WorldWideScience

Sample records for actinium c

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.

    1977-01-01

    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  4. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.

    1979-01-01

    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  6. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  7. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  8. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W

    1950-06-16

    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  9. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.

    1993-01-01

    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  13. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

    2016-01-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. C r C =

    Indian Academy of Sciences (India)

    Administrator

    C r. C. = CTPPY: concentration of TPPY; CAuNPs: concentration of Au NPs. The concentration of the Au NPs is calculated as follows: (1) The weight of Au (WAu) produced from the complete reduction of HAuCl4 is calculated by multiplying the mole of added HAuCl4 (weight of added. HAuCl4·4H2O divided by molecular ...

  17. Hepatite C Hepatitis C

    Directory of Open Access Journals (Sweden)

    Edna Strauss

    2001-02-01

    Full Text Available Estima-se que cerca de 3% da população mundial esteja infectada pelo vírus da hepatite C. Todos os que receberam transfusão de sangue ou seus componentes e os usuários de drogas podem estar infectados. Procedimentos odontológicos, médicos, tatuagem ou acupuntura também constituem fatores de risco. A infecção se cronifica em até 85% dos indivíduos, com evolução assintomática durante anos ou décadas e apresentação clínica variada. Para o diagnóstico, a determinação do anti-VHC revela-se muito sensível e a confirmação se faz pela determinação do RNA-VHC no sangue; o estadiamento da doença e a avaliação da atividade inflamatória pela biópsia hepática. O tratamento objetiva deter a progressão da doença hepática através da inibição da replicação viral. Devido à baixa eficácia terapêutica aliada a importantes efeitos colaterais do interferon e da ribavirina, esses medicamentos encontram indicações e contra-indicações específicas. Vários fatores preditivos de resposta ao tratamento, principalmente a carga viral e o genótipo do VHC, mostram-se úteis na avaliação dos pacientes.It has been estimated that 3% of the world population is infected with the hepatitis C virus. Those who are blood product recipients or have been illicit drug users are at risk. Dental and medical procedures as well as tattooing and acupuncture are also risk factors. Chronic infection occurs in up to 85% of infected cases but they may remain without symptoms during years or even decades, and clinical presentation varies. Determination of anti-HCV in sera is a fairly sensitive tool for the diagnosis, and confirmation requires the identification of HCV-RNA. Staging of the liver disease as well as definition of its present activity can be graded by liver biopsy. The aim of treatment is to stop the progression of the hepatic disease by inhibiting viral replication. Due to the low therapeutic efficacy combined with important side

  18. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  19. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    International Nuclear Information System (INIS)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

    2017-01-01

    The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  1. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  2. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  4. Beginning C

    CERN Document Server

    Horton, Ivor

    2013-01-01

    Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

  5. C Borges

    Indian Academy of Sciences (India)

    C Borges. Articles written in Pramana – Journal of Physics. Volume 60 Issue 4 April 2003 pp 817-828. Study of deconfinement in NA50 · Paula bordalo M C Abreu B Alessandro C Alexa R Arnaldi M Atayan C Baglin A Baldit M Bedjidian S Beolé V Boldea Paula Bordalo S R Borenstein C Borges A Bussiére L Capelli C ...

  6. Vitamin C

    Science.gov (United States)

    ... body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for your ... healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources include ...

  7. Hepatitis C

    Science.gov (United States)

    ... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

  8. Vitamin C

    Science.gov (United States)

    ... values to calculate your total daily recommended amount. What foods provide vitamin C? Fruits and vegetables are the ... lessen cooking losses. Fortunately, many of the best food sources of vitamin C, ... raw. What kinds of vitamin C dietary supplements are available? ...

  9. C Dutta

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Dutta. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 47-49 Composites. Role of work hardening characteristics of matrix alloys in the strengthening of metal matrix composites · K T Kashyap C Ramachandra C Dutta B Chatterji.

  10. Professional C++

    CERN Document Server

    Gregoire, Marc; Kleper, Scott J

    2011-01-01

    Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

  11. Professional C++

    CERN Document Server

    Gregoire, Marc

    2014-01-01

    Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,

  12. C++ Cookbook

    CERN Document Server

    Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff

    2006-01-01

    Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't

  13. C Ghosh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Ghosh. Articles written in Bulletin of Materials Science. Volume 36 Issue 7 December 2013 pp 1323-1329. Structural characterization of electrodeposited boron · Ashish Jain C Ghosh T R Ravindran S Anthonysamy R Divakar E Mohandas G S Gupta · More Details Abstract ...

  14. C Shivakumara

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Shivakumara. Articles written in Bulletin of Materials Science. Volume 29 Issue 4 August 2006 pp 339-345 Ceramics and Glasses. Solution-combustion synthesis of Bi1–LnO1.5 (Ln = Y and La–Yb) oxide ion conductors · Manjunath B Bellakki A S Prakash C Shivakumara ...

  15. C Ramakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C Ramakrishnan. Articles written in Resonance – Journal of Science Education. Volume 6 Issue 10 October 2001 pp 48-56 General Article. Ramachandran and his Map · C Ramakrishnan · More Details Fulltext PDF. Volume 13 Issue 1 January 2008 pp 89-98 ...

  16. C Balaji

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C Balaji. Articles written in Journal of Earth System Science. Volume 118 Issue 4 August 2009 pp 331-343. Polarized microwave forward model simulations for tropical storm Fanoos · C Balaji M Deiveegan S P Venkateshan R M Gairola A Sarkar V K Agarwal · More Details ...

