible. Over an 8-week campaign, a total of approximately 100 mCi of (225)Ac (approximately 80% of the theoretical yield) is shipped in 5-6 batches, with the first batch typically consisting of approximately 50 mCi. After the initial separation and purification of Ac, the Ra pool is re-processed on a bi-weekly schedule or as needed to provide smaller batches of (225)Ac. The averaged radioisotopic purity of the (225)Ac was 99.6 +/- 0.7% with a (225)Ra content of < or =0.6%, and an average (229)Th content of (4(-4)(+5)) x 10(-5)%.

  14. Hepatite C Hepatitis C

    Directory of Open Access Journals (Sweden)

    Edna Strauss


    Full Text Available Estima-se que cerca de 3% da população mundial esteja infectada pelo vírus da hepatite C. Todos os que receberam transfusão de sangue ou seus componentes e os usuários de drogas podem estar infectados. Procedimentos odontológicos, médicos, tatuagem ou acupuntura também constituem fatores de risco. A infecção se cronifica em até 85% dos indivíduos, com evolução assintomática durante anos ou décadas e apresentação clínica variada. Para o diagnóstico, a determinação do anti-VHC revela-se muito sensível e a confirmação se faz pela determinação do RNA-VHC no sangue; o estadiamento da doença e a avaliação da atividade inflamatória pela biópsia hepática. O tratamento objetiva deter a progressão da doença hepática através da inibição da replicação viral. Devido à baixa eficácia terapêutica aliada a importantes efeitos colaterais do interferon e da ribavirina, esses medicamentos encontram indicações e contra-indicações específicas. Vários fatores preditivos de resposta ao tratamento, principalmente a carga viral e o genótipo do VHC, mostram-se úteis na avaliação dos pacientes.It has been estimated that 3% of the world population is infected with the hepatitis C virus. Those who are blood product recipients or have been illicit drug users are at risk. Dental and medical procedures as well as tattooing and acupuncture are also risk factors. Chronic infection occurs in up to 85% of infected cases but they may remain without symptoms during years or even decades, and clinical presentation varies. Determination of anti-HCV in sera is a fairly sensitive tool for the diagnosis, and confirmation requires the identification of HCV-RNA. Staging of the liver disease as well as definition of its present activity can be graded by liver biopsy. The aim of treatment is to stop the progression of the hepatic disease by inhibiting viral replication. Due to the low therapeutic efficacy combined with important side

  15. Beginning C

    CERN Document Server

    Horton, Ivor


    Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

  16. Vitamin C (United States)

    Vitamins are substances that your body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for ... promotes healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources ...

  17. Hepatitis C (United States)

    ... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

  18. Professional C++

    CERN Document Server

    Gregoire, Marc; Kleper, Scott J


    Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

  19. Balanced {C_4, C_5}-Quatrefoil Systems


    Ushio, Kazuhiko


    In graph theory, the decomposition problems of graphs are very important topics. Various types of decompositions of many graphs can be seen in the literature of gaph theory. We give the necessary and sufficient condition for the existence of a balanced {C_4, C_5}-quatrefoil decomposition of K_n for each of (C_4, C_4, C_4, C_4)-quatrefoil, (C_4, C_4, C_4, C_5)-quatrefoil, (C_4, C_4, C_5, C_5)-quatrefoil, (C_4, C_5, C_5, C_5)-quatrefoil, and (C_5, C_5, C_5, C_5)-quatrefoil. These decompositions...

  20. C++ Cookbook

    CERN Document Server

    Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff


    Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't

  1. Professional C++

    CERN Document Server

    Gregoire, Marc


    Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,

  2. Advanced C and C++ compiling

    CERN Document Server

    Stevanovic, Milan


    Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

  3. C/C-PAA与C/C-FA弯曲性能对比%Comparison of Flexural Properties Between C/C-PAA and C/C-FA

    Institute of Scientific and Technical Information of China (English)

    张万强; 赵英民; 王涛; 詹万初



  4. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    International Nuclear Information System (INIS)

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  5. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    Energy Technology Data Exchange (ETDEWEB)

    Aleissa, Khalid A.; Almasoud, Fahad I.; Islam, Mohammed S. [Atomic Energy Research Institute, King Abdul Aziz City for Science and Technology, P.O. Box 6086, Riyadh 11442 (Saudi Arabia); L' Annunziata, Michael F. [IAEA Expert, Montague Group, P.O. Box 5033, Oceanside, CA 92052-5033 (United States)], E-mail:


    The activities of {sup 228}Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide {sup 228}Ac. The radium was pre-concentrated on MnO{sub 2} and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter {sup 228}Ra({sup 228}Ac), the daughter nuclide {sup 228}Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by {sup 228}Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9{+-}0.1% was measured for {sup 228}Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317{+-}0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of {sup 228}Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for {sup 228}Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure {sup 228}Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  6. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228. (United States)

    Aleissa, Khalid A; Almasoud, Fahad I; Islam, Mohammed S; L'Annunziata, Michael F


    The activities of (228)Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide (228)Ac. The radium was pre-concentrated on MnO(2) and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter (228)Ra((228)Ac), the daughter nuclide (228)Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by (228)Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9+/-0.1% was measured for (228)Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317+/-0.013cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of (228)Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for (228)Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure (228)Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  7. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  8. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  9. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications


    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon


    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  10. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    International Nuclear Information System (INIS)

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  11. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)


    Waldek, Achim Marcus


    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  12. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  13. Hepatitis C and Incarceration (United States)

    ... It is also the most common type in jails and prisons. What is Hepatitis C? Hepatitis C is a ... risk for Hepatitis C because many people in jails or prisons already have Hepatitis C. • The most ...

  14. Comparative Study of C, C++, C# and Java Programming Languages


    Chen, Hao


    With the rapid development of software industry, more and more people want to learn programming languages. But nowadays there are more than 200 programming languages available, only a few of them can be applied comparatively widely. In this thesis, the research in programming language was conducted. Four of the most popular programming languages C, C++, C# and Java are chosen to be the objects to study. The technical features of these four programming languages were summarized and compar...

  15. Accelerated C# 2010

    CERN Document Server

    Nash, Trey


    C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

  16. Parallel C/C++: Convergence or divergence?

    Energy Technology Data Exchange (ETDEWEB)

    Stanberry, L. [Lawrence Livermore National Lab., CA (United States)


    C has been noted for its wide portability. C++ is touted as the next generation C. Both languages, however, have multiple proposals for parallel extensions. For C, this includes two different ANSI sponsored efforts, X3H5 and X3J11.1. Since C++ is itself in the throes of standardization, parallel C++ proposals are finding their audience among MPP vendors and C++ users in an ARPA-sponsored HPC++ consortium. The number of proposals is large and still growing, and questions arise of whether and how these proposals can converge in order to extend/preserve/protect the investment of the user community. In this panel the authors will bring together representatives from the ANSI committees, MPP vendors, and from independent research efforts to discuss the motivation for their respective proposals, to determine the interoperability of the proposals, and to argue for or against merging of proposals for a standard.

  17. Hemoglobin C disease (United States)

    Clinical hemoglobin C ... Hemoglobin C is an abnormal type of hemoglobin, the protein in red blood cells that carries oxygen. It is ... Americans. You are more likely to have hemoglobin C disease if someone in your family has had ...

  18. Dicty_cDB: VHI580 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available asvsiiacitiitsitimsgita* *c*c*srstyctcstcrlmviatccncncc*cwfwrtcassisivasitgititsitiva citiititsitsitsitvitsi...NCNCX*cwgwvslcclhfpllplfta**g* c*srstsctcstcrlmvitascncnccqcwfw*tcaasvsiiacitiitsitimsgita* *c*c*srstyctcstcrlmviatccncncc*cwfwrtcass...isivasitgititsitiva citiititsitsitsitvitsitiitsitiitsitsitiitsitiitsitittsitiaii ti

  19. C and C* among intermediate rings

    NARCIS (Netherlands)

    J. Sack; S. Watson


    Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA, exte

  20. Photosynthesis of C3, C3-C4, and C4 grasses at glacial CO2. (United States)

    Pinto, Harshini; Sharwood, Robert E; Tissue, David T; Ghannoum, Oula


    Most physiology comparisons of C3 and C4 plants are made under current or elevated concentrations of atmospheric CO2 which do not reflect the low CO2 environment under which C4 photosynthesis has evolved. Accordingly, photosynthetic nitrogen (PNUE) and water (PWUE) use efficiency, and the activity of the photosynthetic carboxylases [Rubisco and phosphoenolpyruvate carboxylase (PEPC)] and decarboxylases [NADP-malic enzyme (NADP-ME) and phosphoenolpyruvate carboxykinase (PEP-CK)] were compared in eight C4 grasses with NAD-ME, PCK, and NADP-ME subtypes, one C3 grass, and one C3-C4 grass grown under ambient (400 μl l(-1)) and glacial (180 μl l(-1)) CO2. Glacial CO2 caused a smaller reduction of photosynthesis and a greater increase of stomatal conductance in C4 relative to C3 and C3-C4 species. Panicum bisulcatum (C3) acclimated to glacial [CO2] by doubling Rubisco activity, while Rubisco was unchanged in Panicum milioides (C3-C4), possibly due to its high leaf N and Rubisco contents. Glacial CO2 up-regulated Rubisco and PEPC activities in concert for several C4 grasses, while NADP-ME and PEP-CK activities were unchanged, reflecting the high control exerted by the carboxylases relative to the decarboxylases on the efficiency of C4 metabolism. Despite having larger stomatal conductance at glacial CO2, C4 species maintained greater PWUE and PNUE relative to C3-C4 and C3 species due to higher photosynthetic rates. Relative to other C4 subtypes, NAD-ME and PEP-CK grasses had the highest PWUE and PNUE, respectively; relative to C3, the C3-C4 grass had higher PWUE and similar PNUE at glacial CO2. Biomass accumulation was reduced by glacial CO2 in the C3 grass relative to the C3-C4 grass, while biomass was less reduced in NAD-ME grasses compared with NADP-ME and PCK grasses. Under glacial CO2, high resource use efficiency offers a key evolutionary advantage for the transition from C3 to C4 photosynthesis in water- and nutrient-limited environments.

  1. Visual C++与C++Builder的比较%Comparison of Visual C++ and C++ Builder

    Institute of Scientific and Technical Information of China (English)



    C++Builder和Visual C++是目前比较流行的面向对象的程序设计语言,从应用程序框架、易用性、可移植性、应用前景等方面对C++Builder和Visual C++进行了对比分析.

  2. Restructuring C Programs into C++ Programs

    Institute of Scientific and Technical Information of China (English)


    There exist a lot of legacy systems written in C language, whichare di fficult to understand, modify, maintain and reuse. How to improve the quality of these non object-oriented systems has become an important issue in software en g ineering area. A possible way is to transform these procedural systems into sema ntically equivalent object-oriented systems implemented in C++ language, which p rovides object-oriented features such as data abstraction, inheritance and poly m orphism, makes software system more comprehensible, maintainable and reusable. A detailed discussion on polymorphism analysis, object discovery and possible inheritance relation extraction on C-to-C++ conversion problem i s made, wh ich is also suitable to the transformation on legacy systems implemented in othe r procedural languages to equivalent object-oriented systems.

  3. C++ Programming Language (United States)

    Shaykhian, Gholam Ali


    C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.

  4. C++ for dummies

    CERN Document Server

    Davis , Stephen R


    The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new

  5. Objective-C

    CERN Document Server

    DeVoe, Jiva


    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  6. Valence neutrons' role in the collisions 13C+12C and 13C+13C

    International Nuclear Information System (INIS)

    The resonant behaviour is not limited to collisions between α-like nuclei: resonance structures have been observed in the direct channels for the 13C+12C and 13C+13C collisions; in the contrary, the resonances observed in the fusion channels are not so pronounced as in the 12C+12C case: the valence neutrons increase the number of reaction channels and the density of states in the states in the compound nuclei, the resonances are therefore 'washed out' and it is difficult to observe them experimentally

  7. Practical C++ Programming

    CERN Document Server

    Oualline, Steve


    C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th

  8. Exploring C++ 11

    CERN Document Server

    Lischner, Ray


    Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat

  9. Testing of DLR C/C-SiC and C/C for HIFiRE 8 Scramjet Combustor (United States)

    Glass, David E.; Capriotti, Diego P.; Reimer, Thomas; Kutemeyer, Marius; Smart, Michael K.


    Ceramic Matrix Composites (CMCs) have been proposed for use as lightweight hot structures in scramjet combustors. Previous studies have calculated significant weight savings by utilizing CMCs (active and passive) versus actively cooled metallic scramjet structures. Both a carbon/carbon (C/C) and a carbon/carbon-silicon carbide (C/C-SiC) material fabricated by DLR (Stuttgart, Germany) are being considered for use in a passively cooled combustor design for Hypersonic International Flight Research Experimentation (HIFiRE) 8, a joint Australia / Air Force Research Laboratory hypersonic flight program, expected to fly at Mach 7 for approximately 30 sec, at a dynamic pressure of 55 kilopascals. Flat panels of the DLR C/C and C/C-SiC materials were installed downstream of a hydrogen-fueled, dual-mode scramjet combustor and tested for several minutes at conditions simulating flight at Mach 5 and Mach 6. Gaseous hydrogen fuel was used to fuel the scramjet combustor. The test panels were instrumented with embedded Type K and Type S thermocouples. Zirconia felt insulation was used during some of the tests to reduce heat loss from the back surface and thus increase the heated surface temperature of the C/C-SiC panel approximately 177 C (350 F). The final C/C-SiC panel was tested for three cycles totaling over 135 sec at Mach 6 enthalpy. Slightly more erosion was observed on the C/C panel than the C/C-SiC panels, but both material systems demonstrated acceptable recession performance for the HIFiRE 8 flight.

  10. A1C test (United States)

    HbA1C test; Glycated hemoglobin test; Glycosylated hemoglobin test; Hemoglobin glycosylated test; Glycohemoglobin test ... have recently eaten does not affect the A1C test, so you do not need to fast to ...

  11. Hepatitis C FAQs (United States)

    ... State and Local Partners & Grantees Resource Center Hepatitis C FAQs for the Public Recommend on Facebook Tweet ... URL - Redirecting ... Quick Links to Hepatitis ... A | B | C | D | E Viral Hepatitis Home Statistics & Surveillance Populations & ...

  12. Stool C. difficile toxin (United States)

    ... page: // Stool C. difficile toxin To use the sharing features on this page, please enable JavaScript. The stool C. difficile toxin test detects harmful substances produced by ...

  13. Cryptococcosis (C. neoformans) (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. neoformans Infection Recommend on Facebook Tweet Share Compartir ... throughout the world. People can become infected with C. neoformans after breathing in the microscopic fungus, although ...

  14. SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures Project (United States)

    National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

  15. Oxidation Behavior of C/C-SiC Gradient Matrix Composites

    Institute of Scientific and Technical Information of China (English)


    Oxidation behavior of C/C-SiC gradient matrix composites and C/C composites were compared in stationary air. The results show that oxidation threshold of C-SiC materials increases with the amount of SiC particles in the codeposition matrix. Oxidation rate of C/C-SiC gradient matrix composites is significantly lower than that of C/C material. The micro-oxidation process was observed by SEM.

  16. Large N_c


    Jenkins, Elizabeth E.


    The 1/N_c expansion of QCD with N_c=3 has been successful in explaining a wide variety of QCD phenomenology. Here I focus on the contracted spin-flavor symmetry of baryons in the large-N_c limit and deviations from spin-flavor symmetry due to corrections suppressed by powers of 1/N_c. Baryon masses provide an important example of the 1/N_c expansion, and successful predictions of masses of heavy-quark baryons continue to be tested by experiment. The ground state charmed baryon masses have all...

  17. Complement C3


    Dinasarapu, Ashok Reddy; Chandrasekhar, Anjana; Sahu, Arvind; Subramaniam, Shankar


    Complement C3 is the central component of the human complement system. It is ~186 kDa in size, consisting of an α-chain (~110 kDa) and a β-chain (~75 kDa) that are connected by cysteine bridges. C3 in its native form is inactive. Cleavage of C3 into C3b (~177 kDa) and C3a (~9 kDa) is a crucial step in the complement activation cascade, which can be initiated by one or more of the three distinct pathways, called alternative, classical and lectin complement pathways. In the alternative pathway,...

  18. Using C-Kermit

    CERN Document Server

    da Cruz, Frank


    An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced

  19. Head first C#

    CERN Document Server

    Stellman, Andrew


    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  20. Perspective study: governance for C2C

    NARCIS (Netherlands)

    Hovelynck, J.; Dewulf, A.; Sips, K.


    This perspective study will serve as frame of reference for follow-up activities and exchanges both within and outside the Cradle to Cradle Network (C2CN) and it aims to reflect the current challenges and opportunities associated with implementing a Cradle to Cradle approach. In total, four perspect

  1. Dicty_cDB: SHB736 [Dicty_cDB

    Lifescience Database Archive (English)


  2. Microstructure and Oxidation Behavior of CNT/PyC/SiC Coating on C/C Composite Material


    Mizuki, Hironori; Sano, Hideaki; Zheng, Guo-Bin; Uchiyama, Yasuo


    CNT/PyC/SiC coating were prepared by direct growth of CNTs on C/C followed by deposition of PyC (pyrolytic carbon) and SiC. It is found that the coating consisted of two layers; the CNT/PyC/SiC layer and SiC layer. The oxidation resistance of C/C was improved by the coating, which had much fewer cracks and better thermal-shock resistance.

  3. Parylene C Aging Studies.

    Energy Technology Data Exchange (ETDEWEB)

    Achyuthan, Komandoor; Sawyer, Patricia Sue.; Mata, Guillermo Adrian; White II, Gregory Von; Bernstein, Robert


    Parylene C is used in a device because of its conformable deposition and other advantages. Techniques to study Parylene C aging were developed, and "lessons learned" that could be utilized for future studies are the result of this initial study. Differential Scanning Calorimetry yielded temperature ranges for Parylene C aging as well as post-deposition treatment. Post-deposition techniques are suggested to improve Parylene C performance. Sample preparation was critical to aging regimen. Short-term (%7E40 days) aging experiments with free standing and ceramic-supported Parylene C films highlighted "lessons learned" which stressed further investigations in order to refine sample preparation (film thickness, single sided uniform coating, machine versus laser cutting, annealing time, temperature) and testing issues ("necking") for robust accelerated aging of Parylene C.

  4. Properties of c meson

    Indian Academy of Sciences (India)

    Ajay Kumar Rai; P C Vinodkumar


    The mass spectrum of $c\\bar{b}$ meson is investigated with an effective quark-antiquark potential of the form $\\dfrac{-_{c}}{r} + Ar^{}$ with varying from 0.5 to 2.0. The and -wave masses, pseudoscalar decay constant, weak decay partial widths in spectator model and the lifetime of c meson are computed. The properties calculated here are found to be in good agreement with other theoretical and experimental values at potential index, = 1.

  5. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor;


    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the ...

  6. Programming C# 30

    CERN Document Server

    Liberty, Jesse


    This thoroughly updated tutorial for beginning to intermediate programmers covers C# 3.0 and the newest .NET platform for developing Windows and web applications. Now in its fifth edition, our bestselling Programming C# 3.0 teaches the essentials of the C# and the .NET Framework Class Libraries, and explains how to use these tools to create applications for Windows, as well as for the Web.

  7. Scurvy and Vitamin C


    Mayberry, Jason A.


    This paper outlines the history of scurvy and vitamin C. The first section of the paper outlines the science of vitamin C. The second discusses outlines the medical progression of vitamin C deficiency and scurvy. The third section gives a brief timeline of scurvy throughout human history. The fourth section discusses the conditions during the age of sail that combined to make scurvy the greatest killer of sailors. The final section follows the scientific drive to find a cure and eventual elim...

  8. Programming C# 40

    CERN Document Server

    Griffiths, Ian; Liberty, Jesse


    With its support for dynamic programming, C# 4.0 continues to evolve as a versatile language on its own. But when C# is used with .NET Framework 4, the combination is incredibly powerful. This bestselling tutorial shows you how to build web, desktop, and rich Internet applications using C# 4.0 with .NET's database capabilities, UI framework (WPF), extensive communication services (WCF), and more. In this sixth edition, .NET experts Ian Griffiths, Matthew Adams, and Jesse Liberty cover the latest enhancements to C#, as well as the fundamentals of both the language and framework. You'll learn

  9. Learning Boost C++ libraries

    CERN Document Server

    Mukherjee, Arindam


    If you are a C++ programmer who has never used Boost libraries before, this book will get you up-to-speed with using them. Whether you are developing new C++ software or maintaining existing code written using Boost libraries, this hands-on introduction will help you decide on the right library and techniques to solve your practical programming problems.

  10. Thermoelectric properties of porous SiC/C composites

    NARCIS (Netherlands)

    Fujisawa, Masashi; Hata, Toshimitsu; Kitagawa, Hiroyuki; Bronsveld, Paul; Suzuki, Youki; Hasezaki, Kazuhiro; Noda, Yasutoshi; Imamura, Yuji


    We developed a porous SiC/C composite by oxidizing a SiC/C composite made from a mixed powder of wood charcoal and SiO2 (32-45 mu m) by pulse current sintering at 1600 and 1800 degrees C under a N-2 atmosphere. The microstructures of the porous SiC/C composites with oxidation and the SiC/C composite

  11. C. elegans TRP channels. (United States)

    Xiao, Rui; Xu, X Z Shawn


    Transient receptor potential (TRP) channels represent a superfamily of cation channels found in all eukaryotes. The C. elegans genome encodes seventeen TRP channels covering all of the seven TRP subfamilies. Genetic analyses in C. elegans have implicated TRP channels in a wide spectrum of behavioral and physiological processes, ranging from sensory transduction (e.g. chemosensation, touch sensation, proprioception and osmosensation) to fertilization, drug dependence, organelle biogenesis, apoptosis, gene expression, and neurotransmitter/hormone release. Many C. elegans TRP channels share similar activation and regulatory mechanisms with their vertebrate counterparts. Studies in C. elegans have also revealed some previously unrecognized functions and regulatory mechanisms of TRP channels. C. elegans represents an excellent genetic model organism for the study of function and regulation of TRP channels in vivo. PMID:21290304

  12. Dicty_cDB: SSB832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnments: (bits) Value N ( C94506 ) Dictyostelium discoideum slug cDNA, clone SSL114. 377 e-111 2 ( C89831 ) ...Dictyostelium discoideum slug cDNA, clone SSG211. 377 e-111 2 ( AU038639 ) Dictyostelium discoideum slug cDN...A, clone SSL286. 377 e-111 2 ( C93164 ) Dictyostelium discoideum slug cDNA, clone... SSM728. 377 e-111 2 ( C92937 ) Dictyostelium discoideum slug cDNA, clone SSF118. 377 e-111 2 ( AU034859 ) D...ictyostelium discoideum slug cDNA, clone SLE606. 377 e-111 2 ( C94177 ) Dictyostelium discoideum slug cDNA,

  13. Dicty_cDB: SSB514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N ( AU037133 ) Dictyostelium discoideum slug cDNA, clone SSB514. 159 4e-55 3 ( C93995 ) Dictyostelium discoideum slug... cDNA, clone SSK677. 159 1e-54 3 ( C90543 ) Dictyostelium discoideum slug cDNA, clone SSI703.... 159 1e-54 3 ( C94442 ) Dictyostelium discoideum slug cDNA, clone SSK808. 159 2e-54 3 ( C92716 ) Dictyostelium discoideum slug... cDNA, clone SSF896. 159 2e-54 3 ( AU037609 ) Dictyostelium discoideum slug... cDNA, clone SSD849. 159 2e-54 3 ( C91229 ) Dictyostelium discoideum slug cDNA, clone SSJ846. 1

  14. Dicty_cDB: SSA702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kv*kknkk**kikkk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*rc sssilrvnpshsyatlsnv*AVFNKKKYLKK--- ---SMYRYCSVC... Frame C: kv*kknkk**kikkk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*rc sssilrvnpshsyatlsnv*AVFNKKKYLKK--- --

  15. Effect of HfC on the ablative and mechanical properties of C/C composites

    International Nuclear Information System (INIS)

    The ablation and mechanical behavior of the carbon/carbon (C/C) and hafnium carbide (HfC) modified C/C (HfC-C/C) composites were evaluated by oxyacetylene flame and the three-point bending tests. The effect of impact damage on their mechanical behavior was also investigated. To produce the HfC-C/C composites, the refractory carbide precursor was introduced to the preforms by impregnating with HfOCl2.8H2O solution. Both the C/C and the HfC-C/C preforms were densified by thermal gradient chemical vapor infiltration. Results indicated that, although the linear and mass ablation rates exhibited by the HfC-C/C composites were lower than those for the C/C composites by 55% and 21%, respectively, the maximum flexural load for the C/C composites was significantly higher by 33% than that of HfC-C/C composites. The influence of pre-impact loading on mechanical behavior was greater for the HfC-C/C composites than for the C/C composites.

  16. Head first C#

    CERN Document Server

    Stellman, Andrew


    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  17. C++ multithreading cookbook

    CERN Document Server

    Ljumovic, Milos


    The book is an easy-to-follow guide for creating multi-threaded applications using C++. Each topic is thoroughly explained with multiple illustrations. Many algorithms, such as Dinning Philosophers Problem give you thorough explanations that will help you to understand and solve concurrent tasks. The book is intended for enterprise developers and programmers who wish to make use of C++ capabilities to learn the multithreaded approach. Knowledge of multithreading along with experience in C++ is an added advantage. However it is not a prerequisite.

  18. Practical C programming

    CERN Document Server

    Oualline, Steve


    There are lots of introductory C books, but this is the first one that has the no-nonsense, practical approach that has made Nutshell Handbooks® famous. C programming is more than just getting the syntax right. Style and debugging also play a tremendous part in creating programs that run well and are easy to maintain. This book teaches you not only the mechanics of programming, but also describes how to create programs that are easy to read, debug, and update. Practical rules are stressed. For example, there are fifteen precedence rules in C (&& comes before || comes before ?:). The practi

  19. Dicty_cDB: VSD473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vcvikgekvngvvkftqenkdspvtvnyditglekgehgfhvhafgd ttngcvsagphfnpfgknhgapsdedrhvgdlgnivadgesntkgtisdkiislfgeh...rame C: eqqqinnkmsktavcvikgekvngvvkftqenkdspvtvnyditglekgehgfhvhafgd ttngcvsagphfnpfgknhgapsdedrhvgdlgnivadgesntkgtisdkiislfgeht

  20. Dicty_cDB: SLE291 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value N ( AU061448 ) Dictyostelium discoideum slug cDNA, clone S...LE291. 412 e-121 2 ( C90755 ) Dictyostelium discoideum slug cDNA, clone SSJ111. 385 e-113 2 ( C94506 ) Dictyostelium discoideum slug... cDNA, clone SSL114. 377 e-111 2 ( C89831 ) Dictyostelium discoideum slug... cDNA, clone SSG211. 377 e-111 2 ( AU038639 ) Dictyostelium discoideum slug cDNA, clone SSL2...86. 377 e-111 2 ( C93164 ) Dictyostelium discoideum slug cDNA, clone SSM728. 377 e-111 2 ( C92937 ) Dictyostelium discoideum slug

  1. Dicty_cDB: SSM514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clsppllcitllklr*srapltmllkypqg*sitflcnslkcissl*QKKI FKKKKKRKKKNIKIFFLKSILNINNNVFFFFIKKRKKKRKKKKKRKKEFKKKK Frame C: ---ls*c*gvslplcfal...lssssdnlelh*rcsssilrvnpshsyatlsnv*avfnkkky lkkkkkekkkilk

  2. Parallelization in Modern C++

    CERN Document Server

    CERN. Geneva


    The traditionally used and well established parallel programming models OpenMP and MPI are both targeting lower level parallelism and are meant to be as language agnostic as possible. For a long time, those models were the only widely available portable options for developing parallel C++ applications beyond using plain threads. This has strongly limited the optimization capabilities of compilers, has inhibited extensibility and genericity, and has restricted the use of those models together with other, modern higher level abstractions introduced by the C++11 and C++14 standards. The recent revival of interest in the industry and wider community for the C++ language has also spurred a remarkable amount of standardization proposals and technical specifications being developed. Those efforts however have so far failed to build a vision on how to seamlessly integrate various types of parallelism, such as iterative parallel execution, task-based parallelism, asynchronous many-task execution flows, continuation s...

  3. A1C Test (United States)

    ... to minimize the complications caused by chronically elevated glucose levels, such as progressive damage to body organs like the kidneys, eyes, cardiovascular system, and nerves. The A1c test result ...

  4. C. difficile Infection (United States)

    ... include fever and abdominal distension and/or tenderness. Screening/Diagnosis C. difficile infection requires documenting the presence ... First, it would be ideal to stop the antibiotic that led to the infection in the first ...

  5. Cryptococcosis (C. gattii) (United States)

    ... Zoonotic Infectious Disease Division of Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. gattii Infection Recommend on ... Zoonotic Infectious Disease Division of Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch File Formats Help: How do ...


    U.S. Environmental Protection Agency — LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for...

  7. Beginning Objective-C

    CERN Document Server

    Dovey, James


    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  8. D and C - slideshow (United States)

    ... this page: // D and C - series—Normal anatomy To use the ... Update Date 6/11/2014 Updated by: Cynthia D. White, MD, Fellow American College of Obstetricians and ...

  9. Introduction to C

    DEFF Research Database (Denmark)

    Albertsen, Niels Christian


    The principles of C are very much like those of PASCAL, although the syntax differs slightly. The programs are entered in free format, which the programmer may utilise to make the text reader-friendly, and every sentence is ended with a semicolon. Comments can be entered at any point by enclosing...... them in /* and */. e.g.: /* a comment */. Note that the C compiler is case sensitive. A C program may consist of several program segments. One of them must be the main program, the rest are denoted functions. In contrast to PASCAL the concept procedure does not exist. Every segment starts with a number...... this extra complication, we will in the following consider only C programs contained in a single file....

  10. C++ Crash Course


    Rougier, Nicolas,


    1 Foreword 2 From C to C++ 2.1 Input/Output 2.2 New/Delete 2.3 References 2.4 Default parameters 2.5 Namespaces 2.6 Overloading 2.7 Const & inline 2.8 Mixing C and C++ 2.9 Exercises 3 Classes 3.1 Constructors 3.2 Destructor 3.3 Access control 3.4 Initialization list 3.5 Operator overloading 3.6 Friends 3.7 Exercices 4 Inheritance 4.1 Basics 4.2 Virtual methods 4.3 Abstract classes 4.4 Multiple inheritance 4.5 Exercices 5 Exceptions 5.1 The Zen of Python 5.2 Catch me if you can 5.3 Creating yo...

  11. SiC Technology (United States)

    Neudeck, Philip G.


    Silicon carbide (SiC)-based semiconductor electronic devices and circuits are presently being developed for use in high-temperature, high-power, and/or high-radiation conditions under which conventional semiconductors cannot adequately perform. Silicon carbide's ability to function under such extreme conditions is expected to enable significant improvements to a far-ranging variety of applications and systems. These range from greatly improved high-voltage switching [1- 4] for energy savings in public electric power distribution and electric motor drives to more powerful microwave electronics for radar and communications [5-7] to sensors and controls for cleaner-burning more fuel-efficient jet aircraft and automobile engines. In the particular area of power devices, theoretical appraisals have indicated that SiC power MOSFET's and diode rectifiers would operate over higher voltage and temperature ranges, have superior switching characteristics, and yet have die sizes nearly 20 times smaller than correspondingly rated silicon-based devices [8]. However, these tremendous theoretical advantages have yet to be realized in experimental SiC devices, primarily due to the fact that SiC's relatively immature crystal growth and device fabrication technologies are not yet sufficiently developed to the degree required for reliable incorporation into most electronic systems [9]. This chapter briefly surveys the SiC semiconductor electronics technology. In particular, the differences (both good and bad) between SiC electronics technology and well-known silicon VLSI technology are highlighted. Projected performance benefits of SiC electronics are highlighted for several large-scale applications. Key crystal growth and device-fabrication issues that presently limit the performance and capability of high temperature and/or high power SiC electronics are identified.

  12. 8C.02

    DEFF Research Database (Denmark)

    Jensen, B L; Frederiksen-Moller, B; Jorgensen, J S;


    OBJECTIVE: The serine protease prostasin (PRSS8, CAP1) and its activator matriptase and inhibitor nexin-1 are necessary for normal placental development in mice. Prostasin is regulated by aldosterone in the kidney and may activate the epithelial sodium channel (ENaC). Preeclampsia is characterized...... to renal EnaC activation and suppression of aldosterone in preeclampsia. Potential impact of prostasin-matriptase on placental development is likely to be at the level of activity and not protein abundance....

  13. H.C. Andersen

    DEFF Research Database (Denmark)

    Nissen, Mogens Rostgaard


    "Mit Liv er et smukt Eventyr, saa rigt og lyksaligt!" Sådan beskrev H.C. Andersens sit eget liv. Det overgik næsten indholdet af hans egne eventyr. Født i fattigdom og social nød, men kæmpede sig op og døde berømt og feteret 70 år senere. H.C. Andersen er Danmarks bedst kendte forfatter. Især hans...

  14. C# 30 Design Patterns

    CERN Document Server

    Bishop, Judith


    Want to speed up the development of your .NET applications? Tackle common programming problems with C# design patterns. This guide explains what design patterns are and why they're used, with tables and guidelines to help you choose one pattern over another, and plenty of case studies to illustrate how each pattern is used in practice. C# 3.0 features are introduced by example and summarized for easy reference.

  15. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts


    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  16. Dicty_cDB: SFL120 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...E800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR...|AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to ...1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O65744 GDP DISSOC...IATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  17. Dicty_cDB: SSB187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3346.1 sm70g01.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-9289 5' similar to TR:Q4...m-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-1456 5' similar to TR:Q40203 Q40203 RAB1C. ...;, mRNA sequence. 50 4e-14 3 BG047357 |BG047357.1 saa83d10.y1 Gm-c1063 Glycine max cDNA clone GENOME SYSTEMS...m-c1086 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1431 5' similar ... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1041-929 5' similar to TR:Q40203 Q40203 RAB1C. ;, mRNA sequence

  18. Dicty_cDB: AFH224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficant alignments: (bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS... CLONEINHIBITOR. ;, mRNA sequence. 56 5e-06 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS... BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS C... 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5'...04 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212

  19. Dicty_cDB: CFH888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c10...800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:...AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to T...078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O65744 GDP DISSOCI...ATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  20. Dicty_cDB: SLC296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available producing significant alignments: (bits) Value N ( C84710 ) Dictyostelium discoideum slug cDNA, clone SSE70...5. 642 0.0 2 ( AU051981 ) Dictyostelium discoideum slug cDNA, clone SSC841. 642 0....0 2 ( AU034232 ) Dictyostelium discoideum slug cDNA, clone SLC296. 642 0.0 2 ( C92664 ) Dictyostelium discoideum slug... cDNA, clone SSF805. 642 0.0 2 ( AU038147 ) Dictyostelium discoideum slug cDNA, clone SSH330. 642 ...0.0 2 ( C93278 ) Dictyostelium discoideum slug cDNA, clone SSM516. 642 0.0 2 ( C9

  1. Dicty_cDB: SLC487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N ( AU034567 ) Dictyostelium discoideum slug cD...NA, clone SLC487. 359 0.0 2 ( C92009 ) Dictyostelium discoideum slug cDNA, clone SSC771. 359 0.0 2 ( AU03457...0 ) Dictyostelium discoideum slug cDNA, clone SLC492. 359 0.0 2 ( AU034140 ) Dictyostelium discoideum slug c...DNA, clone SLB789. 359 0.0 2 ( C89745 ) Dictyostelium discoideum slug cDNA, clone... SSG743. 359 0.0 2 ( C90200 ) Dictyostelium discoideum slug cDNA, clone SSI241. 359 0.0 2 ( C94225 ) Dictyostelium discoideum slug

  2. Dicty_cDB: SSB358 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N ( C84233 ) Dictyostelium discoideum slug cDNA, clone SS...B358. 375 e-159 2 ( C92151 ) Dictyostelium discoideum slug cDNA, clone SSD151. 367 e-157 2 ( AU037833 ) Dictyostelium discoideum slug... cDNA, clone SSE351. 367 e-157 2 ( AU037479 ) Dictyostelium discoideum slug... cDNA, clone SSD685. 367 e-157 2 ( C91216 ) Dictyostelium discoideum slug cDNA, clone SSJ...829. 361 e-153 2 ( C90895 ) Dictyostelium discoideum slug cDNA, clone SSJ279. 220 e-146 3 ( AU037158 ) Dictyostelium discoideum slug

  3. Dicty_cDB: VFD504 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW703806.1 sk13a02.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-3939 5' similar to ...9.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-2802 5' similar to SW:ASPR_CUCPE O040... 1.9 1 BG404959 |BG404959.1 sac46c02.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1062-28

  4. Dicty_cDB: VFC328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W705505 |AW705505.1 sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mR...NA sequence. 46 0.40 1 AI900122 |AI900122.1 sc01b07.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ...2.1 sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-6285 5', mRNA sequence. 46 ...0.40 1 AW705268 |AW705268.1 sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS... Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA

  5. Dicty_cDB: CHE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available f75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 ... sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O...HIBITOR. ;, mRNA sequence. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS.... 62 8e-06 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...ce. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-

  6. Dicty_cDB: AFI337 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O6...4 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 GDI2. ;, mRNA...ion inhibitor (gdi). 38 9e-06 3 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...05 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 ... sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-262

  7. Dicty_cDB: SFI510 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i). 38 3e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...uence. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...9 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:... |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar t...Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar

  8. Dicty_cDB: AFI273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r (gdi). 38 9e-10 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...A sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ...RNA sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLON...15670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' simi...9.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' si

  9. Dicty_cDB: CHD702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:INHIBITOR. ;, mRNA sequence. 54 0.002 1 AW397479 |AW3...97479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...I315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to T...c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to...06227 |AW306227.1 se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' simil

  10. Interstellar C60+

    CERN Document Server

    Berne, Olivier; Joblin, Christine


    Buckminsterfullerene (C60) was recently detected through its infrared emission bands in the interstellar medium (ISM), including in the proximity of massive stars, where physical conditions could favor the formation of the cationic form, C60+. In addition, C60+ was proposed as the carrier of two diffuse interstellar bands in the near-IR, although a firm identification still awaits for gas-phase spectroscopic data. We examined in details the Spitzer IRS spectra of the NGC 7023 reflection nebula, at a position close (7.5") to the illuminating B star HD 200775, and found four previously unreported bands at 6.4, 7.1, 8.2 and 10.5 \\mu m in addition to the classical bands attributed to Polycylic Aromatic Hydrocarbons (PAHs) and neutral C60. These 4 bands are observed only in this region of the nebula, while C60 emission is still present slightly further away from the star, and PAH emission even further away. Based on this observation, on theoretical calculations we perform, and on laboratory studies, we attribute t...

  11. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    J.C. Christensen var kun regeringsleder i tre år, men i en lille menneskealder kunne stort set intet ske i dansk politik uden om ham. I et kvart århundrede var han et magtcentrum. Centralt i J.C. Christensens politiske virke i årene 1890-1924 stod kampen for det parlamentariske folkestyre....... Parlamentarismen har lige siden udgjort fundamentet for vores styreform, og dens fortsatte betydning og grundlovsfæstede status gør den til den betydeligste arv, J.C. Christensen har efterladt sig. Men hvem var J.C. Christensen egentlig? Han satte sit afgørende fingeraftryk på indførelsen af kvindelig valgret......, stiftelsen af Det Radikale Venstre og Venstre, tilblivelsen af det norske kongehus, Albertiaffæren, salget af De Vestindiske Øer, Påskekrisen og genforeningen med Sønderjylland. Nu har J.C. Christensens efterkommere for første gang givet adgang til hans efterladte dagbøger og breve. Det har gjort det muligt...

  12. Dicty_cDB: VSE884 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone PP095G12 similar to RAS RELATED PROTEIN RAB7. 68 6e-08 1 AW290476 |AW290476.1 NXNV027C10F Nsf Xylem Normal wood Vertical...27C10 Nsf Xylem Normal wood Vertical Pinus taeda cDNA clone NXNV027C10 5' similar... |CD018114.1 NXLV_002_C09_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV_002_C09 5' simil

  13. Dicty_cDB: VHJ558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ificant alignments: (bits) Value N ( BJ442636 ) Dictyostelium discoideum cDNA clone:ddv50c15, 3' ... 1296 0.... ) Dictyostelium discoideum cDNA clone:ddv50k22, 3' ... 1219 0.0 2 ( BJ441840 ) Dictyostelium discoideum cDN...deum cDNA clone:dda54e23, 3' ... 1211 0.0 2 ( BJ423817 ) Dictyostelium discoideum cDNA clone:ddv50c15, 5' ..

  14. Practical C++ financial programming

    CERN Document Server

    Oliveira, Carlos


    Practical C++ Financial Programming is a hands-on book for programmers wanting to apply C++ to programming problems in the financial industry. The book explains those aspects of the language that are more frequently used in writing financial software, including the STL, templates, and various numerical libraries. The book also describes many of the important problems in financial engineering that are part of the day-to-day work of financial programmers in large investment banks and hedge funds. The author has extensive experience in the New York City financial industry that is now distilled in

  15. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M


    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  16. Hepatitis C in India

    Indian Academy of Sciences (India)

    Ashis Mukhopadhya


    Hepatitis C is an emerging infection in India and an important pathogen causing liver disease in India. The high risk of chronicity of this blood-borne infection and its association with hepatocellular carcinoma underscores its public health importance. Blood transfusion and unsafe therapeutic interventions by infected needles are two preventable modalities of spread of hepatitis C infection. In addition, risk factor modification by reducing the number of intravenous drug users will help curtail the prevalence of this infection. This review summarizes the extent, nature and implications of this relatively new pathogen in causing disease in India.

  17. Dicty_cDB: SSD420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TOR. ;, mRNA sequence. 62 5e-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...79.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007...0797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O6...64 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR...IBITOR. ;, mRNA sequence. 44 1e-05 3 BI426472 |BI426472.1 sag03f09.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS

  18. Dicty_cDB: SFJ116 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 62 1e-05 1 AI437629 |AI437629.1 sa37e...09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 ...R. ;, mRNA sequence. 62 1e-05 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...e-05 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS... 1e-05 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-

  19. Dicty_cDB: SSL425 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-888 5' similar t...42 3e-05 2 BM094849 |BM094849.1 saj22d08.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS...11983 |BE611983.1 sr02d07.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1478 5' simil...16219 |BI316219.1 saf62g05.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLON...5.1 sah72f05.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-4089 5' similar to TR:Q402

  20. Dicty_cDB: SFL479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O657...4653 GDI2. ;, mRNA sequence. 62 5e-08 2 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...nce. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...uence. 62 5e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O2

  1. Dicty_cDB: SFH229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nd,single read. 1013 0.0 1 AW395348 |AW395348.1 sh46h12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS...27021.1 sae30b10.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-4292 5' similar to TR:...6 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1674 5' similar to TR:...Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1080-173 5' similar to TR:Q9XHH0 Q9XHH0 ACETOAC...-c1056 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1056-1716 5' similar to TR:Q9XHH0 Q9XHH0 ACETOACE

  2. Dicty_cDB: AFI123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE...INHIBITOR. ;, mRNA sequence. 62 1e-05 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm... |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to...Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar

  3. Dicty_cDB: SFD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 90353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:...049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to T...c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSO...TION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  4. Dicty_cDB: AFN814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence. 38 3e-08 4 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317...1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-51... BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5'

  5. Dicty_cDB: SFA692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , mRNA sequence. 36 0.013 2 BI320995 |BI320995.1 saf23h06.y3 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS ...42d11.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1062-2494 5...m-c1018 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1018-391 5' similar to TR:O74224 O74224 SONA. ;,... mRNA sequence. 48 0.063 1 BI894072 |BI894072.1 sai59g03.y1 Gm-c1068 Glycine max cDNA clone GENOME SYSTEMS C...uence. 48 0.063 1 BE191388 |BE191388.1 sn71h11.y1 Gm-c1038 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G

  6. Dicty_cDB: CHB577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS... INHIBITOR. ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...nce. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...|AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to

  7. Dicty_cDB: AFE576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar....1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...35.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9Z...e chromosome IV reading frame ORF YDL084w. 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  8. Dicty_cDB: CHQ518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-7762 5' similar to TR:Q9XEU0 Q9XEU0 ZINC-FI...66 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-1230 5' similar to TR:Q9XEU0 Q9XEU0 ZINC-FINGER ...sequence. 42 5.5 1 BE023156 |BE023156.1 sm79a08.y1 Gm-c1015 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: ...U090925 |BU090925.1 su09e03.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-990 5' simi...-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-1066 5' similar t

  9. Dicty_cDB: CFC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' sim...12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 ...9d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O6574...cima018l21, 5'end, single read. 46 7e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...quence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  10. Dicty_cDB: SLA533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N ( AU060184 ) Dictyostelium discoideum slu...g cDNA, clone SLA533. 396 e-133 3 ( C91469 ) Dictyostelium discoideum slug cDNA, SSK317. 396 e-132 3 ( AU037400 ) Dictyostelium discoideum slug cDNA, clone SSD587. 396 e-132 3 ( AU07594...0 ) Dictyostelium discoideum slug cDNA, clone SSA167. 396 e-132 3 ( C92697 ) Dictyostelium discoideum slug... cDNA, clone SSF865. 396 e-132 3 ( C92742 ) Dictyostelium discoideum slug cDNA, clo

  11. Dicty_cDB: VSB739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI320483 |BI320483.1 sah56b01.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' ... sh92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-759...111.1 sh40a06.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar to TR:O49

  12. Dicty_cDB: SFL383 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 st5...9b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS06...4435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q

  13. Dicty_cDB: CHD833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 ...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9Z...I974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' si

  14. Dicty_cDB: CHE836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone... 2154-85, mRNA sequence. 92 2e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalide...hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA

  15. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  16. 11C-imaging

    DEFF Research Database (Denmark)

    Thorpe, Michael R; Ferrieri, Abigail P; Herth, Matthias Manfred;


    The long-distance transport and actions of the phytohormone methyl jasmonate (MeJA) were investigated by using the short-lived positron-emitting isotope 11C to label both MeJA and photoassimilate, and compare their transport properties in the same tobacco plants (Nicotiana tabacum L.). There was ...

  17. C-TOOL

    DEFF Research Database (Denmark)

    Taghizadeh-Toosi, Arezoo; Christensen, Bent Tolstrup; Hutchings, Nicholas John;


    agricultural soils. C-TOOL simulates observed losses of SOC in soils under intensive agricultural use and the gain in SOC derived from large inputs of animal manure and inclusion of perennial grassland. The model simulates changes in SOC for the entire profile, but lack of data on subsoil SOC storage hampers...

  18. The 5C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche


    the approaches and reach a new level of conscious action when designing? Informed by theories of design thinking, knowledge production, and learning, we have developed a model, the 5C model, accompanied by 62 method cards. Examples of how the model has been applied in an educational setting are provided...

  19. The 6C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille


    students, teachers, and clients reflect on what abilities the designer must possess in order to be able to promote transformation. The study is informed by the 6C Model, a theory describing the types of knowledge production taking place in design processes, and by the Co-creation Cards, a collection...

  20. The 4C model

    DEFF Research Database (Denmark)

    Knox, Jeanette Bresson Ladegaard


    Doctors and nurses at the neonatal intensive-care unit at The University Hospital, Rigshospitalet, in Copenhagen, Denmark regularly find themselves in ethically challenging and potentially distressing situations concerning the life of ill newborn babies. In collaboration with the neonatal intensi...... how the 4C model was developed and whereof it consists....

  1. Fundamentals of C

    CERN Document Server

    Guruprasad, N


    The book presents a contemporary approach to programming. Complte C programs are presented as and when it is required. This Book is not a cookbook . To get the maximum benefit from this book, you should take as active a role as possible. Don`t just read the examples. Enter it into your system and try them out.

  2. Mutants of complement component C3 cleaved by the C4-specific C1-s protease.


    Mathias, P; Carrillo, C J; Zepf, N E; Cooper, N R; Ogata, R T


    To identify some of the structural features determining specific protease recognition of complement components C3 and C4, we used site-specific mutagenesis to construct mutants of murine C3 that are cleaved by the C4-specific C1-s protease. Insertion of three amino acid residues corresponding to residues at the C1-s cleavage site of human C4 into murine C3 at the analogous C3 convertase cleavage site was adequate to render the mutant protein susceptible to C1-s cleavage. In addition, insertio...

  3. Dicty_cDB: CHQ862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fiiiikfiifytinefnsmwwwlwkwr itrwswwscwwcscwywcnhwfcftrsrfhfnwrfkqlwl*lklqt*IIIKILNQPKIKP NFLICKIKKK--- ---KN...n*nikptk nktqffn Frame C: kqtnk*y*iiikndnlrfnlinw*c*vnykik*fiiiikfiifytinefnsmwwwlwkwr itrwswwscwwcscwywcnhwfcftr...c*vnykik*fiiiikfiifytinefnsmwwwlw kwritrwswwscwwcscwywcnhwfcftrsrfhfnwrfkqlwl*lklqt*iiikilnqpk ikpnfli Homol

  4. Low temperature sintering of ZrC-SiC composite

    International Nuclear Information System (INIS)

    Highlights: → Zirconium carbide, silicon, and graphite powders were used as raw materials to prepare ZrC-SiC composite. → ZrC-30 vol.%SiC was sintered to a relative density of >96.1% at 1800 deg. C by SPS. → The obtained ZrC-30 vol.%SiC composite exhibited a fine microstructure and excellent mechanical properties. - Abstract: High-energy ball milling and spark plasma sintering were adopted to prepare ZrC-SiC composite. Zirconium carbide, silicon, and graphite powders were used as raw materials. ZrC-30 vol.%SiC was sintered to a relative density of >96.1% at 1800 deg. C. The composite showed a fine microstructure. The fracture strength reached up to 523.4 MPa, Vickers' hardness 18.8 GPa, fracture toughness 4.0 MPa m1/2, and elastic modulus 390.5 GPa.

  5. Dicty_cDB: SLI621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G DRAFT SEQUENCE, 9 unordered pieces. 58 5e-08 4 AW201445 |AW201445.1 sf03c02.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3045 5' similar to SW:ERF1_ARATH P35614 ...y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-2790 5' similar to SW:ERF1_ARATH P35614...1 AW831104 |AW831104.1 sm08g04.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-8335 5'

  6. Dicty_cDB: VSK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N BE608288 |BE608288.1 sq27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE I....y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9XFY7 Q9XFY7 PU...cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' similar to WP:D1005....uence. 50 2e-06 2 AW704694 |AW704694.1 sk39d02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G... 50 3e-06 2 AW317457 |AW317457.1 sg50a11.y1 Gm-c1025 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c102

  7. Dicty_cDB: SFJ186 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 56 6...e-04 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...97.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O657...Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O6...7 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' similar to TR:O65744 O65744 GDP DISSOCIAT

  8. Dicty_cDB: AFN644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 71471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE...9.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS0...435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: chromosome IV reading frame ORF YDL084w. 42 3e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  9. Dicty_cDB: AFB707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS...y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06 Q9ZS06 RNA...10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06 Q9ZS06 ...e IV reading frame ORF YDL084w. 42 7e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  10. Dicty_cDB: AFJ131 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available I437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' sim...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 GDI2. ;, mRNA max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION INH...IBITOR. ;, mRNA sequence. 62 1e-05 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...e max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O

  11. Dicty_cDB: AFN656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...ence. 56 7e-04 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...m-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DIS... Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 GDP D...ISSOCIATION INHIBITOR. ;, mRNA sequence. 56 7e-04 1 BI972870 |BI972870.1 sai84a09.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  12. Dicty_cDB: AFH664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION INH...TOR. ;, mRNA sequence. 62 3e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...2 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O6

  13. Dicty_cDB: CFH515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 O65744 GDP DISS...OCIATION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...SSOCIATION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...A sequence. 62 4e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE...I437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLO

  14. Dicty_cDB: AFE889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 O65744 GDP DISSOCIATION I...NHIBITOR. ;, mRNA sequence. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...e. 62 5e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS.... 62 6e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...I437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-

  15. Dicty_cDB: SSD524 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence update 1997.10.13 Translated Amino Acid sequence ---lsffkyhahslflk*c*fri*ifqmmpi...ssncgktnnkikknnkkkkkkif**lk** kkkiiik*flfyf Frame C: ---lsffkyhahslflk*c*fri*ifqmmpiniqlf*YQFILSNSXQFVLAFLLI

  16. Dicty_cDB: CHH715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90 1e-13 1 BM0585...78 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clon

  17. Dicty_cDB: SHA256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85, mRNA sequence. 92 3e-14 1 DR447725 |DR4477...94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cD...acted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90 1e-13 1 dna update 2005.12. 5

  18. Dicty_cDB: SLI174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ssapssasssapsssasssaassaassessesssa ts*ikl*s Homology vs CSM-cDNA Score E Sequences producing significant al...lis hfinktli Frame C: hasattaastiattastvatttsattagtttggtttggstsdssaassadssaassspss saassaassepsssaasssapssas

  19. Dicty_cDB: SLC739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sapssasssapsssasssa assaassessesssats*ikl*skkkk Homology vs CSM-cDNA Score E Sequences producing*csilcfk*rsilclk*csiiisfkfs ciiscklrklrklishfinktlikkkk Frame C: ---adssaassspsssaassaassepsssaasssapssass

  20. Dicty_cDB: SLB615 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value N ( AU033920 ) Dictyostelium discoideum slug cDNA, clone SLB615. 579 e-166 2 ( AU052377 ) Dictyostelium discoideum slug... cDNA, clone SLD220. 571 e-163 2 ( AU038245 ) Dictyostelium discoideum slug cDNA, SSH465. 571 e-163 2 ( AU034608 ) Dictyostelium discoideum slug cDNA, clone SL...C616. 571 e-163 2 ( AU054006 ) Dictyostelium discoideum slug cDNA, clone SLK408. 571 e-163 2 ( AU053421 ) Di...ctyostelium discoideum slug cDNA, clone SLI617. 571 e-163 2 ( AU053322 ) Dictyostelium discoideum slug cDNA,

  1. Dicty_cDB: SLH166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 28 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU053235 ) Dictyostelium discoideum slug... cDNA, clone SLI196. 414 e-112 1 ( AU039216 ) Dictyostelium discoideum slug... cDNA, clone SLH166. 414 e-112 1 ( AU037973 ) Dictyostelium discoideum slug cDNA, clone SSH113.... 414 e-112 1 ( AU034614 ) Dictyostelium discoideum slug cDNA, clone SLC625. 414 e-112 1 ( C93961 ) Dictyostelium discoideum slug... cDNA, clone SSC860. 414 e-112 1 ( C92661 ) Dictyostelium discoideum slug cDNA, clone S

  2. Dicty_cDB: SLF627 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : (bits) Value N ( C91955 ) Dictyostelium discoideum slug cDNA, clone SSC567. 446 e-145 2 ( AU053074 ) Dictyostelium discoideum slug... cDNA, clone SLF627. 446 e-145 2 ( AU053394 ) Dictyostelium discoideum slug cDNA, SLI546. 446 e-121 1 ( AU052834 ) Dictyostelium discoideum slug cDNA, clone SL...F185. 446 e-121 1 ( AU052345 ) Dictyostelium discoideum slug cDNA, clone SLD173. 446 e-121 1 ( AU040089 ) Di...ctyostelium discoideum slug cDNA, clone SLA391. 446 e-121 1 ( AU039940 ) Dictyostelium discoideum slug cDNA,

  3. Dicty_cDB: SLE437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e E Sequences producing significant alignments: (bits) Value N ( AU061491 ) Dictyostelium discoideum slug... cDNA, clone SLE437. 535 e-148 1 ( AU051971 ) Dictyostelium discoideum slug cDNA, SSC830. 535 e-148 1 ( AU038276 ) Dictyostelium discoideum slug cDNA, clone SSH508. 535 e-148 1 ( AU03781...4 ) Dictyostelium discoideum slug cDNA, clone SSE328. 535 e-148 1 ( C94316 ) Dictyostelium discoideum slug... cDNA, clone SSK829. 535 e-148 1 ( C93202 ) Dictyostelium discoideum slug cDNA, clo

  4. Dicty_cDB: SSB106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ing significant alignments: (bits) Value N ( AU051988 ) Dictyostelium discoideum slug cDNA, clone SSB106. 57...7 e-177 2 ( C91121 ) Dictyostelium discoideum slug cDNA, clone SSJ652. 480 e-169 ...3 ( C92519 ) Dictyostelium discoideum slug cDNA, clone SSE517. 480 e-169 3 ( AU037690 ) Dictyostelium discoideum slug... cDNA, clone SSE177. 480 e-169 3 ( AU039039 ) Dictyostelium discoideum slug cDNA, clone SSM310. 480... e-169 3 ( AU051804 ) Dictyostelium discoideum slug cDNA, clone SSA256. 480 e-169

  5. Dicty_cDB: SSB387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value N ( AU051876 ) Dictyostelium discoideum slug cDNA, clone... SSB387. 383 e-123 3 ( AU037138 ) Dictyostelium discoideum slug cDNA, clone SSB522. 353 e-110 3 ( C92575 ) D...ictyostelium discoideum slug cDNA, clone SSE785. 351 e-109 3 ( AU037792 ) Dictyostelium discoideum slug cDNA..., clone SSE302. 351 e-109 3 ( C89820 ) Dictyostelium discoideum slug cDNA, clone ...SSG195. 351 e-109 3 ( AU038946 ) Dictyostelium discoideum slug cDNA, clone SSM180. 351 e-109 3 ( AU037963 )

  6. Dicty_cDB: SLH861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A Score E Sequences producing significant alignments: (bits) Value N ( AU039477 ) Dictyostelium discoideum slug... cDNA, clone SLH861. 353 3e-93 1 ( AU038935 ) Dictyostelium discoideum slug cDNA, clone SSM162. 301 8e-78... 1 ( AU038352 ) Dictyostelium discoideum slug cDNA, clone SSH606. 301 8e-78 1 ( A...U038200 ) Dictyostelium discoideum slug cDNA, clone SSH407. 301 8e-78 1 ( C94522 ) Dictyostelium discoideum slug... cDNA, clone SSL157. 301 8e-78 1 ( C94308 ) Dictyostelium discoideum slug cDNA, clone SSK769. 301 8e-78

  7. Dicty_cDB: SFF287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLON...471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS...08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  8. Dicty_cDB: SLJ376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence. 44 0.075 2 BM093255 |BM093255.1 saj06h02.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...m-c1065-9939 5', mRNA sequence. 42 0.24 2 BE329911 |BE329911.1 so71b06.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS...033.1 sah65a10.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-3092 5', mRNA sequence.

  9. Dicty_cDB: SSD708 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3815 5' similar to TR...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3784 5' similar to TR:O80678...lycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-155 5' similar to TR:O80678 O80678 PUTATIVE RNA-BIND...ING PROTEIN. ;, mRNA sequence. 46 0.30 1 BI469404 |BI469404.1 sai11e07.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS

  10. Dicty_cDB: AFI284 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE I....1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 ...3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  11. Dicty_cDB: AFC104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XKIKKK--- ---XFXKKKKKXKKFFLVFKXXXFXKKKKKTPFXXX*kkikn*kkkkxkkxxisysmglx enxkvxkknxk*xkikkk*kkkllklsfyflvllls*c*gvslplcfalls...xk*xkikkk*kkkllklsfyflvllls*c*gvslplcfallss Frame B: kmsnk*KKKKKNXKKFXXVXKGXXFNKKKKXPXFFXGKKKXKIKKK--- ---xf

  12. Dicty_cDB: SSL836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kmv*f**kkkknhyh***kknkk*kkkk*kkiiisytmglren kkv*kknkk**kikkk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*r css...kk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*r csssilrvnpshsyatlsnv*AVFNKKKYLKKKK

  13. Dicty_cDB: VSD417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence IQAFNERDLSHQSLKRYQDFWMAKFGHEFSMSMTMSLXLXRFPIVLDAAASLIEXXGSRF XAEWAAVMTGVKPKT...rames) Frame A: IQAFNERDLSHQSLKRYQDFWMAKFGHEFSMSMTMSLXLXRFPIVLDAAASLIEXXGSRF XAEWAAVMTGVKPKTWFLRPDVGPLXVLEIF...asisicnnffkkkxxxnhnrv Frame C: psfqrt*sfspisqeisrlldg*irsrilnvhdyvslxxqipnrfrcrrlfnrkxrftfp c*mgcrydwcqtkdlv

  14. Dicty_cDB: VHF373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -- ---SDPLLRDKVTTKIGYVG*c*yrc*m*ekirsfqsrlfkftirysfystcynrkeww* s*stnhh*sis*iffsr*keflpfgtcfgskrgig*kspqfrfi...vplnskplmlvvlshvlmnll*nlslilks lfhli*l--- ---SDPLLRDKVTTKIGYVG*c*yrc*m*ekirsfqsrlfkftir

  15. Dicty_cDB: VSG609 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HLVLNLKKLILVHHTVVVVVVPQLVPLLVQVQVQVHQEQ FTIK*ilnynei--- Frame C: fwfwfwfkwyfrrfwfrfrfrfrlr*rfrfrfrccqwftirfrccqwftir...frcc*wfti wcpnwftircw*cfrcfhw*piwfsisrn*ywfiiqw*w*wcpnwcrywfrfrfrfirns lllnkf*iitks--- Homology vs C

  16. Dicty_cDB: VHI283 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e C: nsniyi**ne*vnnfilnfgfnfshlcstqipiii*rfiik*fk*psnwftiilwftirf klririphn*hrfii...fwfwfwfkwyfrrfwfrfrfrfrlr*rfrfrfrccqwftirfrcc qwftirfrcc*wftiwcpnwftircw*cfrcfhw*piwfsisrn*ywfiiqw*w*wcpnw c

  17. Dicty_cDB: VHM818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GFYRSKYVVNGEXRYIGTTQ--- ---RDKSKH*igyvg*c*yrc*m*ekirsfqsrlfkftirysfystcynrkeww*s*stn hh*sis*iffsr*keflpfgtcf...PTKKIIIHSIDIEIQSVKILNQQATSVTYYEPEXVAILEFQDELPVTENTILSIDFT GILNDKLKGFYRSKYVVNGEXRYIGTTQ--- ---RDKSKH*igyvg*c*yrc*m*ekirsfqsrlfkftir

  18. Dicty_cDB: VHA346 [Dicty_cDB

    Lifescience Database Archive (English)


  19. Dicty_cDB: VFC392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 17896.1 EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C...15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon escule...9042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone c...T355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' end

  20. Dicty_cDB: AFN569 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SHNMQ Frame B: ---issxxvvxpcxxxlvnvfnvxpxvlsixvsnxxkn*vvvkxxlshwpstxxlticn Frame ...C: ---yrxxxwfxhvxxfw*tsst*xxtfcrxpyrtxxrirww*nxscpigrqrxlsqyat Homology vs CSM-cDNA Score E Sequences produc

  1. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  2. Production of actinium, thorium and radium isotopes from natural thorium irradiated with protons up to 141 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Ermolaev, S.V.; Zhuikov, B.L.; Kokhanyuk, V.M.; Matushko, V.L. [Russian Academy of Sciences, Moscow (Russian Federation). Inst. of Nuclear Research; Kalmykov, S.N. [Lomonosov Moscow State Univ., Moscow (Russian Federation). Chemistry Dept.; Aliev, R.A. [Lomonosov Moscow State Univ., Moscow (Russian Federation). Skobeltsyn Inst. of Nuclear Physics; Tananaev, I.G.; Myasoedov, B.F. [Russian Academy of Sciences, Moscow (Russian Federation). A.N. Frumkin Inst. of Physical Chemistry and Electrochemistry


    Cross sections of {sup 225}Ac, {sup 227}Ac, {sup 227}Th and {sup 228}Th in thorium-232 targets irradiated with protons in the energy range 21-141 MeV have been measured. Based on these data, production yields of {sup 225}Ac and {sup 223}Ra in thick thorium targets have been calculated. It is possible to produce in proton energy range 60-140 MeV about 96 GBq (2.6 Ci) {sup 225}Ac per 10-d irradiation with 100 {mu}A proton beam current and 10-d decay, and much higher amount of {sup 223}Ra. The impurities of {sup 227}Ac and {sup 224}Ra are important and need to be assessed for further medical applications. (orig.)

  3. C.A. Nothardbiblioteek

    Directory of Open Access Journals (Sweden)

    J. Swart


    Full Text Available As instructed by the Central Board of the South African Nursing Association during 1985, an investigation was launched into the function of the C.A. Not hard Library, namely to provide optimal information to members. The underlying philosophy concerned with the establishment of the library was to provide a service which is not available elsewhere. The investigation revealed however, that various training institutions in the country meet this need. As a result of the findings, as presented in the article, the C.A. Northard Library was closed on 1 December 1985 as a lending library. A unique Nursing reference library is being established in its place, with the emphasis in the future on the S. A. Nursing Association’s role in the promotion of Nursing research.

  4. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas;

    soil horizons and the fraction of the organic horizon that is translocated to spodic material in a B-horizon is to be chosen from a range of values. Four cases were selected in that reflect common forested soil types in Denmark. In the four selected cases turnover rates (k, year-1) were adjusted......, and iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during......, bioturbation by macrofauna (earthworms) and podzolisation were included, allowing transfer of SOC between the forest floor and mineral soil layers. The forest soil carbon simulator incorporates all types of new and old organic matter into one pool. It is organized in six horizontal soil layers and runs for 40...

  5. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval


    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 �- 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924

  6. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval


    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 - 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924

  7. Testing of DLR C/C-SiC for HIFiRE 8 Scramjet Combustor (United States)

    Glass, David E.; Capriotti, Diego P.; Reimer, Thomas; Kutemeyer, Marius; Smart, Michael


    Ceramic Matrix Composites (CMCs) have been proposed for hot structures in scramjet combustors. Previous studies have calculated significant weight savings by utilizing CMCs (active and passive) versus actively cooled metallic scramjet structures. Both a C/C and a C/C-SiC material system fabricated by DLR (Stuttgart, Germany) are being considered for use in a passively cooled combustor design for HIFiRE 8, a joint Australia / AFRL hypersonic flight program, expected to fly at Mach 7 for approximately 30 sec, at a dynamic pressure of 55 kPa. Flat panels of the DLR C/C and the C/C-SiC were tested in the NASA Langley Direct Connect Rig (DCR) at Mach 5 and Mach 6 enthalpy for several minutes. Gaseous hydrogen fuel was used to fuel the scramjet combustor. The test panels were instrumented with embedded Type K and Type S thermocouples. Zirconia felt insulation was used in some of the tests to increase the surface temperature of the C/C-SiC panel for approximately 350degF. The final C/C-SiC panel was tested for 3 cycles totaling over 135 sec at Mach 6 enthalpy. Slightly more erosion was observed on the C/C panel than the C/C-SiC panels, but both material systems demonstrated acceptable recession performance for the HIFiRE 8 flight.

  8. Hepatitis C in dermatology

    Directory of Open Access Journals (Sweden)



    Full Text Available Hepatitis C is a serious public health problem all over the world. It is caused by a single stranded RNA virus. Most acute infections are subclinical, but in 75% of individuals, infection leads to a chronic hepatitis, which in some cases can progress to cirrhosis and occasionally development of hepatoma. It has wide range of dermatological manifestations. This review article deals with the overview of epidemiology, pathogenesis, clinical manifestations, management and prevention.

  9. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....

  10. Dicty_cDB: VFD348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q...9ZS06 RNA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...ASE P47 HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c101

  11. Dicty_cDB: AFO646 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q...9ZS06 RNA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...ASE P47 HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c101

  12. Dicty_cDB: VSF473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ax cDNA 3', mRNA sequence. 54 5e-04 1 AI941061 |AI941061.1 sb83h05.y1 Gm-c1010 Glycine max cDNA clone GENOME SYSTEMS...54 5e-04 1 BG652825 |BG652825.1 sad84e07.y1 Gm-c1055 Glycine max cDNA clone GENOME SYSTEMS...ojae mixed EST library cDNA, mRNA sequence. 54 5e-04 1 BE347117 |BE347117.1 sp35b10.y1 Gm-c1043 Glycine max cDNA clone GENOME SYSTEMS...9146.1 sai08a12.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-2352 5' similar to SW:R

  13. Dicty_cDB: AFO484 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...SE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...6749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar

  14. Dicty_cDB: AFK433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available roducing significant alignments: (bits) Value N AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS... BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS ...5 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 ...cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION I

  15. Dicty_cDB: SSF112 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 sa81e11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-5733 5' similar to SW:VSPA_SO...47.1 sae29c02.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-4323 5' similar to TR:O49...855 O49855 ACID PHOSPHATASE. ;, mRNA sequence. 44 1.3 1 BU091184 |BU091184.1 st77g08.y1 Gm-c1054 Glycine max cDNA clone GENOME SYSTEM...ACID PHOSPHATASE. ;, mRNA sequence. 44 1.3 1 BE331581 |BE331581.1 sp15g08.y1 Gm-c1042 Glycine max cDNA clone GENOME SYSTEMS

  16. Dicty_cDB: SFJ795 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 64 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR...1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 GDP DISSOC...-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISS..., 5'end, single read. 46 7e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS... 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  17. Dicty_cDB: AFA836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequence 6225 from Patent WO02053728. 40 5e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...8e-09 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...OG. [1] ;, mRNA sequence. 38 4e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...I966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' simi

  18. Dicty_cDB: AFN831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Sequence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...ELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...OLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' si

  19. Dicty_cDB: VFD181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 925.1 Sequence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...NA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5

  20. Dicty_cDB: AFA616 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6225 from Patent WO02053728. 40 5e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CL...;, mRNA sequence. 38 4e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...|AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to T

  1. Dicty_cDB: VFF253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 |AW705505.1 sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mRNA seq...uence. 46 0.46 1 AI441512 |AI441512.1 sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm... Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', mRNA sequence. 46 0.46 1 BI317694 |BI3176...94.1 saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA sequence. 4

  2. Dicty_cDB: AFO440 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q...9ZS06 RNA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...ASE P47 HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c101

  3. Dicty_cDB: AFK259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW306469.1 se51b09.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2418 5', mRNA seque...nce. 34 8e-04 3 BF008963 |BF008963.1 ss71e08.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS... 0.001 3 AI899992 |AI899992.1 sb97c10.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-6...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-3950 5', mRNA sequence. 34 0.002 3 AQ501049 |AQ501049.1

  4. Dicty_cDB: VSK364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 36 0.031 2 AW100096 |AW100096.1 sd20c05.y2 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...4 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1084-470 5' similar to TR:Q39835 Q39835 EXTENSIN. ;, m... AW164667 |AW164667.1 se76a06.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-587 5' si...sac11f12.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-4487 5', mRNA sequence. 36 0.1

  5. Insulin C-peptide test (United States)

    C-peptide ... the test depends on the reason for the C-peptide measurement. Ask your health care provider if ... C-peptide is measured to tell the difference between insulin the body produces and insulin someone injects ...

  6. Dicty_cDB: VFJ639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar...00797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' simil....y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GD.... 66 9e-07 1 AW831512 |AW831512.1 sm26g12.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c10...AW306227 |AW306227.1 se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' si

  7. Dicty_cDB: VFD346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.041 1 BE459099 |BE459099.1 EST414391 tomato developing...BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLE

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available persicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.042 1 BE459099 |BE459099.1 EST414391 tomato developing...1 BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone c

  9. Dicty_cDB: SHA752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssowii Tamarix androssowii cDNA, mRN...A sequence. 58 4e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssowii leaf Tamarix androssowii cDNA, mRNA

  10. Dicty_cDB: CHQ531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yqidflknnklvksiklxhi Frame C: c*fsssi*fiiiiiv*iykd*ffci*ifvnk*innnfffnshtyi*ilnn*ilknvinwy *frynifmcwclak*sc...10.25 Translated Amino Acid sequence c*fsssi*fiiiiiv*iykd*ffci*ifvnk*innnfffnshty...i*ilnn*ilknvinwy *frynifmcwclak*sc*nyck*sr**nhsilcciy*yrtfnw*cckesscnesnqysi* c*tfnws*i**qrssk*YETLAIQSIPKDG

  11. Dicty_cDB: SLJ752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA sequence. ...acted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 60 1e-05 1 CA916753 |CA916753.1

  12. Dicty_cDB: VHF263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence kytminkdtptksppfksgsaqdgnldmsetsdmvsienfeffldhvysdvlssyyfktl ieqekilkkei*i... hksevsilqnkiieleskirqletvqgstnqnknkip Frame C: kytminkdtptksppfksgsaqdgnldmsetsdmvsienfeffldhvysdvlssyyfktl

  13. Dicty_cDB: SLA708 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klrklishfinktlikkkk k Frame B: ---stvatttsattagtttggtttggstsdssaassadssaassspsssaassaasseps ssaasssapssasssapssasssapsssasssaassaasse...ssesssats*ikl*skkkk Frame C: ---QLSQLQPLQLLQVQQLVELQLVVQ

  14. Dicty_cDB: SSB877 [Dicty_cDB

    Lifescience Database Archive (English)


  15. Dicty_cDB: SLA681 [Dicty_cDB

    Lifescience Database Archive (English)


  16. Dicty_cDB: VSD206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mino Acid sequence kqdqldllaqvlgegedsgkneileedfdditrgakkskssaptvsrttggstralsggn dmnymeyqapaiyksiptqhalfkqrak...ikllqfikvfqlnmhylnnvlkinnkk*ikk*tkk Frame C: kqdqldllaqvlgegedsgkneileedfdditrgak

  17. Dicty_cDB: VHG190 [Dicty_cDB

    Lifescience Database Archive (English)


  18. Dicty_cDB: SHG618 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 WHE2108_D02_H04ZT CS wheat salt-stressed crown cDNA library Triticum aestivum cDNA clone WHE2108_D02_H04, ...04ZY Wheat salt-stressed crown cDNA library Triticum aestivum cDNA clone WHE2108_D02_H04, mRNA sequence. 44

  19. Dicty_cDB: VFA266 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 BG131085 |BG131085.1 EST463977 tomato crown gall Lycopersicon esculentum cDNA clone cTOE2D11 5' sequenc...37 |BG133537.1 EST466525 tomato crown gall Lycopersicon esculentum cDNA clone cTOE13N15 5' sequence, mRNA se

  20. Dicty_cDB: SSE551 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 BG131085 |BG131085.1 EST463977 tomato crown gall Lycopersicon esculentum cDNA clone cTOE2D11 5' sequence, ...|BG133537.1 EST466525 tomato crown gall Lycopersicon esculentum cDNA clone cTOE13N15 5' sequence, mRNA seque

  1. Dicty_cDB: SFD774 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence. 34 0.002 14 BF298760 |BF298760.1 021PbB01 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium b...erghei cDNA 5', mRNA sequence. 36 0.005 3 BF298776 |BF298776.1 021PbC06 Pb cDNA #20, Charles

  2. Dicty_cDB: AFK713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cD...NA clone NXLV_039_C04 5', mRNA sequence. 46 0.018 2 BM158719 |BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical

  3. Dicty_cDB: AFG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ielielpeyvlsllfgsvmfvfififiiiayrfkeidqsvldelngdt pmtddnananskeldvvtqkdlssssnpiinn...nnnnnnstlgns Frame C: kkennyyykkwr*kknhqilvyqhqlii*ghqlmervhlkvnkviwkvlimkflfmegmk iifhhqlnilwvmkfvkgihtml*e

  4. Dicty_cDB: SLD371 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) tag22f08.y1 Hydra EST -Kiel 1 Hydra vulgaris cDNA... 38 1.3 2 ( DN302284 ) PL04025A2C08 cDNA from sexually... mature hermaphodi... 34 3.2 2 ( DN308666 ) PL05017A2B08 cDNA from sexually mature hermaphodi... 34 3.2 2 d

  5. Dicty_cDB: VSH844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ictyostelium discoideum cDNA clone:ddv50m11, 5' ... 942 0.0 2 ( C23686 ) Dictyostelium discoideum gamete cDN...7 ) Dictyostelium discoideum cDNA clone:ddv50m11, 3' ... 942 0.0 2 ( AU265127 ) Dictyostelium discoideum veg

  6. Dicty_cDB: VSI126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 268192 ) Dictyostelium discoideum vegetative cDNA clone:VS... 418 e-113 1 ( BJ442592 ) Dictyostelium discoideum cDNA clone:ddv50...lium discoideum cDNA clone:ddv50m22, 3' ... 400 e-107 1 ( BJ441082 ) Dictyostelium discoideum cDNA clone:ddv

  7. Dicty_cDB: VHF201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 442499 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 1352 0.0 1 ( BJ442525 ) Dictyostelium discoideum cDNA discoideum cDNA clone:ddc55m02, 3' ... 1193 0.0 2 ( BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f

  8. Dicty_cDB: VHJ861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostelium discoideum cDNA clone:ddv50j16, 3' ... 1475 0.0 1 ( BJ446334 ) Dictyostelium discoideum cDNA clone:...J442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1467 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50

  9. Dicty_cDB: VHJ575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .0 1 ( BJ442726 ) Dictyostelium discoideum cDNA clone:ddv50e19, 3' ... 1205 0.0 1 ( BJ442635 ) Dictyostelium... discoideum cDNA clone:ddv50c13, 3' ... 1205 0.0 1 ( BJ442488 ) Dictyostelium discoideum cDNA clone:ddv50d04

  10. Dicty_cDB: SLJ322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 BG732108 |BG732108.1 ps20c12.y4 Trichinella spiralis ML CMVsport jasmer Trichinella spiralis cDNA 5' simil...54 0.002 1 BG353063 |BG353063.1 ps20c12.y1 Trichinella spiralis ML CMVsport jasmer Trichinella spiralis cDNA

  11. Dicty_cDB: VSF452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available moeba histolytica genomic, DNA sequence. 38 0.15 2 N98113 |N98113.1 2203C3 czapPFDd2.1, Debopam Chakrabarti ...Plasmodium falciparum cDNA clone PF2203C, mRNA sequence. 34 0.20 2 N98046 |N98046.1 2110C3 czapPFDd2.1, Debo

  12. Dicty_cDB: AFJ476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *lcfnaccndi*cctlfcsn crsfsw*yslgryrtnskstcaxnfrrs Frame C: kkmkvisgllffiliscslflvqgqvdcvtnssdasctnfqyplani...tadinnlcgsmpy mpvctiqqscnqesstsgicdpfsilgdsclhdmpgmsgcnnfkklcasgsvveqcstvd svtdlptt

  13. Dicty_cDB: SSC156 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s balsamifera subsp. trichocarpa cDNA, mRNA sequence. 62 4e-17 2 CB086276 |CB086276.1 hj82c12.g1 Hedyotis ce...ntranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj82c12, mRNA sequence. 56 1e-16 3 d

  14. Dicty_cDB: CHB132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available inas Lactuca sativa cDNA clone QGB24M14, mRNA sequence. 56 4e-19 4 CB086276 |CB086276.1 hj82c12.g1 Hedyotis ...centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj82c12

  15. Dicty_cDB: CFB889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llii cDNA clone cLPP11A1 5' sequence, mRNA sequence. 66 9e-10 2 CF811515 |CF811515.2 NA716 cDNA non acclim...ated Bluecrop library Vaccinium corymbosum cDNA 5', mRNA sequence. 70 7e-09 2 AF352

  16. Dicty_cDB: CFJ845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3754.1 EST321699 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB13E3 5... EST402393 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY19A14

  17. Dicty_cDB: SSJ182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE342564.1 EST395408 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA20O8, mRNA sequence...2683 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES17M3, mRN

  18. Dicty_cDB: SFH171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA c...82264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA se

  19. Dicty_cDB: CFJ532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2039 |AW622039.1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cD...1828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5', ... 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell Lycopersicon esculent

  20. Dicty_cDB: AFI206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ19K... AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRN

  1. Dicty_cDB: VFN130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XSSXXXTPKPKPKPKPTPTTSTPNLSAKSATNSPYKSSIRNASPQP TSKPK Frame B: ---xxxxxxxxxxxhhxxx...qhqnqnqnqnqhqqhqhqiyqpnqqqihhinhqlgmhhhnp hqnqn Frame C: ---xxxxxxnxxxxiixxxntktktktktntnnintkfisqisnkfti*ii

  2. Dicty_cDB: AFM354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NGXVVLXXXXIXXIHXF XQVXSVXXXXXX Frame B: ---vxxxqxxqarigxwxxxxxxkxxxxxxxxfxcwxxxcxlxmxwwffxxxx...yxxsixx fkxnqxxxxxx Frame C: ---xxxxrxxrqelxxgxxxxgxkxxvrxqxxxnvgxxxaxxxwxggslxxyxxfxpsix ssxisxxxxxx

  3. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  4. Dicty_cDB: AFL805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: ---rf*vkkkrfffxxgkkxkkxkxxxxxkxxxxxxxxxxxkxkxxxxkxsxxkkknk Frame B: ---GFRXKKKGFFLXXXKKXKNXKXXXXXKX...XXXXXXXXXXKXKXXXXKXPXEKKKIK Frame C: ---vlgxkkkvffxpwxkkxktkxxxxxxkxxxxxxxxxxxxkxxxxxkxxx

  5. Dicty_cDB: CFH749 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 949067E10.y2 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, ...leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence. 42 7e-11 4 dna update 2004. 2. 2 Homology

  6. Dicty_cDB: CHF675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 48 0.15 1 BG453581 |BG453581.1 NF092A07LF1F1050 Developing leaf Medicago truncatula cDNA...15 1 BG453480 |BG453480.1 NF092C08LF1F1055 Developing leaf Medicago truncatula cDNA clone NF092C08LF 5', mRN

  7. Dicty_cDB: SFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124-6045772 strain AX4, complete sequence. 34 0.50 7 BE317387 |BE317387.2 NF068C10LF1F1070 Developing leaf M...249770 |BE249770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA seque

  8. Dicty_cDB: CHA105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73-367476 strain AX4, complete sequence. 38 0.39 6 BE317387 |BE317387.2 NF068C10LF1F1070 Developing...49770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA sequence. 36 0.5

  9. Dicty_cDB: SLD561 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N ( AU052592 ) Dictyostelium discoideum slug cDNA, clone SLD561. 206 3e-53 2 ( AU054168 ) Dictyostelium discoideum slug... cDNA, clone SLK851. 206 3e-53 2 ( AU038671 ) Dictyostelium discoideum slug cDNA, clone SSL...330. 206 3e-53 2 ( AU053081 ) Dictyostelium discoideum slug cDNA, clone SLF641. 206 3e-53 2 ( AU052708 ) Dictyostelium discoideum slu...g cDNA, clone SLD809. 206 3e-53 2 ( AU053627 ) Dictyostelium discoideum slug... cDNA, clone SLJ259. 206 3e-53 2 ( AU054174 ) Dictyostelium discoideum slug cDNA, clone

  10. Dicty_cDB: SLB652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLB652. 531 e-150 2 ( AU054012 ) Dictyostelium discoideum slug cD...NA, clone SLK416. 515 e-145 2 ( AU038238 ) Dictyostelium discoideum slug cDNA, clone SSH455. 515 e-145 2 ( A...U053479 ) Dictyostelium discoideum slug cDNA, clone SLI735. 515 e-145 2 ( AU05333...5 ) Dictyostelium discoideum slug cDNA, clone SLI413. 515 e-145 2 ( AU054088 ) Dictyostelium discoideum slug... cDNA, clone SLK575. 515 e-145 2 ( AU052377 ) Dictyostelium discoideum slug cDNA, clone SLD220. 515 e-145 2

  11. Dicty_cDB: SLG159 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alue N ( AU039673 ) Dictyostelium discoideum slug cDNA, clone SLG159. 515 e-157 2 ( AU052248 ) Dictyostelium discoideum slug... cDNA, clone SLA424. 476 e-145 2 ( C92456 ) Dictyostelium discoideum slug... cDNA, clone SSE569. 476 e-145 2 ( AU039018 ) Dictyostelium discoideum slug cDNA, clone SSM280. 476 ...e-145 2 ( AU039112 ) Dictyostelium discoideum slug cDNA, clone SSM404. 476 e-145 2 ( AU039077 ) Dictyostelium discoideum slug... cDNA, clone SSM351. 476 e-145 2 ( AU037964 ) Dictyostelium discoideum slug

  12. Dicty_cDB: SLG229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLG229. 313 e-120 2 ( AU052966 ) Dictyostelium discoideum slug cDN...A, clone SLF396. 313 e-107 4 ( AU053262 ) Dictyostelium discoideum slug cDNA, clone SLI263. 313 e-107 4 ( AU...034176 ) Dictyostelium discoideum slug cDNA, clone SLC144. 313 e-107 4 ( AU033450 ) Dictyostelium discoideum slug... cDNA, clone SLA841. 313 e-107 4 ( AU033594 ) Dictyostelium discoideum slug ...cDNA, clone SLB210. 313 e-107 4 ( AU039267 ) Dictyostelium discoideum slug cDNA, clone SLH314. 313 e-107 4 (

  13. Dicty_cDB: SLF725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value N ( AU053114 ) Dictyostelium discoideum slug cDNA, clon...e SLF725. 472 e-138 2 ( AU034546 ) Dictyostelium discoideum slug cDNA, clone SLC450. 472 e-138 2 ( C93134 ) ...Dictyostelium discoideum slug cDNA, clone SSM592. 472 e-138 2 ( AU034374 ) Dictyostelium discoideum slug... cDNA, clone SLC770. 472 e-138 2 ( AU053515 ) Dictyostelium discoideum slug cDNA, SLI819. 472 e-138 2 ( AU033378 ) Dictyostelium discoideum slug cDNA, clone SLA695. 472 e-138 2 ( AU039244

  14. Dicty_cDB: SLC575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U034586 ) Dictyostelium discoideum slug cDNA, clone SLC575. 216 8e-54 2 ( AU053333 ) Dictyostelium discoideum slug... cDNA, clone SLI409. 216 1e-53 2 ( AU038601 ) Dictyostelium discoideum slug... cDNA, clone SSL233. 216 1e-53 2 ( AU052355 ) Dictyostelium discoideum slug cDNA, clone SLD187. 216 2e-53 2 ...( AU053301 ) Dictyostelium discoideum slug cDNA, clone SLI347. 216 2e-53 2 ( AU039583 ) Dictyostelium discoideum slug... cDNA, clone SLE787. 216 2e-53 2 ( AU062090 ) Dictyostelium discoideum slug cDNA, clone SLH520. 216

  15. Dicty_cDB: SSB384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -33 1 ( AU075020 ) Dictyostelium discoideum slug cDNA, clone SSM743. 153 2e-33 1 ( AU073395 ) Dictyostelium discoideum slug... cDNA, clone SSG889. 153 2e-33 1 ( AU072094 ) Dictyostelium discoideum slug... cDNA, clone SSD411. 153 2e-33 1 ( AU071392 ) Dictyostelium discoideum slug cDNA, clone SSB384. 153... 2e-33 1 ( AU052600 ) Dictyostelium discoideum slug cDNA, clone SLD572. 153 2e-33 1 ( AU051943 ) Dictyostelium discoideum slug... cDNA, clone SSC441. 153 2e-33 1 ( AU051917 ) Dictyostelium discoideum slug cDNA, clone SS

  16. Dicty_cDB: SLE833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU035014 ) Dictyostelium discoideum slug... cDNA, clone SLE492. 428 e-136 2 ( AU033641 ) Dictyostelium discoideum slug cDNA, clone SLB259.... 428 e-136 2 ( C89992 ) Dictyostelium discoideum slug cDNA, clone SSG816. 428 e-136 2 ( AU034728 ) Dictyostelium discoideum slug... cDNA, clone SLE246. 428 e-136 2 ( AU033790 ) Dictyostelium discoideum slug... cDNA, clone SLB442. 428 e-136 2 ( AU052850 ) Dictyostelium discoideum slug cDNA, clone SLF20

  17. Dicty_cDB: SLB686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73 ) D. discoideum EF1-I gene for elongation factor 1 al... 620 e-174 1 ( AU285051 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AC... 620 e-174 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... ...620 e-174 1 ( AU285015 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 620... e-174 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 620 e-174 1 ( AU284420 ) Dictyostelium discoideum gamete... cDNA clone:FC-AT2... 620 e-174 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA c

  18. Dicty_cDB: SFL133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE I...D:sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ...CRLFL1008H03 5', mRNA sequence. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  19. Dicty_cDB: CFF586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09....y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS06 RNA ...|BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:

  20. Dicty_cDB: VSF154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 121 |BF298121.1 060PbE12 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA ...5', mRNA sequence. 38 0.096 3 BF296904 |BF296904.1 044PbC10 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clar...73.1 061PbC05 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA se

  1. Dicty_cDB: SFE435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1C5, mRNA se...on esculentum cDNA clone cTOF19D15 5' sequence, mRNA sequence. 38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell...sculentum cDNA clone cTOE14I10 5' sequence, mRNA sequence. 38 0.10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Cornell

  2. Hepatitis C und Psyche

    Directory of Open Access Journals (Sweden)

    Moser G


    Full Text Available Hepatitis C ist ein globales gesundheitliches Problem und eine der häufigsten infektiösen Erkrankungen weltweit. Nur die Hälfte der Betroffenen leidet nach einer Infektion unter Symptomen, die sie ärztliche Hilfe aufsuchen läßt, weshalb es oft Zufallsbefunde sind, die zu einer Diagnose führen. Die häufigsten Beschwerden der Betroffenen in frühen Stadien der Erkrankung sind unspezifisch und führen zu einer reduzierten Lebensqualität mit verminderter Leistungsfähigkeit und psychischer Beeinträchtigung. Wird dann die Diagnose gestellt, fühlen sich die Patienten durch die infektiöse Erkrankung häufig stigmatisiert, manche leiden unter immensen Schuldgefühlen und viele erleben ihre Erkrankung als fatal. In zahlreichen Studien konnte gezeigt werden, daß Patienten mit Hepatitis C unter einer deutlich reduzierten Lebensqualität sowie häufigen Depressionen und Angstsymptomen leiden, welche durch die derzeit gängige Therapie der Hepatitis C mit Interferon-alpha und Ribavirin zusätzlich induziert oder noch verstärkt werden können. Aber mehrere Studien weisen auch darauf hin, daß die Lebensqualität der Betroffenen weniger mit dem Grad der Hepatitis als mit den psychosozialen Folgen wie der psychiatrischen Co-Morbidität, dem Krankheitsverstehen und den krankheitsbezogenen Sorgen wie Stigmatisierung korreliert. Umso wichtiger scheint nach Mitteilung der Diagnose die Evaluation der psychosozialen Situation der Betroffenen. Abgesehen von einer medikamentösen Therapie der Hepatitis ist es entsprechend dem bio-psycho-sozialen Modell der Erkrankung daher wichtig, bei Bedarf eine integrierte psychosomatische Betreuung anzubieten und/oder eine interdisziplinäre Kooperation mit FachärztInnen der Psychiatrie zu etablieren.

  3. Dicty_cDB: VSD715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone:VS... 88 5e-14 1 ( AU053803 ) Dictyostelium discoideum slug cDNA, clone S...LJ717. 88 5e-14 1 ( AU039403 ) Dictyostelium discoideum slug cDNA, clone SLH725. 88 5e-14 1 ( AU038090 ) Dictyostelium discoideum slu...g cDNA, clone SSH260. 88 5e-14 1 ( C94389 ) Dictyostelium discoideum slug cDNA, SSK608. 88 5e-14 1 ( C93239 ) Dictyostelium discoideum slug cDNA, clone SSM862.... 88 5e-14 1 ( C92872 ) Dictyostelium discoideum slug cDNA, clone SSF603. 88 5e-14 1 ( C83898 ) Dictyostelium discoideum slug

  4. Dicty_cDB: AFO278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7E2 map 21q22.2,D21S349-MX1. 32 0.61 6 BM093255 |BM093255.1 saj06h02.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-1068 5', mRNA sequence. 42 0.78 2 BI424033 |BI424033.1... sah65a10.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-30...2.3 2 BE802815 |BE802815.1 sr45a02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-963

  5. Dicty_cDB: VFJ721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AW156723 |AW156723.1 se29h12.y1 Gm-c1015 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1015-2688 5' s...1 sae09e07.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-2...NA sequence. 60 5e-12 2 BE021106 |BE021106.1 sm55e02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS...sequence. 62 6e-12 3 AW597647 |AW597647.1 sj49a11.y1 Gm-c1033 Glycine max cDNA clone GENOME SYSTEMS CLONE ID

  6. Dicty_cDB: SFD789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available roducing significant alignments: (bits) Value N BG046427 |BG046427.1 saa63f08.y1 Gm-c1060 Glycine max cDNA clone GENOME SYSTEMS...NA sequence. 48 0.17 1 AW759353 |AW759353.1 sl41b12.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ...80578.1 sl72g01.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...EHYDROGENASE E1 ALPHA SUBUNIT ;, mRNA sequence. 48 0.17 1 AW201355 |AW201355.1 sf02b05.y1 Gm-c1027 Glycine max cDNA clone GENOME SYST...EMS CLONE ID: Gm-c1027-1066 5' similar to TR:Q9ZT57 Q9ZT57 BRANCHED-CHAIN ALPHA KET

  7. Dicty_cDB: SFD132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1080 0.0 2 BI317339 |BI317339.1 saf70a03.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c107...RNA sequence. 56 6e-04 1 BG362767 |BG362767.1 sac08f03.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLO... mRNA sequence. 56 6e-04 1 AW620967 |AW620967.1 sj98c05.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS...DE ISOMERASE P5 PRECURSOR ;, mRNA sequence. 56 6e-04 1 AW508381 |AW508381.1 si40c04.y1 Gm-r1030 Glycine max cDNA clone GENOME SYSTEMS

  8. Dicty_cDB: SFG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEM...nce. 56 9e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...nce. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...E12 5', mRNA sequence. 48 2e-08 3 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  9. CLR via C#

    CERN Document Server

    Richter, Jeffrey


    Dig deep and master the intricacies of the common language runtime (CLR) and the .NET Framework 4.0. Written by a highly regarded programming expert and consultant to the Microsoft® .NET team, this guide is ideal for developers building any kind of application-including Microsoft® ASP.NET, Windows® Forms, Microsoft® SQL Server®, Web services, and console applications. You'll get hands-on instruction and extensive C# code samples to help you tackle the tough topics and develop high-performance applications.

  10. Programming with C++

    CERN Document Server

    Juneja, BL


    About the Book: Authors have taken special care to present the various topics in Programming with C++ in an easy-to-learn style. Almost every topic is followed by well designed live programmes so that it becomes easy to grasp the underlying principle or programming technique. A total of more than 450 live programmes are included in the book. It is also taken care that programmes are short and do not include such details which do not relate to the topic on hand. This makes them easy to be tested and suitable for practice students. Authors are confident that the book will prove its worth for th

  11. C programming language essentials

    CERN Document Server

    Ackermann, Ernest C


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. C Programming Language discusses fundamental notions, data types and objects, expressions, statements, declarations, function and program structure, the preprocessor, and the standar

  12. Dicty_cDB: VHD773 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85...uence. 88 7e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...hian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRN

  13. Dicty_cDB: AFK408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2154...-85, mRNA sequence. 92 1e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...ut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90

  14. Free C_+ -actions on C^3 are translations


    Kaliman, Shulim


    Let X' be a smooth contractible three-dimensional affine algebraic variety with a free algebraic C_+ -action on it such that S =X'// C_+ is smooth. We prove that X' is isomorphic to $S \\times \\C$ and the action is induced by a translation on the second factor. As a consequence we show that any free algebraic C_+ -action on C^3 is a translation in a suitable coordinate system.

  15. Dicty_cDB: VHO133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available deum cDNA clone:ddv59a09, 3' ... 1411 0.0 1 ( BJ442525 ) Dictyostelium discoideum cDNA clone:ddv50...l04, 3' ... 1292 0.0 2 ( BJ442499 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 12..., 3' ... 1233 0.0 2 ( BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 1225 0.0 3 ( C25574 )

  16. Dicty_cDB: VHP414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostelium discoideum cDNA clone:ddv50g15, 3' ... 1635 0.0 3 ( BJ437910 ) Dictyostelium discoideum cDNA clone:...J442583 ) Dictyostelium discoideum cDNA clone:ddv50g12, 3' ... 1614 0.0 2 ( BJ430...cDNA clone:ddv38n15, 3' ... 1608 0.0 3 ( BJ442531 ) Dictyostelium discoideum cDNA clone:ddv50m05, 3' ... 159

  17. Dicty_cDB: VFI213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CF828170.1 UCRCR01_01C19_f Clementine Mandarin Albedo at Rind Separation cDNA L....1 UCRCR01_05N10_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus reticulata cDNA clone C...R_CEa05N10, mRNA sequence. 54 0.004 1 CF828247 |CF828247.1 UCRCR01_01E19_f Clementine Mandarin Albedo at Rind Separation

  18. Dicty_cDB: VHO217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF828602 |CF828602.1 UCRCR01_01N10_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus retic...R01_01H10_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus reticulata cDNA clone CR_CEa01...28476.1 UCRCR01_01K07_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus reticulata cDNA cl

  19. Dicty_cDB: VHO325 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0313 Homo sapiens cDNA, mRNA sequence. 38 1.3 2 CB077403 |CB077403.1 hj53c10.g1 Hedyotis terminalis flower - Stage 2 (NYBG) Hedyotis... terminalis cDNA clone hj53c10, mRNA sequence. 38 4.2 2 CB076908 |CB076908.1 hj46b11.g1 Hedyotis... terminalis flower - Stage 2 (NYBG) Hedyotis terminalis cDNA clone hj

  20. Dicty_cDB: CFI693 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 852.1 057PbA12 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA s...a cDNA clone pMHRP-45K18, mRNA sequence. 50 0.020 1 BF294187 |BF294187.1 001PbC04 Pb cDNA #17, Tommaso Pace, Marta

  1. Dicty_cDB: SSA671 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68 |BF295868.1 029PbD04 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontal...laria mosquito). 46 0.82 1 BF297693 |BF297693.1 055PbA03 Pb cDNA #17, Tommaso Pace, Marta...058PbC01 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequenc

  2. Dicty_cDB: CHO881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone (ACO) mRNA, complete cds. 66 9e-15 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9

  3. Dicty_cDB: AHB122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ot during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5', mRNA sequence...e QHJ21N12, mRNA sequence. 54 1e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...T311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5

  4. Dicty_cDB: CHS483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ey sequence. 38 0.14 2 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA...490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic acid...34.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38 0.15

  5. Dicty_cDB: AFB456 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AI773934 |AI773934.1 EST255034 tomato resistant, Cornell...AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic ac...AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1C5, mRNA sequence. 38

  6. Dicty_cDB: SSE709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sicon esculentum cDNA clone cLEI12C1 5', mRNA sequence. 54 0.003 1 BF187220 |BF187220.1 EST443507 potato stolon, Cornell...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5', ... 1 BE473010 |BE473010.1 EST417863 potato stolon, Cornell University Solanum tuber

  7. Dicty_cDB: VFG265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pph31g22, 3' end, single read. 1013 0.0 1 AW395348 |AW395348.1 sh46h12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS... 1 BI426611 |BI426611.1 sag05d03.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1080-173 5'...d06.y1 Gm-c1056 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1056-1716 5' ...c09.y3 Gm-c1086 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1674 5' similar to TR:Q43637 Q43637...1 st25a12.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-23 5' similar to TR:Q43637 Q4

  8. Dicty_cDB: CHD258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar t...797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar...1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' simil...SOCIATION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  9. Dicty_cDB: SFI237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5...-05 1 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-218....1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1...INHIBITOR. ;, mRNA sequence. 62 1e-05 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...N INHIBITOR. ;, mRNA sequence. 62 1e-05 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS

  10. Dicty_cDB: SFD673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O65744 GDP... DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...gdi). 38 7e-06 3 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to T... |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to

  11. CSO$_c$ superpotentials

    CERN Document Server

    Guarino, Adolfo


    Motivated by their application to holographic RG flows and hairy black holes in Einstein-scalar systems, we present a collection of superpotentials driving the dynamics of $\\mathcal{N}=2$ and $\\mathcal{N}=1$ four-dimensional supergravities. These theories arise as consistent truncations of the electric/magnetic families of $\\textrm{CSO}(p,q,r)_{c}$ maximal supergravities, with ${p+q+r=8}$, discovered by Dall'Agata et al. The $\\mathcal{N}=2$ and $\\mathcal{N}=1$ truncations describe $\\textrm{SU}(3)$ and $\\mathbb{Z}_{2} \\times \\textrm{SO}(3)$ invariant sectors, respectively, and contain AdS$_4$ solutions preserving $\\mathcal{N}=1,2,3,4$ supersymmetry within the full theories, as well as various gauge symmetries. Realisations in terms of non-geometric type IIB as well as geometric massive type IIA backgrounds are also discussed. The aim of this note is to provide easy to handle superpotentials that facilitate the study of gravitational and gauge aspects of the $\\textrm{CSO}(p,q,r)_{c}$ maximal supergravities avoi...

  12. Understanding hepatitis C. (United States)

    Yim, C K


    Chronic hepatitis C virus (HCV) infection affects over 170 million people worldwide and is a common cause for liver transplantation in Canada. The prevalence of HCV infection in the dialysis population is estimated to be 20% to 50%. Today, intravenous drug use remains the most common route of transmission. The risk of acquiring HCV infection in patients on long-term hemodialysis is expected to decrease because of the screening of blood products for HCV. The diagnostic tests for hepatitis C include anti-HCV, HCV RNA, serum ALT levels, and liver biopsy. Liver biopsy is the definitive diagnostic procedure. Of patients acutely infected with the virus 50% to 85% will become carriers. HCV infection progresses slowly and the minority of patients develop cirrhosis over 20 years. The risk of hepatocellular carcinoma is increased once cirrhosis is present. The current standard of treatment that employs interferon and ribavirin has its limitations and is not indicated for many patients groups, such as patients on long-term hemodialysis. Interferon monotherapy is possible but is poorly tolerated by patients on dialysis. Patient and family education, as well as counselling, are important in that patients infected with HCV should be partners with health care providers in the management of their disease. PMID:11785189

  13. Physics of C. eleganssearch (United States)

    Panlilio, Maria; Bartumeus, Frederic; Ryu, William


    Movement is a fundamental feature of life. Organisms must search for prey, avoid predators, or explore new habitats. Using methods from statistical physics we seek to elucidate the behavioral strategies governing C. elegans searches and their effects on both ecological and evolutionary timescales. Here we ask: how does the search strategy change under starvation? Animal movement studies are often hindered by difficult observations over large spatiotemporal scales, unknown environmental conditions, and complex behavioral descriptions. C. elegans is a powerful model system for overcoming such challenges. Machine vision technologies capture high-resolution images of individuals crawling through a large isotropic environment. Trajectories are reconstructed from the images and behavioral reorientation events are automatically flagged. We find that short-term directional persistence initially increases with time away from food. We also quantify local and global spatial searching scales, which are modulated at least in part by the dynamics of one distinct behavior. Since other reorientation types are known to be suppressed under starvation, we propose that the long-term behavioral strategy acts as a compensatory mechanism to prevent both under and oversampling of the environment. We gratefully acknowledge the support of the Human Frontier Science Program and the Ontario Graduate Scholarship (M.P.)

  14. InlfammatoryboweldiseasesandhepatitisC virusinfection

    Institute of Scientific and Technical Information of China (English)

    Yan-Dong Li; Jian-Jiang Lin; Shu-Sen Zheng


    BACKGROUND: Data on the prevalence of hepatitis C in patients with inlfammatory bowel diseases (IBD) are limited and conlficting. This study was to assess the prevalence of hepatitis C virus (HCV) infection in IBD patients and to deifne the clinical and immunologic proifle of IBD associated with HCV infection. METHODS: Ten patients (seven females and three males) with IBD and HCV infection were consecutively recruited in our department between June 2005 and May 2010. We analyzed the clinical and serologic description of all patients. RESULTS: The mean age of the 10 patients was 41 years and the median disease duration was 7 years. With present and/or past HCV infection, the patients had clinical manifestations and were positive for endoscopic study or histological test. Compared with the HCV-negative IBD group, the HCV-positive IBD group have a higher positive rate of autoantibodies (antinuclear antibodies, antieutrophil cytoplasmic antibody, and anti-SSa/SSb). In the HCV-positive group, 8 patients were positive for p-antieutrophil cytoplasmic antibody, 4 positive for antinuclear antibodies, and 3 positive for anti-SSa/SSb. Four patients had an elevated level of transaminase (alanine transminase, and aspartate transminase). CONCLUSIONS: HCV positive in IBD may induce autoanti-bodies (antinuclear antibodies, antieutrophil cytoplasmic antibody, anti-SSa/SSb) and damage of liver function. In managing IBD patients, physicians should be aware of screening of HCV and prescribe antiviral treatment.

  15. Glucocorticosteroids for viral hepatitis C

    DEFF Research Database (Denmark)

    Brok, J; Mellerup, M T; Krogsgaard, K;


    Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection.......Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection....

  16. Braided C*-quantum groups


    Roy, Sutanu


    We propose a general theory of braided quantum groups in the C*-algebraic framework. More precisely, we construct braided quantum groups using manageable braided multiplicative unitaries over a regular C*-quantum group. We show that braided C*-quantum groups are equivalent to C*-quantum groups with projection.

  17. $\\Lambda_c\\Sigma_c\\pi$ coupling and $\\Sigma_c \\rightarrow\\Lambda_c \\pi$ decay in lattice QCD

    CERN Document Server

    Can, K U; Oka, M; Takahashi, T T


    We evaluate the $\\Lambda_c\\Sigma_c\\pi$ coupling constant ($G_{\\Lambda_c \\Sigma_c \\pi}$) and the width of the strong decay $\\Sigma_c \\rightarrow\\Lambda_c \\pi$ in 2+1 flavor lattice QCD on four different ensembles with pion masses ranging from 700 MeV to 300 MeV. We find $G_{\\Lambda_c \\Sigma_c \\pi}=18.332(1.476)_{\\rm{stat.}}(2.171)_{\\rm{syst.}}$ and the decay width $\\Gamma(\\Sigma_c \\rightarrow\\Lambda_c \\pi)=1.65(28)_{\\rm{stat.}}(30)_{\\rm{syst.}}$~MeV on the physical quark-mass point, which is in agreement with the recent experimental determination.

  18. Dicty_cDB: AFM469 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BJ346942 ) Dictyostelium discoideum cDNA clone:dda25j18, 3' ... 212 2e-51 1 ( AU038195 ) Dictyostelium discoideum slug... cDNA, clone SSH396. 137 7e-39 2 ( AU037315 ) Dictyostelium discoideum slug cDNA, clone SSB757....7 1e-28 1 ( AU060182 ) Dictyostelium discoideum slug cDNA, clone SLA529. 137 1e-28 1 ( AU053491 ) Dictyostelium discoideum slug... cDNA, clone SLI758. 137 1e-28 1 ( AU034407 ) Dictyostelium discoideum slug cDNA, clone S...LC832. 137 1e-28 1 ( C94037 ) Dictyostelium discoideum slug cDNA, clone SSG310. 137 1e-28 1 ( C84047 ) Dictyostelium discoideum slug

  19. Low-Cost, Large C-SiC Blisk Fabrication (United States)

    Kowbel, W.; Effinger, M.


    C-SiC composites offer unique properties for propulsion applications. However, fabrication of low-cost, thick, large scale C-SiC disk for integrally bladed disk (blisk) applications has not been established yet. MER has demonstrated a new process to address this issue. Polymer-based processing was employed for interfacial coatings, consolidation and densification. Up to 40" O.C., 2" thick C-SiC composite processing was established, yielding in excess of 1.8 g/cu cm density. Computer tomography (CT) scans on the 40" O.D., 2" thick C-SiC disk showed no visible delamination, and good density uniformity. Stress-rupture testing in air was conducted at 2200 F, 2400 F and 2550 F.

  20. Dicty_cDB: CFJ662 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available J PROTEIN. ;, mRNA sequence. 60 2e-05 2 BF595059 |BF595059.1 su63e08.y1 Gm-c1069 Glycine max cDNA clone GENOME SYSTEMS...-05 2 BE805892 |BE805892.1 ss62f10.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS... Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-3332 5' similar to TR:O...e max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1069-197 5' similar to TR:O24074 O24074 DNAJ-LIKE PROTEIN. ;, ...24074 O24074 DNAJ-LIKE PROTEIN. ;, mRNA sequence. 58 4e-05 2 BF424117 |BF424117.1 su46e03.y1 Gm-c1069 Glycin

  1. Dicty_cDB: AFF828 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06 Q9ZS06 RNA HELICASE ;, mR...NA sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE...yces exiguus. 38 1e-09 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLO...e 6225 from Patent WO02053728. 40 1e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  2. Dicty_cDB: VFK428 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 0.004 1 AI772499 |AI772499.1 EST253599 tomato resistant, Cornell Lycopersicon e...3 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT3...0 cSTD Solanum tuberosum cDNA clone cSTD13M7 5' sequence, mRNA sequence. 54 0.004 1 BF187223 |BF187223.1 EST443510 potato stolon, Cor...nell University Solanum tuberosum cDNA clone cSTA39F1 5' sequence, mRNA sequence. 5...Lycopersicon esculentum cDNA clone cLEG70A23 5' end, mRNA sequence. 54 0.004 1 BE353311 |BE353311.1 EST40044

  3. Dicty_cDB: AFO611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2...79.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O657...7629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O2...4653 O24653 GDI2. ;, mRNA sequence. 56 5e-04 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...quence. 56 5e-04 1 AW306227 |AW306227.1 se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS

  4. Dicty_cDB: SFC277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ue N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184...5e-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-15...lycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION... INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...ON INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS

  5. Dicty_cDB: AFH834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...equence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS... sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE I...70 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar...37629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' simil

  6. Dicty_cDB: CFE844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA for GDP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEM...OR. ;, mRNA sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184...1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-15.... ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYST

  7. Dicty_cDB: AFJ402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA for GDP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...;, mRNA sequence. 62 2e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEM.... ;, mRNA sequence. 62 2e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS... 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5...-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505

  8. Dicty_cDB: VFE739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 46 0.88 1 AI900122 |AI900122.1 sc01b07.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-...878 5', mRNA sequence. 46 0.88 1 AW705505 |AW705505.1 sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS...AW705268 |AW705268.1 sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', m...RNA sequence. 46 0.88 1 BI317694 |BI317694.1 saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLON... CLONE ID: Gm-c1019-5952 5', mRNA sequence. 46 0.88 1 AI441512 |AI441512.1 sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTE

  9. Dicty_cDB: SFJ449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R. ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...TOR. ;, mRNA sequence. 62 4e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-218....1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1... inhibitor (gdi). 38 2e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTE

  10. Meningococcal disease serogroup C

    Directory of Open Access Journals (Sweden)

    Cuevas IE


    Full Text Available Félix O Dickinson1, Antonio E Pérez1, Iván E Cuevas21Department of Epidemiology, “Pedro Kourí” Institute, Havana, Cuba; 2Pharmacovigilance Group, Finlay Institute, Havana, CubaAbstract: Despite current advances in antibiotic therapy and vaccines, meningococcal disease serogroup C (MDC remains a serious threat to global health, particularly in countries in North and Latin America, Europe, and Asia. MDC is a leading cause of morbidity, mortality, and neurological sequelae and it is a heavy economic burden. At the individual level, despite advances in antibiotics and supportive therapies, case fatality rate remains nearly 10% and severe neurological sequelae are frequent. At the population level, prevention and control of infection is more challenging. The main approaches include health education, providing information to the public, specific treatment, chemoprophylaxis, and the use of vaccines. Plain and conjugate meningococcal C polysaccharide vaccines are considered safe, are well tolerated, and have been used successfully for over 30 years. Most high-income countries use vaccination as a part of public health strategies, and different meningococcal C vaccination schedules have proven to be effective in reducing incidence. This is particularly so with conjugate vaccines, which have been found to induce immunogenicity in infants (the age group with the highest incidence rates of disease, stimulate immunologic memory, have longer effects, not lead to hyporesponsiveness with repeated dosing, and decrease acquisition of nasopharyngeal carriage, inducing herd immunity. Antibiotics are considered a cornerstone of MDC treatment and must be administered empirically as soon as possible. The choice of which antibiotic to use should be made based on local antibiotic resistance, availability, and circulating strains. Excellent options for a 7-day course are penicillin, ampicillin, chloramphenicol, and third-generation cephalosporins (ceftriaxone and

  11. Mammalian phospholipase C. (United States)

    Kadamur, Ganesh; Ross, Elliott M


    Phospholipase C (PLC) converts phosphatidylinositol 4,5-bisphosphate (PIP(2)) to inositol 1,4,5-trisphosphate (IP(3)) and diacylglycerol (DAG). DAG and IP(3) each control diverse cellular processes and are also substrates for synthesis of other important signaling molecules. PLC is thus central to many important interlocking regulatory networks. Mammals express six families of PLCs, each with both unique and overlapping controls over expression and subcellular distribution. Each PLC also responds acutely to its own spectrum of activators that includes heterotrimeric G protein subunits, protein tyrosine kinases, small G proteins, Ca(2+), and phospholipids. Mammalian PLCs are autoinhibited by a region in the catalytic TIM barrel domain that is the target of much of their acute regulation. In combination, the PLCs act as a signaling nexus that integrates numerous signaling inputs, critically governs PIP(2) levels, and regulates production of important second messengers to determine cell behavior over the millisecond to hour timescale. PMID:23140367

  12. Dicty_cDB: AHA269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clo...BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis 2154-85, mRNA sequence. 92 2e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 8e-14 1

  13. Dicty_cDB: SLE194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E Sequences producing significant alignments: (bits) Value N ( AU034692 ) Dictyostelium discoideum slug cDNA..., clone SLE194. 268 2e-91 2 ( AU033787 ) Dictyostelium discoideum slug cDNA, clon...e SLB438. 260 1e-86 2 ( AU040025 ) Dictyostelium discoideum slug cDNA, clone SLH472. 260 1e-86 2 ( AU033785 ...) Dictyostelium discoideum slug cDNA, clone SLB436. 260 1e-86 2 ( AU033617 ) Dictyostelium discoideum slug c...DNA, clone SLB234. 260 1e-86 2 ( AU039989 ) Dictyostelium discoideum slug cDNA, clone SLH386. 260 1e-86 2 (

  14. Dicty_cDB: SLD238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N ( AU052389 ) Dictyostelium discoideum slug cDNA, clone SLD238. 533 e-156... 2 ( AU052473 ) Dictyostelium discoideum slug cDNA, clone SLD384. 533 e-156 2 ( AU053348 ) Dictyostelium discoideum slug... cDNA, clone SLI436. 533 e-156 2 ( AU052949 ) Dictyostelium discoideum slug cDNA, clone SLF368. ...533 e-156 2 ( AU033974 ) Dictyostelium discoideum slug cDNA, clone SLB679. 533 e-...156 2 ( AU052416 ) Dictyostelium discoideum slug cDNA, clone SLD280. 533 e-156 2 ( AU052488 ) Dictyostelium discoideum slug

  15. Dicty_cDB: SLE859 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lignments: (bits) Value N ( AU073002 ) Dictyostelium discoideum slug cDNA, clone SSF684. 278 1e-70 1 ( AU039...623 ) Dictyostelium discoideum slug cDNA, clone SLE859. 278 1e-70 1 ( AU039285 ) Dictyostelium discoideum slug... cDNA, clone SLH350. 278 1e-70 1 ( AU038051 ) Dictyostelium discoideum slug cDNA, clone SSH205. 278 1e-70 ...1 ( AU037986 ) Dictyostelium discoideum slug cDNA, clone SSH126. 278 1e-70 1 ( AU...036928 ) Dictyostelium discoideum slug cDNA, clone SSB829. 278 1e-70 1 ( AU034464 ) Dictyostelium discoideum slug

  16. Dicty_cDB: SLC461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bits) Value N ( AU052389 ) Dictyostelium discoideum slug cDNA, clone SLD238. 531 ...e-155 2 ( AU034553 ) Dictyostelium discoideum slug cDNA, clone SLC461. 531 e-155 2 ( AU052473 ) Dictyostelium discoideum slug... cDNA, clone SLD384. 531 e-155 2 ( AU053348 ) Dictyostelium discoideum slug cDNA, clone SLI...436. 531 e-155 2 ( AU052949 ) Dictyostelium discoideum slug cDNA, clone SLF368. 5...31 e-155 2 ( AU033974 ) Dictyostelium discoideum slug cDNA, clone SLB679. 531 e-155 2 ( AU052416 ) Dictyostelium discoideum slug

  17. Dicty_cDB: SLD814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N ( AU053560 ) Dictyostelium discoideum slu...g cDNA, clone SLJ113. 74 1e-09 1 ( AU053233 ) Dictyostelium discoideum slug cDNA, c...lone SLI189. 74 1e-09 1 ( AU052710 ) Dictyostelium discoideum slug cDNA, clone SLD814. 74 1e-09 1 ( AU034917... ) Dictyostelium discoideum slug cDNA, clone SLE688. 74 1e-09 1 ( AU034895 ) Dictyostelium discoideum slug...927 ) Dictyostelium discoideum cDNA clone:dda4n09, 3' e... 72 5e-09 1 ( AU039941 ) Dictyostelium discoideum slug

  18. Dicty_cDB: SLI263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ng significant alignments: (bits) Value N ( AU052966 ) Dictyostelium discoideum slug cDNA, clone SLF396. 313... e-133 3 ( AU053262 ) Dictyostelium discoideum slug cDNA, clone SLI263. 313 e-133 3 ( AU034176 ) Dictyostelium discoideum slug... cDNA, clone SLC144. 313 e-133 3 ( AU033450 ) Dictyostelium discoideum slug cDNA, clone SL...A841. 313 e-133 3 ( AU033594 ) Dictyostelium discoideum slug cDNA, clone SLB210. ...313 e-133 3 ( AU039267 ) Dictyostelium discoideum slug cDNA, clone SLH314. 313 e-133 3 ( AU034754 ) Dictyostelium discoideum slug

  19. Dicty_cDB: SLA715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s: (bits) Value N ( AU033392 ) Dictyostelium discoideum slug cDNA, clone SLA715. 430 e-134 2 ( AU061433 ) Di...ctyostelium discoideum slug cDNA, clone SLE229. 125 1e-24 1 ( AU052935 ) Dictyostelium discoideum slug... cDNA, clone SLF348. 125 1e-24 1 ( AU052765 ) Dictyostelium discoideum slug cDNA, clone... SLK604. 125 1e-24 1 ( AU052509 ) Dictyostelium discoideum slug cDNA, clone SLD436. 125 1e-24 1 ( AU052458 )... Dictyostelium discoideum slug cDNA, clone SLD352. 125 1e-24 1 ( AU052357 ) Dictyostelium discoideum slug

  20. Dicty_cDB: SLA579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nts: (bits) Value N ( AU052130 ) Dictyostelium discoideum slug cDNA, clone SLA579. 313 e-144 4 ( AU034239 ) ...Dictyostelium discoideum slug cDNA, clone SLC311. 313 e-134 4 ( AU052966 ) Dictyostelium discoideum slug... cDNA, clone SLF396. 313 e-134 4 ( AU053398 ) Dictyostelium discoideum slug cDNA, SLI557. 313 e-133 4 ( AU034057 ) Dictyostelium discoideum slug cDNA, clone SLB864. 313 e-133 4 ( AU033607... ) Dictyostelium discoideum slug cDNA, clone SLB224. 313 e-133 4 ( AU052240 ) Dictyostelium discoideum slug

  1. Dicty_cDB: SLD591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU052612 ) Dictyostelium discoideum slug... cDNA, clone SLD591. 394 e-106 1 ( AU040016 ) Dictyostelium discoideum slug... cDNA, clone SLH448. 365 e-100 2 ( AU040010 ) Dictyostelium discoideum slug cDNA, clone SLH434.... 365 e-100 2 ( AU039914 ) Dictyostelium discoideum slug cDNA, clone SLG735. 365 e-100 2 ( AU039555 ) Dictyostelium discoideum slug... cDNA, clone SLE743. 365 e-100 2 ( AU033990 ) Dictyostelium discoideum slug cDNA, clon

  2. Dicty_cDB: SLI465 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value N ( AU053548 ) Dictyostelium discoideum slug cDNA, clone S...LI884. 841 0.0 1 ( AU053363 ) Dictyostelium discoideum slug cDNA, clone SLI465. 841 0.0 1 ( AU053267 ) Dictyostelium discoideum slug... cDNA, clone SLI280. 841 0.0 1 ( AU052974 ) Dictyostelium discoideum slug... cDNA, clone SLF417. 841 0.0 1 ( AU052524 ) Dictyostelium discoideum slug cDNA, clone SLD467.... 841 0.0 1 ( AU039588 ) Dictyostelium discoideum slug cDNA, clone SLE804. 841 0.0 1 ( AU039561 ) Dictyostelium discoideum slug

  3. Dicty_cDB: SLG207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9696 ) Dictyostelium discoideum slug cDNA, clone SLG207. 359 e-165 3 ( AU052383 )... Dictyostelium discoideum slug cDNA, clone SLD229. 359 e-165 3 ( AU053303 ) Dictyostelium discoideum slug cD...NA, clone SLI350. 359 e-165 3 ( AU053244 ) Dictyostelium discoideum slug cDNA, clone SLI220. 359 e-165 3 ( A...U033975 ) Dictyostelium discoideum slug cDNA, clone SLB680. 359 e-165 3 ( AU03471...4 ) Dictyostelium discoideum slug cDNA, clone SLE226. 359 e-165 3 ( AU039609 ) Dictyostelium discoideum slug

  4. Dicty_cDB: SLC852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 422 ) Dictyostelium discoideum slug cDNA, clone SLC852. 400 e-111 2 ( AU053615 ) Dictyostelium discoideum slug... cDNA, clone SLJ236. 400 e-111 2 ( AU038588 ) Dictyostelium discoideum slug cDN...A, clone SSL212. 400 e-111 2 ( AU038481 ) Dictyostelium discoideum slug cDNA, clone SSH773. 400 e-111 2 ( AU...052369 ) Dictyostelium discoideum slug cDNA, clone SLD208. 400 e-111 2 ( AU033953 ) Dictyostelium discoideum slug... cDNA, clone SLB652. 400 e-111 2 ( AU054012 ) Dictyostelium discoideum slug

  5. Dicty_cDB: SLF671 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 04.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU061433 ) Dictyostelium discoideum slu...g cDNA, clone SLE229. 335 5e-88 1 ( AU053094 ) Dictyostelium discoideum slug cDNA, ...clone SLF671. 335 5e-88 1 ( AU052935 ) Dictyostelium discoideum slug cDNA, clone SLF348. 335 5e-88 1 ( AU052...765 ) Dictyostelium discoideum slug cDNA, clone SLK604. 335 5e-88 1 ( AU052509 ) ...Dictyostelium discoideum slug cDNA, clone SLD436. 335 5e-88 1 ( AU052458 ) Dictyostelium discoideum slug cDN

  6. Dicty_cDB: SLF323 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available factor 1 al... 531 e-147 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 531 e-147 1 ( A...U285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 531 e-147 1 ( AU28...5015 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 531 e-147 1 ( AU284628 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 531 e-147 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... ...531 e-147 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 531

  7. Dicty_cDB: SLC589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available te cDNA clone:FCL-AC... 456 e-124 1 ( AU285021 ) Dictyostelium discoideum gamete cD...NA clone:FCL-AA... 456 e-124 1 ( AU285015 ) Dictyostelium discoideum gamete cDNA ...clone:FCL-AA... 456 e-124 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 456 e-124 1 ( ...AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 456 e-124 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 456 e-124 1 ( AU284225 ) Dictyostelium discoideum gamete

  8. Dicty_cDB: SLF652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elongation factor 1 al... 450 e-122 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 450... e-122 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 450 e-122 1 ( AU285015 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 450 e-122 1 ( AU284628 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 450 e-122 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clon...e:FC-AT2... 450 e-122 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 450 e-122 1 ( AU28

  9. Dicty_cDB: SLA544 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-139 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 505 e-1...39 1 ( AU285021 ) Dictyostelium discoideum gamete cDNA clone:FCL-AA... 505 e-139 1 ( AU285015 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 505 e-139 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone...:FC-BF1... 505 e-139 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC...-AT2... 505 e-139 1 ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 505 e-139 1 ( AU284225

  10. Dicty_cDB: SLB733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-163 1 ( C23695 ) Dictyostelium discoideum gamete cDNA, clone FC-AK02. 561 e-156 2 ( AC116100 ) Dictyostel...ium discoideum chromosome 2 map 6163571... 561 e-156 1 ( AU284631 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 561 e-156 1 ( AU284520 ) Dictyostelium discoideum gamete cDNA clone:...FC-BB0... 561 e-156 1 ( AU284518 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 561 e-156 1 ( AU2844...49 ) Dictyostelium discoideum gamete cDNA clone:FC-AW0... 561 e-156 1 ( AU284378

  11. Dicty_cDB: SLE664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 521 e-144 1 ( AU285051 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 521 e-144 1 ( AU285021 ) D...ictyostelium discoideum gamete cDNA clone:FCL-AA... 521 e-144 1 ( AU285015 ) Dictyostelium discoideum game...te cDNA clone:FCL-AA... 521 e-144 1 ( AU284628 ) Dictyostelium discoideum gamete cD...NA clone:FC-BF1... 521 e-144 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 521 e-144 1... ( AU284342 ) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 521 e-144 1 (

  12. Dicty_cDB: SLG134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 ) Dictyostelium discoideum gamete cDNA, clone FC-AK02. 529 e-158 2 ( AU284631 ) Dictyostelium discoideum gamete... cDNA clone:FC-BF1... 529 e-158 2 ( AU284449 ) Dictyostelium discoideum gamete... cDNA clone:FC-AW0... 529 e-158 2 ( AU284368 ) Dictyostelium discoideum gamete cDNA clone:FC-AP1... 529 e-...158 2 ( AU284518 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 529 e-158 2 ( AU284520 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 529 e-158 2 ( AU284378 ) Dictyostelium discoideum gamete

  13. Dicty_cDB: SLB720 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E Sequences producing significant alignments: (bits) Value N ( AU284939 ) Dictyostelium discoideum gamete c...DNA clone:FC-BQ1... 529 e-146 1 ( AU284921 ) Dictyostelium discoideum gamete cDNA clone:FC-BP2... 529 e-146 ...1 ( AU284887 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1... 529 e-146 1 (... AU284668 ) Dictyostelium discoideum gamete cDNA clone:FC-BG1... 529 e-146 1 ( AU284515 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 529 e-146 1 ( AU284299 ) Dictyostelium discoideum gamete cDNA clone:FC-AJ

  14. Dicty_cDB: SLH214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 51 ) Dictyostelium discoideum gamete cDNA clone:FCL-AC... 498 e-137 1 ( AU285021 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 498 e-137 1 ( AU285015 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 498 e-137 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 498 e...-137 1 ( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 498 e-137 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 498 e-137 1 ( AU284225 ) Dictyostelium discoideum gamete

  15. Dicty_cDB: SLG875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ctyostelium discoideum gamete cDNA clone:FCL-AC... 498 e-137 1 ( AU285021 ) Dictyostelium discoideum gamete ...cDNA clone:FCL-AA... 498 e-137 1 ( AU285015 ) Dictyostelium discoideum gamete cDN...A clone:FCL-AA... 498 e-137 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 498 e-137 1 ...( AU284420 ) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 498 e-137 1 ( AU284342 ) Dictyostelium discoideum gamete... cDNA clone:FC-AN0... 498 e-137 1 ( AU284225 ) Dictyostelium discoideum gamete

  16. Dicty_cDB: VSD185 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available and Malpighian tubule cDNA library Ctenocephalides felis cDNA clone 3254-25, mRNA sequence. 48 2e-06 2 BQ476622 |BQ476622.1 curculio...3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio...3e06 3', mRNA sequence. 46 0.46 1 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium cDNA Curc...ulio glandium cDNA clone curculio3e06 5', mRNA sequence. 46 0.46 1 AX345182 |AX345182.1 Sequence 253 from Pa

  17. Dicty_cDB: VFD577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA cl...tical) Pinus taeda cDNA clone NXLV_039_C04 5', mRNA sequence. 46 0.017 2 BM158719 |...p library Pinus taeda cDNA clone ST11A05, mRNA sequence. 46 0.016 2 BM158718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Ver

  18. Dicty_cDB: VHC552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available estuca arundinacea cDNA, mRNA sequence. 58 3e-04 1 CJ845953 |CJ845953.1 Triticum aestivum cDNA clone:whatlal...39n16, 3' end. 58 3e-04 1 CJ787559 |CJ787559.1 Triticum aestivum cDNA clone:whatl18a10, 3' end. 58 3e-04 1 C...J787558 |CJ787558.1 Triticum aestivum cDNA clone:whatl18a09, 3' end. 58 3e-04 1 C

  19. Dicty_cDB: SFB381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 42 0.14 2 AW279403 |AW279403.1 sf79b03.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS...equence from clone CH211-188I17. 38 0.28 3 BI702238 |BI702238.1 sag44a03.y1 Gm-c1081 Glycine max cDNA clone GENOME SYSTEMS...4 0.30 2 BG156272 |BG156272.1 saa73f04.y1 Gm-c1063 Glycine max cDNA clone GENOME SYSTEMS

  20. Dicty_cDB: AFA547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA sequence. 74 ...e, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ19K24 5', mRNA sequence. 7...on esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 2e-09 1 AW626316 |AW626316.1 EST320223 tomato radicl

  1. Dicty_cDB: AFA816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O657...4653 GDI2. ;, mRNA sequence. 62 4e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...ce. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...ence. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...OCIATION INHIBITOR. ;, mRNA sequence. 44 9e-06 3 BI426472 |BI426472.1 sag03f09.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS

  2. Dicty_cDB: SFE141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gdi). 38 6e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...equence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:...10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' s...8c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O6574...4 GDP DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 5e-07 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYS

  3. Dicty_cDB: SLI838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-09 4 AW306469 |AW306469.1 se51b09.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-241...8 5', mRNA sequence. 34 4e-04 3 BF008963 |BF008963.1 ss71e08.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS...899992 |AI899992.1 sb97c10.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLON...E ID: Gm-c1012-619 5', mRNA sequence. 34 7e-04 3 AW394993 |AW394993.1 sh38b07.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS...uence. 34 8e-04 3 AI759854 |AI759854.1 sb65b12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G

  4. Dicty_cDB: SFA175 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : (bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...equence. 62 6e-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:...1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP ...DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...P DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEM

  5. Interstellar detection of c-C3D2

    CERN Document Server

    Spezzano, S; Schilke, P; Caselli, P; Menten, K M; McCarthy, M C; Bizzocchi, L; Trevino-Morales, S P; Aikawa, Y; Schlemmer, S


    We report the first interstellar detection of c-C3D2. The doubly deuterated cyclopropenylidene, a carbene, has been detected toward the starless cores TMC- 1C and L1544 using the IRAM 30m telescope. The J(Ka,Kc) = 3(0,3)-2(1,2), 3(1,3)-2(0,2), and 2(2,1)-1(1,0) transitions of this species have been observed at 3 mm in both sources. The expected 1:2 intensity ratio has been found in the 3(0,3)-2(1,2) and 3(1,3)-2(0,2) lines, belonging to the para and ortho species respectively. We also observed lines of the main species, c-C3H2, the singly deuterated c-C3HD, and the species with one 13C off of the principal axis of the molecule, c-H13CC2H. The lines of c-C3D2 have been observed with high signal to noise ratio, better than 7.5 sigma in TMC-1C and 9 sigma in L1544. The abundance of doubly deuterated cyclopropenylidene with respect to the normal species is found to be (0.4 - 0.8)% in TMC-1C and (1.2 - 2.1)% in L1544. The deuteration of this small hydrocarbon ring is analysed with a comprehensive gas-grain model, ...

  6. C*-algebras associated with Hilbert C*-quad modules of C*-textile dynamical systems

    CERN Document Server

    Matsumoto, Kengo


    A $C^*$-textile dynamical system $({\\cal A}, \\rho,\\eta,\\Sigma^\\rho,\\Sigma^\\eta, \\kappa)$ connsists of a unital $C^*$-algebra ${\\cal A}$, two families of endomorphisms ${\\rho_\\alpha}_{\\alpha \\in \\Sigma^\\rho}$ and ${\\eta_a}_{a \\in \\Sigma^\\eta}$ of ${\\cal A}$ and certain commutation relations $\\kappa$ among them. It yields a two-dimensional subshift and multi structure of Hilbert $C^*$-bimodules, which we call a Hilbert $C^*$-quad module. We introduce a $C^*$-algebra from the Hilbert $C^*$-quad module as a two-dimensional analogue of Pimsner's construction of $C^*$-algebras from Hilbert $C^*$-bimodules. We study the $C^*$-algebras defined by the Hilbert $C^*$-quad modules and prove that they have universal properties subject to certain operator relations. We also present its examples arising from commuting matrices.

  7. Dicty_cDB: SSL717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LTSTVLNYRKTQTS SEFTVSSAASYSGMYVESQADYEKENFPLN*rmdhflcfmcwchrftifhlyllqekl*k wn*kinnlkk*cllikkysiklknkkknkkki...e C: FIDNDFSNAEFEFVSGSSEGKWEPLAPNSQVQTNLTVIPKKSGIYSLTSTVLNYRKTQTS SEFTVSSAASYSGMY...VESQADYEKENFPLN*rmdhflcfmcwchrftifhlyllqekl*k wn*kinnlkk*cllikkysiklknkkknkkkikkkikfikk Homology vs CSM-cDNA

  8. Dicty_cDB: AHA345 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PLSKRLGFRANQR*tifrylvkr*skh*igyvg*c*y rc*m*ekirsfqsrlfkftirysfystcynrkeww*s*stnhh*sis*iffsr*keflpf gtcfgskrg...nfcn*k**wy--- ---LIEDHPYSSRFNEIFVQLLKPLSKRLGFRANQR*tifrylvkr*skh*igyvg*c*y rc*m*ekirsfqsrlfkftirysfystcynrke

  9. Dicty_cDB: VSF150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce *c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thfwl lcftrr*lhclwflqrwfr*nckpsrywwnfngiprqylisftt...QGKXLXVX Frame B: *c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thfwl lcftrr*lhclwflqrwfr*nckpsryww

  10. Dicty_cDB: VSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftrr*lhclwf...GXTXNPXEIGGTSXEXQXKXXLVLQQNGNXERLSXFXPDXGPNKKN Frame B: ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftr

  11. Dicty_cDB: CHJ469 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nk*ink*ink*INNNXMSNSNNNX--- ---***yxcxl**nfgw*nhfsxrf*c*c*rfn*kiisc**ns*igcfkgwci...nk*ink**xhe*lk**x--- ---mmixxxsiikfwlveslfx*vlmlmlki*lkdy*llielvdwvl*rmvh*mskiidg fliligkdyireeimdhsfxrfnikv

  12. Dicty_cDB: SSD544 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ts) Value N ( AU037369 ) Dictyostelium discoideum slug cDNA, clone SSD544. 696 0.0 1 ( AU052987 ) Dictyostelium discoideum slug... cDNA, clone SLF452. 680 0.0 1 ( AU039141 ) Dictyostelium discoideum slug... cDNA, clone SSM439. 680 0.0 1 ( AU038903 ) Dictyostelium discoideum slug cDNA, clone SSM121. 680... 0.0 1 ( AU034237 ) Dictyostelium discoideum slug cDNA, clone SLC307. 680 0.0 1 ( AU033908 ) Dictyostelium discoideum slug... cDNA, clone SLB601. 680 0.0 1 ( C94120 ) Dictyostelium discoideum slug cDNA, clone SSG432. 68

  13. The C-12/C-13 Ratio as a Chemistry Indicator (United States)

    Wirstroem, Eva; Geppert, Wolf; Persson, Carina; Charnley, Steven


    Isotopic ratios of elements are considered powerful tools, e.g. in tracing the origin of solar system body materials, or the degree of nucleosynthesis processing throughout the Galaxy. In interstellar molecules, some isotopic ratios like H/D and C-12/C-13 can also be used as indicators of their chemical origin. Isotope fractionation in gas-phase chemical reactions and gas-dust interaction makes observations of the ratio between C-12 and C-13 isotopologues suitable to distinguish between different formation scenarios. We will present observations of the C-12/C-13 ratio in methanol and formaldehyde towards a sample of embedded, massive young stellar objects. In relation to this we also present results from theoretical modeling showing the usefulness of the C-12/C-13 ratio as a chemistry indicator.

  14. Dicty_cDB: VHB238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tmvfkkvyhmxlcxlsifpkkhnf Frame C: pmhhnktfliyslinirtyk*rerctnssisrycfke*ysl*k*rkk*nfn*tmgin*tk c*krh*kysftrfrit...yqr*itkckisryssimlcirickekf *y*rtkrlyyesyy**frit--- ---astxketh*tirstnvgxfiqriqesinhhlrrgspchwchhlgfgc*frtll

  15. Dicty_cDB: SSM844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycw*icl*n*kaydqs*c*kshlfvc**yyptnccfnfsnl*tl*g*rwifihylqw *kyfw**fityynp*mysctlrerrppnvyrskq**fak*METLISFSYD...e A: s*yycw*icl*n*kaydqs*c*kshlfvc**yyptnccfnfsnl*tl*g*rwifihylqw *kyfw**fityynp*

  16. Dicty_cDB: SFI877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ighclpnixkminhxxliwxxyhhqlxxkxkvhqvxrfiqtlxt Frame C: *wk*vyfik*DLHXTXYIHILIFSNEN...rir**ffikeis*im*f*rixnyx y*ikglyiwrixxs*ldivypiyxr**iixi*fgxxttinxxkrxrfiksxxlfkh*xr Homology vs CSM-cDNA Sc

  17. Dicty_cDB: VFI753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vqeyiisndfennynvtisriiniryke diik*f**hikaswkilkn*nhqklh*ykfikntf Frame C: fkffqs*k*lysvikwyhkakmm*kyn*myknisyqmilk...*lysvikwyhkakmm*kyn*myknisyqmilkiitm*qfqelltfdikk i**nsfnnt*klhgkf*kiktikncininslkih Homology vs CSM-cDNA Sc

  18. Dicty_cDB: SLF813 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available discoideum chromosome 2 map 6163571... 468 e-137 2 ( C23695 ) Dictyostelium discoideum gamete cDNA, clone F...C-AK02. 468 e-137 2 ( AU284631 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 468 e-137 2 ( AU284449... ) Dictyostelium discoideum gamete cDNA clone:FC-AW0... 468 e-137 2 ( AU284368 ) ...Dictyostelium discoideum gamete cDNA clone:FC-AP1... 468 e-137 2 ( AU284518 ) Dictyostelium discoideum gamete... cDNA clone:FC-BB0... 468 e-137 2 ( AU284520 ) Dictyostelium discoideum gamete cDNA clone:FC-BB0... 468 e-1

  19. Dicty_cDB: VSH364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ome 2 map 5515173... 254 2e-73 2 ( AU284312 ) Dictyostelium discoideum gamete cDNA clone:FC-AK1... 254 2e-73... 2 ( C23652 ) Dictyostelium discoideum gamete cDNA, clone FC-AG13. 254 2e-73 2 ( AU284996 ) Dictyostelium discoideum gamete... cDNA clone:FC-BS1... 254 2e-73 2 ( AU284930 ) Dictyostelium discoideum gamete... cDNA clone:FC-BQ0... 254 2e-73 2 ( AU284889 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1...... 254 2e-73 2 ( C92427 ) Dictyostelium discoideum slug cDNA, clone SSE533. 254 2e-73 2 ( AU284467 ) Dictyostelium discoideum gamete

  20. C-SiC Honeycomb for Advanced Flight Structures Project (United States)

    National Aeronautics and Space Administration — The proposed project is to manufacture a C-SiC honeycomb structure to use as a high temperature material in advanced aircraft, spacecraft and industrial...

  1. Dicty_cDB: VSI530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vnqn*erkfalv*lsdke ntgrermvftsiskitlvlcviqkvkskvtfsdqsprnapiygqrlppmpvplfk*IHIK LKQYKKK--- ---MNSADNSGAKNLYV...Frame C: *tvliilvpkiytslpskvskvv*idyhpqvlviwswlpskrvnqn*erkfalv*lsdke ntgrermvftsiskitlvlcviqkvkskvtfsdqsprnapiygqrlppm...qn*erkfalv*ls dkentgrermvftsiskitlvlcviqkvkskvtfsdqsprnapiygqrlppmpvplfk*i hiklkq Homology vs CSM-cDNA Score

  2. Dicty_cDB: SSF506 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kki Frame B: ---iiiiiiiiiiapiliktqanikk*sin*lilfi*ikkkh*ivnysknfkitnlrk* Frame C: ---*********slpf*skprris...ksdqsin*yclyeskknik**iivkilksli*en Homology vs CSM-cDNA Score E Sequences producing

  3. Dicty_cDB: AFJ756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N BM094322 |BM094322.1 saj14a08.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS...lycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-455 5' similar to TR:O04336 O04336 ELICITOR RESPONSE... Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1060-684 5' similar to TR:O0...Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-5007 5' similar to TR:Q9ZUI7 Q9ZUI7 T2K10.11 PROTEI

  4. Dicty_cDB: VSA585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2000. 2.21 Translated Amino Acid sequence ---kllklsfyflvllls*c*gvslplcfallssssdnl... Acid sequence (All Frames) Frame A: ---kllklsfyflvllls*c*gvslplcfallssssdnlelh*rcsssilrvnpshsyat lsnv*AVFNQ

  5. Dicty_cDB: SHF860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAT sequence update 2002.10.25 Translated Amino Acid sequence flvllls*c*gvslplcfalls...sitflcnslkcissl*qk kifkkk--- ---LFGASVKIMIRCLXPPLLCITLLKLR*srapltmllkypqg*sitflcnslkcissl *qkk Frame B: flvllls*c*gvslplcfalls...sssdnlelh*rcsssilrvnpshsyatlsnv*AVFNKK KYLKKK--- ---flvlllr***gvxxplcfalls

  6. Demonstration of SiC Pressure Sensors at 750 C (United States)

    Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender


    We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

  7. Dicty_cDB: SFI706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42 0.036 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1...NA clone cTOF19D15 5' sequence, mRNA sequence. 38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Corn...lone cTOE14I10 5' sequence, mRNA sequence. 38 0.10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Corn...ell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic acid 4-hydroxyla...ell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38 0.10 2 AE003601 |

  8. Dicty_cDB: VFF382 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esc...root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clon...i cDNA clone cLPP8K18 5' sequence, mRNA sequence. 92 3e-15 2 BG642411 |BG642411.1 EST355887 tomato flower buds, anthesis, Cornell... flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequence. 92 2e... esculentum cDNA clone cTOE2D11 5' sequence, mRNA sequence. 92 2e-16 3 AW217896 |AW217896.1 EST296610 tomato

  9. Dicty_cDB: VFM647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst

  10. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  11. Dicty_cDB: CHQ769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al

  12. Dicty_cDB: VFH554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

  13. Dicty_cDB: CFC518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxdnkkxvetxrcvsithvlhy*lnn Translated Amino Acid sequ...ence (All Frames) Frame A: ---ervkfknt*istmvxvfnxsp*slitslxlsqn*dlvvslssxfqkhtihhsxrnyn xlh*klkxxwtl*rnytf*x...YTSLRXKLQX SSLEIKEXLDTLEKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxd

  14. Dicty_cDB: AFB770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c fhrfrw*ryqsyv*s*twysfwxc*tiipsiscxftcxlsfxls Translated Amino Acid sequence (All Frames) Frame A: ttlqkdnn...grpfefkdrclwlss*s*kirsl*yhqic fhrfrw*ryqsyv*s*twysfwxc*tiipsiscxftcxlsfxls Frame C: nttkrq*LLIRMVLQFVDDSSCKX

  15. Walter C. Williams (United States)


    Walter C. Williams arrived from the National Advisory Committee for Aeronautics, Langley Memorial Aeronautical Laboratory, Hampton, Virginia, on September 30, 1946, at the Muroc Army Air Field. He had been named the engineer-in-charge of the small group of five that came with him to the Rogers Dry Lakebed to take part in research flights of a joint NACA-Army Air Forces program involving the rocket-powered Bell XS-1. This established the first permanent National Advisory Committee for Aeronautics presence at the Mojave Desert site in California. This small group grew in numbers to 27 and received permanent status as the NACA Muroc Flight Test Unit from Hugh L. Dryden, NACA's Director of Research, on September 27, 1947. Walt was named Head of the Unit. On November 14, 1949, the Unit along with the 100 employees became the NACA High-Speed Flight Research Station with Walt Williams as Chief. Next came the move from the South Base site to the new headquarters, Bldg. 4800 on the north-west shore of the Rogers Dry lakebed on the Edwards Air Force Base complex. July 1, 1954 saw another name change to the NACA High-Speed Flight Station with Walt remaining the Chief to a complement of about 225 employees. Williams had received a Bachelor of Science Degree in aeronautical engineering from Louisiana State University, Baton Rouge, Louisiana, in 1939. After graduation, he was employed by the Glenn L. Martin Company of Baltimore, Maryland, and later that same year joined the staff of the NACA Langley Memorial Aeronautical Laboratory, where he worked as an engineer in the Flight Division. During the period from September 1946 to July 1954 Williams supervised the activities of several research projects. These included the first successful rocket-powered flight of the XS-1 made by Bell pilot Chalmers Goodlin on December 9, 1946; the record breaking flight of A.F. Captain Chuck Yeager on October 14, 1947, that exceeded the speed of sound; and the first flight of the jet

  16. Dicty_cDB: VHA442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AFT SEQUENCE, 21 unordered pieces. 42 3e-04 2 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssow...ii Tamarix androssowii cDNA, mRNA sequence. 58 4e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssow...ii leaf Tamarix androssowii cDNA, mRNA sequence. 58 4e-04 1 AC146990 |AC1469

  17. Dicty_cDB: CHR188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , complete sequence. 50 2e-04 2 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssow...ii Tamarix androssowii cDNA, mRNA sequence. 58 2e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssow...ii leaf Tamarix androssowii cDNA, mRNA sequence. 58 2e-04 1 AC146990 |AC146990.2 Lytechinu

  18. Dicty_cDB: CHG233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 66 2e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...pighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, ...mRNA sequence. 90 9e-14 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  19. Dicty_cDB: VSG402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M058328 |BM058328.1 2189-54 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA...d cDNA library Ctenocephalides felis cDNA clone 2163-12, mRNA sequence. 42 3.7 1 ... clone 2189-54, mRNA sequence. 42 3.7 1 BM057177 |BM057177.1 2163-12 hindgut and Malpighian tubule subtracte

  20. Dicty_cDB: SHG302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ;, mRNA sequence. 66 3e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...ighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, m...RNA sequence. 82 3e-11 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  1. Dicty_cDB: SHA868 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 66 3e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...bule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA seque...nce. 90 1e-13 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  2. Dicty_cDB: SSL266 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NXGDRXNVYXDFSYFFFFFKKKKQTKQVYFHFFFFKKKAIL S*minkeiffqfinpikl*iiniffiqkkkkkkk Translated Amino Acid sequence ...FSYFFFFFKKKKQTKQVYFHFFFFKKKAIL S*minkeiffqfinpikl*iiniffiqkkkkkkk Frame C: qiinth

  3. Dicty_cDB: VHO714 [Dicty_cDB

    Lifescience Database Archive (English)


  4. Dicty_cDB: SSF826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LGGSMVKQPFAIGGSGSTYIYGYCDSKFKPKMTKDECIEFVQNSLALAMFRDGSSGGV IRLCIIDKNGVERKMIPGNNLPRFWEG*fsni*imiginhayniivkk*... IRLCIIDKNGVERKMIPGNNLPRFWEG*fsni*imiginhayniivkk*lkkn Frame C: ---li*vlllwq*nmmvvllwvqiqelplvhisqielqtklpqf

  5. Dicty_cDB: SFD878 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ftinefnsmwwwlwk writrwswwsrwwsscwywcncwfcftrsrfhfnwrfkqlwl*lklknykyilnklkink v*lf...vnvkkk--- ---ytkqnknktkqnk*ndnlrfnlfnw*c*infkik*fiiiikfiifftinefnsmwww lwkwritrwswwsrwwsscwywcncwfcftrsrfhfn

  6. Dicty_cDB: CHS164 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available utrients Pinus taeda cDNA clone RTMNUT1_37_B06_A029 5', mRNA sequence. 54 2e-11 4 C...icon esculentum cDNA clone cLEG49G24 5' end, mRNA sequence. 58 7e-12 2 DR181209 |DR181209.1 RTMNUT1_37_B06.g2_A029 Roots minus micron

  7. Dicty_cDB: VSI673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IYKDKKAQLVTLPGAKGIFGVAKNHVPRIAELKPGVIQINHENGDLEKFFISGGFAFVN PDASCYINTIEAVPIDQLDAEGS*kwfklvtlnstmmlkrenakaval...FISGGFAFVN PDASCYINTIEAVPIDQLDAEGS*kwfklvtlnstmmlkrenakavaligletyqqmgic lwc Frame C: slfnsykktsnnke*sdqllnqa

  8. Dicty_cDB: AFM535 [Dicty_cDB

    Lifescience Database Archive (English)


  9. Dicty_cDB: VSJ119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kr Frame C: fsksqi*lkkkmttigpieneikelltkelnpinleiinesymhnvpkgseshfkvkivs ekfetlsmieqhrlvneil...kelnpinleiinesymhnvpkgsesh fkvkivsekfetlsmieqhrlvneilknfigngkihalsitsrtptqgkkiikqksmlmm inhhlvkevw*ikke Homo

  10. Dicty_cDB: CHR636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

  11. Dicty_cDB: SHA609 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IVDFGLCVDANERKLVHMAGSPFWMSPEMIRGESYGCPTDIWSFAICLLELANGEPPHR KSSLPXYVHXCN*gxcrxgqt*kmdrtlysflkslfrngsfkeincrt...CPTDIWSFAICLLELANGEPPHR KSSLPXYVHXCN*gxcrxgqt*kmdrtlysflkslfrngsfkeincrttfktslx*fi*k Frame C: ykfisishivfis*

  12. Dicty_cDB: CHC160 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kgfxgvikrwgvrklprkthkglrkvacigawhpsrvsttvpragqlgyhhr vernkkiyrigqaqpedgkqistgktefdltektinpmggfahygmvkheflmlkgcvag prkraltlrksittqtgra...alekitlkfidtsskfghglhqtaedktkyfgvkksr Frame C: kqq*qyess*i*sstsr*srfqtkkesrqtsr*sqv

  13. Dicty_cDB: SLE739 [Dicty_cDB

    Lifescience Database Archive (English)


  14. Dicty_cDB: VFC294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available copersicon pennellii cDNA clone cLPP17G1 5' sequence, mRNA sequence. 72 3e-11 3 BG131085 |BG131085.1 EST463977 tomato crown...y Lycopersicon esculentum cDNA clone cLEZ13A13 5', mRNA sequence. 68 3e-10 3 BG133537 |BG133537.1 EST466525 tomato crown

  15. Dicty_cDB: VFG517 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycopersicon pennellii cDNA clonecLPP17G1 5' sequence, mRNA sequence. 92 6e-16 3 BG131085 |BG131085.1 EST463977 tomato crown...culentum cDNA clone cTOD11C15 5' end, mRNA sequence. 92 1e-14 2 BG133537 |BG133537.1 EST466525 tomato crown

  16. Dicty_cDB: VFE361 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available on pennellii cDNA clone cLPP17G1 5' sequence, mRNA sequence. 92 3e-16 3 BG131085 |BG131085.1 EST463977 tomato crown...m cDNA clone cSTS30D8 5' sequence, mRNA sequence. 90 2e-14 2 BG133537 |BG133537.1 EST466525 tomato crown

  17. Dicty_cDB: VSC875 [Dicty_cDB

    Lifescience Database Archive (English)


  18. Dicty_cDB: VSE856 [Dicty_cDB

    Lifescience Database Archive (English)


  19. Dicty_cDB: VSG886 [Dicty_cDB

    Lifescience Database Archive (English)


  20. Dicty_cDB: SSJ321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ish DNA sequence from clone DKEY-5P1 in linkage group 20. 46 0.59 1 BQ476622 |BQ476622.1 curculio...3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06 3', mRNA sequence. 4...0.59 1 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06

  1. Dicty_cDB: VSI829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lio4h01.g Curculio glandium cDNA Curculio glandium cDNA clone curculio4h01 3', mRNA... sequence. 54 2e-08 3 BQ476431 |BQ476431.1 curculio4h01.b Curculio glandium cDNA Curculio glandium cDNA clone curculio...ideum chromosome 2 map 6163571-6199719 strain AX4, complete sequence. 846 0.0 5 BQ476680 |BQ476680.1 curcu

  2. Dicty_cDB: SSJ346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.097 4 BQ476381 |BQ476381.1 curculio4b06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio..., WORKING DRAFT SEQUENCE, 8 ordered pieces. 36 0.19 6 BQ476658 |BQ476658.1 curculio4b06.g Curculio glandium ...cDNA Curculio glandium cDNA clone curculio4b06 3', mRNA sequence. 38 0.21 2 AF462

  3. Dicty_cDB: VSE575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rchaeoglobus fulgidus section 5 of 172 of the complete genome. 46 0.26 1 BQ476340 |BQ476340.1 curculio...3e06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06 5', mRNA sequen...ce. 46 0.26 1 BQ476622 |BQ476622.1 curculio3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio

  4. Dicty_cDB: VFA149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence lpiyxlniggishrfqixdktstsytlqfhgskipvtvlspeedllcqympvkktvdssn slispmpgtilslav...VEAMKMQNVLRAPKDC*iksinvkpvk sflx*vxxf Frame C: lpiyxlniggishrfqixdktstsytlqfhgskipvtvlspeed

  5. Dicty_cDB: VHN217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 ) Dictyostelium discoideum cDNA clone:ddv50l04, 3' ... 1094 0.0 3 ( BJ442653 )... Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 1076 0.0 4 ( BJ445359 ) Dictyostelium discoideum cDNA ...clone:ddv59a09, 3' ... 1007 0.0 3 ( BJ442499 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 999 0.0

  6. Dicty_cDB: VHI341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iscoideum cDNA clone:ddv51k15, 3' ... 1447 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50...m24, 3' ... 1447 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ...... 1447 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1447 0.0 1 ( BJ442218 ) Dict

  7. Dicty_cDB: VHO672 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ictyostelium discoideum cDNA clone:ddv51k15, 3' ... 1465 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50...m24, 3' ... 1465 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1465 0.0 1... ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1465 0.0 1 ( B

  8. Dicty_cDB: VHK894 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iscoideum cDNA clone:ddv51k15, 3' ... 1467 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50m24, ...3' ... 1467 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1467 0.0 1 ( BJ442731 ) ...Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1467 0.0 1 ( BJ442218 ) Dict

  9. Dicty_cDB: VHJ523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N ( BJ442531 ) Dictyostelium discoideum cDNA clone:ddv50m05, 3' ... 1772 0.0 1 ( BJ443457 ) Dictyos...v31j09, 3' ... 1655 0.0 2 ( BJ442583 ) Dictyostelium discoideum cDNA clone:ddv50g...7 ) Dictyostelium discoideum cDNA clone:ddv50o17, 3' ... 1628 0.0 2 ( BJ442656 ) Dictyostelium discoideum cDNA clone:ddv50

  10. Dicty_cDB: VHN889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , 3' ... 1463 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50m24, 3'... ... 1463 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1463 0.0 1 ( BJ442731 ) Di...ctyostelium discoideum cDNA clone:ddv50e24, 3' ... 1463 0.0 1 ( BJ442218 ) Dictyostelium discoideum cDNA clo

  11. Dicty_cDB: VHJ736 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N ( BJ442585 ) Dictyostelium discoideum cDNA clone:ddv50h...Dictyostelium discoideum cDNA clone:ddv17m03, 3' ... 1162 0.0 1 ( BJ423840 ) Dictyostelium discoideum cDNA clone:ddv50...g16, 5' ... 105 3e-18 1 ( BJ423768 ) Dictyostelium discoideum cDNA clone:ddv50h09, 5' ... 105 3e-1

  12. Dicty_cDB: VHJ530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BJ443368 ) Dictyostelium discoideum cDNA clone:ddv52o18, 3' ... 1451 0.0 1 ( BJ442687 ) Dictyostelium discoideum cDNA clone:ddv50...m18, 3' ... 1451 0.0 1 ( BJ442596 ) Dictyostelium discoideum cDNA clone:ddv50...451 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50a11, 3' ... 1445 0.0 1 ( BJ438342 ) Dictyost

  13. Dicty_cDB: VHJ654 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 674 ) Dictyostelium discoideum cDNA clone:ddv50k14, 3' ... 1457 0.0 1 ( BJ442828 ) Dictyostelium discoideum ...8 0.0 1 ( BJ442759 ) Dictyostelium discoideum cDNA clone:ddv50k20, 3' ... 1392 0....discoideum cDNA clone:ddv57b24, 3' ... 1390 0.0 1 ( BJ442507 ) Dictyostelium discoideum cDNA clone:ddv50h05,

  14. Dicty_cDB: VHH260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ideum cDNA clone:ddv54o16, 5' ... 1090 0.0 1 ( BJ423883 ) Dictyostelium discoideum cDNA clone:ddv50...o17, 5' ... 1090 0.0 1 ( BJ423839 ) Dictyostelium discoideum cDNA clone:ddv50g15, 5' ... 1...090 0.0 1 ( BJ423765 ) Dictyostelium discoideum cDNA clone:ddv50g12, 5' ... 1090 0.0 1 ( BJ423178 ) Dictyost

  15. Dicty_cDB: VHJ539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Dictyostelium discoideum cDNA clone:ddv50m09, 3' ... 1366 0.0 1 ( BJ442759 ) D...ictyostelium discoideum cDNA clone:ddv50k20, 3' ... 1358 0.0 1 ( BJ441455 ) Dictyostelium discoideum cDNA cl... 1336 0.0 1 ( BJ442696 ) Dictyostelium discoideum cDNA clone:ddv50o16, 3' ... 1336 0.0 1 ( BJ437729 ) Dictyo

  16. Dicty_cDB: VHK322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Dictyostelium discoideum cDNA clone:ddv51l05, 3' ... 1441 0.0 1 ( BJ442780 ) Dictyostelium discoideum cDNA clone:ddv50...o20, 3' ... 1441 0.0 1 ( BJ442687 ) Dictyostelium discoideum cDNA clone:ddv50...m18, 3' ... 1441 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50a11, 3' ... 1441 0.0 1

  17. Dicty_cDB: VHJ814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available J442525 ) Dictyostelium discoideum cDNA clone:ddv50l04, 3' ... 1501 0.0 1 ( BJ437...847 ) Dictyostelium discoideum cDNA clone:ddv35f17, 3' ... 1320 0.0 2 ( BJ442499 ) Dictyostelium discoideum cDNA clone:ddv50...g01, 3' ... 1310 0.0 2 ( BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 129

  18. Dicty_cDB: VHK888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 1348 0.0 1 ( BJ442780 ) Dictyostelium discoideum cDNA clone:ddv50o20, 3' ... ...1348 0.0 1 ( BJ442687 ) Dictyostelium discoideum cDNA clone:ddv50m18, 3' ... 1348 0.0 1 ( BJ442548 ) Dictyos...telium discoideum cDNA clone:ddv50a11, 3' ... 1348 0.0 1 ( BJ441725 ) Dictyostelium discoideum cDNA clone:dd

  19. Dicty_cDB: VHP357 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ctyostelium discoideum cDNA clone:ddv51k15, 3' ... 1467 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50...m24, 3' ... 1467 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50...l21, 3' ... 1467 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1467 0.0 1 ( BJ

  20. Dicty_cDB: SLA476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone SLA476. 1154 0.0 1 ( BJ442525 ) Dictyostelium discoideum cDNA clone:ddv50l...9 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 1104 0.0 2 ( BJ438430 ) Dictyostelium discoideum cD... BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 1011 0.0 3 ( BJ385501 ) Dictyostelium disco

  1. Dicty_cDB: SHA333 [Dicty_cDB

    Lifescience Database Archive (English)


  2. Dicty_cDB: SHH353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qrqdglmvlqf**qlyw*lvlhh*misrikldlen*v trvtirklkvfvvvnnvkyqysmsrlvilshwtlvipfvpmvf...DPFLISGSMVIEGFGTMLVTAVGVNSFNGKTMMGLRVASEDTPLQMK LSVLASRIGYFGMGAAILMLLIAI--- Frame C: *yf**wqq*cqlywvqliihqii

  3. Singlet H-cCNC-C:A Potential Interstellar Molecule

    Institute of Scientific and Technical Information of China (English)

    Hai Tao YU; Ming Xia LI; Hong Gang FU; Bai Fu XING; Jia Zhong SUN


    A new planar isomer of HNC3 system, H-cCNC-C, is theoretically predicted by means of B3LYP and CCSD(T) methods. The suggested species can isomerize into other five kinetically more stable isomers, which have been experimentally identified, with relatively higher reaction barriers. In view of its higher kinetic stability, we can reasonably believe that the obtained species H-cCNC-C can be experimentally observed in future studies.

  4. Dicty_cDB: SSJ391 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**nr...** lk Frame C: ---gxgi*gcvdiqvrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**

  5. Dicty_cDB: SSD274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one QHM6D05, mRNA sequence. 58 1e-04 1 CB084130 |CB084130.1 hq10c11.b1 Hedyotis centranthoides flower - Stage 2 (NYBG) Hedyotis... centranthoides cDNA clone hq10c11, mRNA sequence. 50 0.026 1 CB084528 |CB084528.1 hq16g12.b1 Hedyotis... centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA

  6. Dicty_cDB: SSJ373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 58 7e-05 1 CB084130 |CB084130.1 hq10c11.b1 Hedyotis centranthoides flower - Stage 2 (NYBG) Hedyotis ...centranthoides cDNA clone hq10c11, mRNA sequence. 50 0.016 1 CB084528 |CB084528.1 hq16g12.b1 Hedyotis centra...nthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hq16g12, mRNA

  7. Dicty_cDB: CFF880 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2191 |BQ512191.1 EST619606 Generation of a set of potato cDNA clones for microarray analyses mixed potato ti... |BQ512190.1 EST619605 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissue...8865.1 EST556401 potato roots Solanum tuberosum cDNA clone cPRO2F7 5' end,mRNA sequence. 52 9e-14 4 BQ512190

  8. Dicty_cDB: VSB133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 12191 |BQ512191.1 EST619606 Generation of a set of potato cDNA clones for microarray analyses mixed potato t...0 |BQ512190.1 EST619605 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissu...8865.1 EST556401 potato roots Solanum tuberosum cDNA clone cPRO2F7 5' end, mRNA sequence. 52 2e-14 4 BQ51219

  9. Dicty_cDB: AFH387 [Dicty_cDB

    Lifescience Database Archive (English)


  10. Dicty_cDB: SHA139 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- ---IDSKLFNSLRENYKNNITFLPTLERIKKXXSYQLMKTISEX*kttfxiliii Frame C: *iqnclilcvki...tkti*lfyqhlkdqkmisyqlmkqfqklknsfkiliiisni*yliypl kkk--- ---*iqnclilcvkitkti*lfyqhlkeskkxxhin**kqfqkxkklllxf*

  11. Dicty_cDB: VHJ628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lasmodium falciparum MAL3P7. 38 0.058 3 BF298113 |BF298113.1 060PbD12 Pb cDNA #17, Tommaso Pace, Marta Ponzi...cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5..., and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequence. 38 0.071 2 BF298182 |BF298182.1 061PbD05 Pb

  12. Dicty_cDB: SSF313 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nts: (bits) Value N BF298113 |BF298113.1 060PbD12 Pb cDNA #17, Tommaso Pace, Marta...D05 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequence. 52...BF295739 |BF295739.1 027PbF11 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei

  13. Dicty_cDB: SSA615 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stage Eimeria tenella cDNA 5', mRNA sequence. 32 3.3 2 BG516652 |BG516652.1 EtESTed59d07.y1 Eimeria tenella S5-2 cDNA Neg Selected... |BG516015.1 EtESTed47h06.y1 Eimeria tenella S5-2 cDNA Neg Selected Eimeria tenella cDNA 5', mRNA sequence.

  14. Dicty_cDB: SSJ623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iversity Solanum tuberosum cDNA clone cSTA43O5 5' sequence, mRNA sequence. 44 4e-16 5 BG098716 |BG098716.1 EST463235 sprouting...NA sequence. 44 8e-16 5 BG098390 |BG098390.1 EST462909 sprouting eyes/shoots Solanum tuberosum cDNA clone cS

  15. Dicty_cDB: VFN350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2001.11.22 Translated Amino Acid sequence iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaick... C: iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaickakrg afketapddllapvikhiikvtkldpn*LEMLLWEQYYQDHHK

  16. Dicty_cDB: CFG834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one BACR23H21, complete sequence. 42 0.038 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycope...38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 si....10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, m

  17. Dicty_cDB: AFF758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC Library) complete sequence. 42 0.070 5 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersi... 0.074 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 sim... EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1,

  18. Dicty_cDB: CHD312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mplete sequence. 42 0.056 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum...6 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic...I773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38

  19. Dicty_cDB: AFL147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ' sequence, mRNA sequence. 42 0.16 2 BE471638 |BE471638.1 EST416491 potato stolon, Cornell University Solanu...ST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA sequence. 42 0.17 2 ...m tuberosum cDNA clone cSTA29J22, mRNA sequence. 42 0.16 2 BE343505 |BE343505.1 E

  20. Dicty_cDB: AFK872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ACR23H21, complete sequence. 42 0.051 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersico...12 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar... AI773934 |AI773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA s

  1. Dicty_cDB: CHA214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2D11 5' sequence, mRNA sequence. 92 6e-16 3 AW217896 |AW217896.1 EST296610 tomato flower buds, anthesis, Cornell...-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES3N17...root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA sequence. 9

  2. Dicty_cDB: AHB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5...i aconitase mRNA, partial cds. 58 6e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...1 EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10

  3. Dicty_cDB: SFH756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PVSDNQ CQCSVGFSGDDCRQCDNGMVLWASDNGIPMCSPLNSLGKPKTCYAAY Frame B: ---xxxxxxxxxxxxxxxxxxkxxxxx*xxivnwhxxqvlvgsl...vhh*ihwvnqkpvmll Frame C: ---xxxxxxxxkxxxxxxxaxxxxxxxsxx*xigxxxkc*wvrfxk*lyvlxv*w

  4. Dicty_cDB: CHA864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ---XXXXXXXXXXXXXXXXXXXXXXMXXXIEXXXAAXESXXHGSXXFXYIMRDGXLERXX Frame B: ---xxxxxxxxxxxlxxxxxxxxxxcxvx*rxxx...qqxspxxmdxpfsxil*emvnwkexx Frame C: ---xxxxxxxxxvxxxxxxxxxxxxaxxyre

  5. Dicty_cDB: CFH318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: ---VXQXXLXXGIFXSXXVXKPGIFXIXXXGTGAXPGACWKLKKXAKXKXXXX Frame B: ---xxxxxxxxgfsfpxxxknpgflxlxxx...glgpxxghvgn*kxxxkxxsix Frame C: ---xxxxxxxxdfxfxxsxktrdf*xxlxxdwgpsxgmleiekxxxx

  6. Dicty_cDB: CHA554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIQILNSYFIFLYIVTFHKKKKKKKNLKXXXFXKKK--- ---xxxxxxxxxxxxxxxxxxxxvxxxmsxxxxxcxg*xwxxlcxxxxrxixr*fixrxi rwssr F...GXS GGHP Frame C: ihfyytnikfifyfsiycnis*kkkkkkkfkxxxfxkkk--- ---xxxxxxxxxxxsxxxxxxscxxxyvxlxxxvxrivmxxx

  7. Dicty_cDB: CFJ554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: ---LFPHCSENXLXXXQREXTTXPXRNXPRXGHXSALXXXXRXXXXRPSCTN Frame B: ---sfltvpktxxxxprexxqhxpxexnqdxdtxahxxxxxxxxxx...ghlvq Frame C: ---lsslfrkxaxxxperxxntpx*kxtkxwtlxrtxxxxsxxxxxailyk Hom

  8. Dicty_cDB: CFH854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Lab Zea mays cDNA, mRNA sequence. 42 6e-12 4 BI674812 |BI674812.1 949067E10.y2 949 - Juvenile leaf and shoot cDNA from Steve...BI478599.1 949067E10.x1 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence. 42

  9. Dicty_cDB: CHR344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 576.1 NF031C11ST1F1000 Developing stem Medicago truncatula cDNA clone NF031C11ST 5', mRNA sequence. 42 4.0 1... GR__Ea21F12.f GR__Ea Gossypium raimondii cDNA clone GR__Ea21F12 5', mRNA sequence. 42 4.0 1 AW690576 |AW690

  10. Dicty_cDB: CHA820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 C4 gene, exon 9 and partial cds; and endogenous retrovirus ERV-K(C4), partial sequence. 32 9.3 3 AY224375 |AY224375.1 sphinx Mandrill.1119 C4 gene, exon 9 and partial cds; and

  11. Dicty_cDB: VFD860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon...9099.1 EST414391 tomato developing/immature green fruit Lycopersicon esculentum c... Cornell University Lycopersicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.038 1 BE459099 |BE45

  12. Dicty_cDB: SHB481 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5_075 Brachypodium distachyon developing spike EST library Brachypodium distachyon cDNA clone 5484_C09_E18, ...257_H11_P21, mRNA sequence. 42 7.6 1 DV474787 |DV474787.1 5484_C09_E18ZE5_075 Brachypodium distachyon developing

  13. Dicty_cDB: VHC687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CE, 21 unordered pieces. 42 3e-04 2 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssowii Tamarix androssow...ii cDNA, mRNA sequence. 58 4e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssowii leaf Tamarix androssow

  14. Dicty_cDB: CFC796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 58 9e-07 2 CF806266 |CF806266.1 psHB007xC07f USDA-IFAFS:Expression of Phytophthora sojae genes during infection and propaga...tion Phytophthora sojae cDNA clone sHB007C07 5, mRNA seq

  15. Dicty_cDB: VSD656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- Frame C: qltlklihi*kllnfklfqnnikiknkk*kk--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value...12. 5 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC044805 | vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54C22) RecName: Full=Origin

  16. Dicty_cDB: AHA302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 BM301463 |BM301463.1 MCR046C02_25968 Ice plant Lambda Uni-Zap XR expression library, 48 hours NaCl treatment prescreened for of highly abundant transcripts Mesembryanthemum crystallinum cDNA clone MCR046C0

  17. Dicty_cDB: CFG804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nome. 68 2e-14 3 BU041060 |BU041060.1 PP_LEa0008C18f Peach developing fruit mesocarp Prunus persica cDNA clo...iheyensis genomic DNA, section 11/13. 50 2e-05 10 BU040467 |BU040467.1 PP_LEa0006C14f Peach developing fruit

  18. Dicty_cDB: SFH515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N BG133537 |BG133537.1 EST466525 tomato crown gall Lycopersicon esculentum cDNA clonecT...m cDNA clone cTOD22O12 5' end, mRNA sequence. 72 1e-09 2 BG131085 |BG131085.1 EST463977 tomato crown

  19. Dicty_cDB: SHE789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 36 1.0 4 CD453775 |CD453775.1 WHE2108_D02_H04ZT CS wheat salt-stressed crown cDNA library Triticum aestivum..._H04ZY Wheat salt-stressed crown cDNA library Triticum aestivum cDNA clone WHE2108_D02_H04, mRNA sequence. 4

  20. Dicty_cDB: SFJ641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ellii cDNA clonecLPP17G1 5' sequence, mRNA sequence. 92 6e-16 3 BG131085 |BG131085.1 EST463977 tomato cTOD11C15 5' end, mRNA sequence. 92 1e-14 2 BG133537 |BG133537.1 EST466525 tomato crown

  1. Dicty_cDB: AFH216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BM260251.1 baa17f06.x1 Cassava EYC library1 Manihot esculenta cDNA 3' similar to...SC cDNA library Populus alba x Populus glandulosa cDNA clone PopSC00059, mRNA sequence. 46 1e-06 2 BM260251

  2. Dicty_cDB: VFF578 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available berghei genomic 3', DNA sequence. 68 1e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and ...9139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA sequence. 68 1

  3. Dicty_cDB: AFB336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA se...quence. 68 3e-13 2 BF299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowell and

  4. Dicty_cDB: AFF451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Plasmodium berghei genomic 3', DNA sequence. 68 3e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles...299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA se

  5. Dicty_cDB: CFH434 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and Jane Carlt...on Plasmodium berghei cDNA 5', mRNA sequence. 68 3e-12 2 BF299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles

  6. Dicty_cDB: VFD589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', m...RNA sequence. 68 1e-12 2 BF299139 |BF299139.1 069PbF12 Pb cDNA #20, Charles Yowel

  7. Dicty_cDB: AFG366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m berghei genomic 3', DNA sequence. 68 2e-12 2 BF298951 |BF298951.1 068PbG10 Pb cDNA #20, Charles Yowell and...99139.1 069PbF12 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium berghei cDNA 5', mRNA sequence. 68

  8. Dicty_cDB: SLA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m discoideum slug cDNA, clone SLA423. 470 0.0 3 ( ES615204 ) NGPAP47TR NGPA Nasonia giraulti cDNA, mRNA sequ.... 50 2e-05 2 ( EV418706 ) 210774888 NGP Nasonia giraulti cDNA clone 128A21 ... 40 3e-05 3 ( AP006852 ) Candi

  9. Dicty_cDB: VSC244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gene for cytochrome c, partial sequence, country:Japan:Okinawa. 30 0.12 3 BQ476583 |BQ476583.1 curculio2h12....g Curculio glandium cDNA Curculio glandium cDNA clone curculio2h12 3', mRNA seque

  10. Dicty_cDB: SSC532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c, partial sequence, country:Japan:Okinawa. 30 0.21 3 BQ476298 |BQ476298.1 curculio2h12.b Curculio glandium... cDNA Curculio glandium cDNA clone curculio2h12 5', mRNA sequence. 46 0.37 1 dna update 2003. 7.28 Homology

  11. Dicty_cDB: AFE557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 46 0.018 2 BM158718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Vertical...5_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV_039_C05 5', mRNA sequence. 46 0.019 2 AW

  12. Dicty_cDB: SFB745 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ypanosoma cruzi strain Colombian... 563 e-159 FJ807243_1( FJ807243 |pid:none) Peranema trichophorum strain C...rypanosoma cruzi strain Dm 28 c c... 563 e-159 AY785657_1( AY785657 |pid:none) Tr

  13. Dicty_cDB: SHJ738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9.1 PL05017A1F05 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 3', mRNA sequence. 34 1....7 2 DN301936 |DN301936.1 PL04024A1H02 cDNA from sexually mature hermaphodites Sc

  14. Dicty_cDB: SHF685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 994.1 PL05007A2E05 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 3', mRNA sequence. 52... 0.011 1 DN295438 |DN295438.1 PL03019B2F09 cDNA from sexually mature hermaphodite

  15. Dicty_cDB: SHD287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 17 1 DN307050 |DN307050.1 PL05012B2H02 cDNA from sexually mature hermaphodites Schmidtea mediterranea cDNA 3...', mRNA sequence. 48 0.069 1 DN299510 |DN299510.1 PL04016A2B03 cDNA from sexually mature hermaphodites Schmi

  16. Dicty_cDB: SHJ718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 44 0.89 1 DN307545 |DN307545.1 PL05014A2B03 cDNA from sexually mature hermaphodites Schmidtea medite...rranea cDNA 3', mRNA sequence. 44 0.89 1 DN300133 |DN300133.1 PL04018A2E08 cDNA from sexually

  17. Dicty_cDB: VHA842 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hyrhizi TW72-1 germinating urediniospores on water surface (20C/16 hours/dark) Phakopsora pachyrhizi cDNA cl... inoculation with TW72-1 urediniospores Glycine max cDNA clone ABWZ1277 3', mRNA sequence. 44 4.7 1 dna upda

  18. Dicty_cDB: VSA637 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 02 5', DNA sequence. 48 0.092 1 BI977733 |BI977733.1 lC02 Old Blush petal SMART library Rosa chinensis cDNA ...0.36 1 BI978917 |BI978917.1 yF10 Old Blush petal SMART library Rosa chinensis cDNA 5' similar to calmodulin,

  19. Dicty_cDB: VHE717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d21, 5' end. 70 3e-13 3 EV830481 |EV830481.1 TTSB084TH Tetrahymena thermophila SB210 cDNA library (Heavy metals...trahymena thermophila SB210 cDNA library (Heavy metals) Tetrahymena thermophila c

  20. Dicty_cDB: VHG483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.0 1 ( BJ442780 ) Dictyostelium discoideum cDNA clone:ddv50o20, 3' ... 1247 0.0 1 ( BJ442687 ) Dictyosteliu...m discoideum cDNA clone:ddv50m18, 3' ... 1247 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50a1

  1. Dicty_cDB: VSI331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ictyostelium discoideum cDNA clone:ddv50k10, 5' ... 688 0.0 3 ( AU265613 ) Dictyostelium discoideum cDNA clone:VS... 716 0.0 3 ( BJ442597 ) Dictyostelium discoideum cDNA clone:ddv50k10, 3' ... 634 0.0 4 (

  2. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ium discoideum cDNA clone:ddv51j06, 3' ... 1237 0.0 1 ( BJ442633 ) Dictyostelium discoideum cDNA clone:ddv50...b17, 3' ... 1237 0.0 1 ( BJ442555 ) Dictyostelium discoideum cDNA clone:ddv50b12, 3' ... 1237 0.0 1 ( BJ4416

  3. Dicty_cDB: VHO666 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 465 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50m24, 3' ... 1465 0.0 1 ( BJ442764 ) Dictyost...elium discoideum cDNA clone:ddv50l21, 3' ... 1465 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50

  4. Dicty_cDB: VHF669 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one:ddv60e18, 3' ... 1370 0.0 1 ( BJ442583 ) Dictyostelium discoideum cDNA clone:ddv50g12, 3' ... 1370 0.0 2...coideum cDNA clone:ddv61l04, 3' ... 1368 0.0 2 ( BJ442531 ) Dictyostelium discoideum cDNA clone:ddv50m05, 3'

  5. Dicty_cDB: VHP556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available discoideum cDNA clone:ddv51l13, 5' ... 133 2e-27 1 ( BJ423702 ) Dictyostelium discoideum cDNA clone:ddv50j0...3, 5' ... 133 2e-27 1 ( BJ423663 ) Dictyostelium discoideum cDNA clone:ddv50a04, 5' ... 133 2e-27 1 ( BJ4235

  6. Dicty_cDB: VHJ763 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 76 ) Dictyostelium discoideum cDNA clone:ddv50n15, 5' ... 1160 0.0 1 ( BJ442706 ) Dictyostelium discoideum cDNA clone:ddv50...a22, 3' ... 686 0.0 3 ( BJ442690 ) Dictyostelium discoideum cDNA clone:ddv50n15, 3' ... 686 0

  7. Dicty_cDB: VHJ622 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequences producing significant alignments: (bits) Value N ( BJ442522 ) Dictyostelium discoideum cDNA clone:ddv50...764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1465 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50

  8. Dicty_cDB: VHJ680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum cDNA clone:ddv50o20, 3' ... 1443 0.0 1 ( BJ442687 ) Dict...yostelium discoideum cDNA clone:ddv50m18, 3' ... 1443 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50

  9. Dicty_cDB: VFN866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 2 ( BJ423858 ) Dictyostelium discoideum cDNA clone:ddv50k13, 5' ... 430 0.0 2 ( BJ435821 ) Dictyostelium d...iscoideum cDNA clone:ddv28d18, 3' ... 402 e-108 1 ( BJ442673 ) Dictyostelium discoideum cDNA clone:ddv50k13,

  10. Dicty_cDB: VHJ695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5, 3' ... 1473 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50m24, 3' ... 1473 0.0 1 ( BJ442764... ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1473 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50

  11. Dicty_cDB: VHO781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum cDNA clone:ddv50m24, 3' ... 1465 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50...l21, 3' ... 1465 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50

  12. Dicty_cDB: VHH687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42780 ) Dictyostelium discoideum cDNA clone:ddv50o20, 3' ... 1443 0.0 1 ( BJ44268...7 ) Dictyostelium discoideum cDNA clone:ddv50m18, 3' ... 1443 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50

  13. Dicty_cDB: VHM389 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stelium discoideum cDNA clone:ddv50o18, 3' ... 1138 0.0 1 ( BJ441974 ) Dictyostelium discoideum cDNA clone:d...lone:ddv48n08, 5' ... 42 2e-11 3 ( BJ423884 ) Dictyostelium discoideum cDNA clone:ddv50o18, 5' ... 42 2e-11

  14. Dicty_cDB: VHF217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum cDNA clone:ddv50j21, 5' ... 100 3e-17 1 ( BJ423810 ) Di...ctyostelium discoideum cDNA clone:ddv50a16, 5' ... 100 3e-17 1 ( BJ423633 ) Dictyostelium discoideum cDNA cl

  15. Dicty_cDB: VHJ801 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available telium discoideum cDNA clone:ddv50b02, 3' ... 888 0.0 1 ( BJ437026 ) Dictyosteliu... ) Dictyostelium discoideum cDNA clone:ddv50n22, 3' ... 567 e-157 1 ( BJ446199 ) Dictyostelium discoideum cD

  16. Dicty_cDB: VSI532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mete cDNA, clone FC-AE21. 1150 0.0 1 ( BJ442607 ) Dictyostelium discoideum cDNA clone:ddv50m11, 3' ... 1150 ...0.0 1 ( BJ423789 ) Dictyostelium discoideum cDNA clone:ddv50m11, 5' ... 1150 0.0

  17. Dicty_cDB: SLC886 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3' ... 1298 0.0 1 ( BJ442717 ) Dictyostelium discoideum cDNA clone:ddv50c22, 3' ...... 1298 0.0 1 ( BJ442693 ) Dictyostelium discoideum cDNA clone:ddv50n18, 3' ... 1298 0.0 1 dna update 2009.

  18. Dicty_cDB: VHJ756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s producing significant alignments: (bits) Value N ( BJ423885 ) Dictyostelium discoideum cDNA clone:ddv50p13...) Dictyostelium discoideum cDNA clone:ddv34h10, 5' ... 674 0.0 2 ( BJ423936 ) Dictyostelium discoideum cDNA clone:ddv50

  19. Dicty_cDB: VSI120 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.0 2 ( BJ423789 ) Dictyostelium discoideum cDNA clone:ddv50m11, 5' ... 973 0.0 2 ( C23686 ) Dictyostelium d... 973 0.0 2 ( BJ442607 ) Dictyostelium discoideum cDNA clone:ddv50m11, 3' ... 973 0.0 2 ( AU265127 ) Dictyost

  20. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ium discoideum cDNA clone:ddv52a15, 3' ... 622 e-174 1 ( BJ442547 ) Dictyostelium discoideum cDNA clone:ddv50...a10, 3' ... 622 e-174 1 ( BJ442480 ) Dictyostelium discoideum cDNA clone:ddv50b06, 3' ... 622 e-174 1 ( BJ4