  17. C Ramachandra

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Ramachandra. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 39-45 Metallic Materials. Role of diffusional coherency strain theory in the discontinuous precipitation in Mg–Al alloy · K T Kashyap C Ramachandra M Sujatha B Chatterji.

  18. C++ evolves!

    International Nuclear Information System (INIS)

    Naumann, Axel

    2014-01-01

    C++ is used throughout High Energy Physics. CERN participates in the development of its standard. There has been a major shift in standardization procedures that will be visible starting 2014 with an increase rate of new standardized features. Already the current C++11 has major improvements, also for coding novices, related to simplicity, expressiveness, performance and robustness. Other major improvements are in the area of concurrency, where C++ is now on par with most other high level languages. To benefit from these language improvements and from the massive improvements in compiler technology for instance in usability, access to current compilers is crucial. Use of current C++ compiled with current compilers can considerably improve C++ for the HEP physicist community.

  19. Why Y-c.c

    Czech Academy of Sciences Publication Activity Database

    Chodounský, David; Zapletal, Jindřich

    2015-01-01

    Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664

  20. Advanced C and C++ compiling

    CERN Document Server

    Stevanovic, Milan

    2014-01-01

    Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

  1. Hall C

    Data.gov (United States)

    Federal Laboratory Consortium — Hall C's initial complement of equipment (shown in the figure), includes two general-purpose magnetic spectrometers. The High Momentum Spectrometer (HMS) has a large...

  2. Hepatitis C

    Science.gov (United States)

    ... viral load (the amount of HCV in your blood), imaging tests, and biopsy results. Treatment is especially important for people who are showing signs liver fibrosis or scarring. Medicines used to treat hepatitis C ...

  3. Hepatitis C

    Science.gov (United States)

    ... Workshops Follow Us Home Health Information Liver Disease Hepatitis (Viral) Hepatitis C Related Topics English English Español Section Navigation Hepatitis (Viral) What Is Viral Hepatitis? Hepatitis A Hepatitis B ...

  4. C Ranganathaiah

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C Ranganathaiah. Articles written in Bulletin of Materials Science. Volume 30 Issue 1 February 2007 pp 37-41 Catalysis. Photocatalytic degradation of indigo carmine dye using TiO2 impregnated activated carbon · A K Subramani K Byrappa S Ananda K M Lokanatha Rai C ...

  5. C, Adigwe

    African Journals Online (AJOL)

    C, Adigwe. Vol 30, No 1-2 (2015) - Articles Honey Attenuates the Detrimental Effects of Nicotine on Testicular Functions in Nicotine Treated Wistar Rats Abstract PDF. ISSN: 0794-859X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  6. C Thangaraja

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. C Thangaraja. Articles written in Journal of Chemical Sciences. Volume 116 Issue 4 June 2004 pp 209-213 Full Papers. A new Mannich base and its transition metal (II) complexes - Synthesis, structural characterization and electrochemical study · N Raman S Esthar C ...

  7. Practical C++ programming

    National Research Council Canada - National Science Library

    Oualline, Steve

    2003-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv Part I. The Basics 1. What Is C++? A Brief History of C++ C++ Organization How to Learn C++...

  8. Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

    Science.gov (United States)

    Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

    2012-01-01

    The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

  9. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  10. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  11. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    Marx, Sebastian Markus

    2014-01-01

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  12. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  13. HfC plasma coating of C/C composites

    International Nuclear Information System (INIS)

    Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.

    1992-01-01

    The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs

  14. Excitation functions of the systems 12C+14C and 13C+12C

    International Nuclear Information System (INIS)

    Haindl, E.

    1975-01-01

    The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de

  15. Accelerated C# 2010

    CERN Document Server

    Nash, Trey

    2010-01-01

    C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

  16. Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC

    International Nuclear Information System (INIS)

    Gusev, A.I.

    1985-01-01

    Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established

  17. Facts about Vitamin C

    Science.gov (United States)

    ... milligrams of vitamin C every day. Three large strawberries provide 33 milligrams of vitamin C. Figure 1. ... and citrus fruit juices, sweet peppers, papayas, and strawberries. Table 2. Food sources of vitamin C. Food ...

  18. Travelers' Health: Hepatitis C

    Science.gov (United States)

    ... Chapter 3 - Hepatitis B Chapter 3 - Hepatitis E Hepatitis C Deborah Holtzman INFECTIOUS AGENT Hepatitis C virus ( ... mother to child. Map 3-05. Prevalence of hepatitis C virus infection 1 PDF Version (printable) 1 ...

  19. Hepatitis C: Treatment

    Science.gov (United States)

    ... Public Home » Hepatitis C » Hepatitis C Treatment Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... Enter ZIP code here Enter ZIP code here Hepatitis C Treatment for Veterans and the Public Treatment ...

  20. Hemoglobin C disease

    Science.gov (United States)

    Clinical hemoglobin C ... Hemoglobin C is an abnormal type of hemoglobin, the protein in red blood cells that carries oxygen. It is ... Americans. You are more likely to have hemoglobin C disease if someone in your family has had ...

  1. Hepatitis C: Mental Health

    Science.gov (United States)

    ... the Public Home Hepatitis A Hepatitis B Hepatitis C Hepatitis C Home Getting Tested Just Diagnosed Treatment Choice Program ... Pain Mental Health Sex and Sexuality (for Hepatitis C) Success Stories FAQs For Health Care Providers Provider ...

  2. C. difficile Infection

    Science.gov (United States)

    ... Patients Home / Digestive Health Topic / C. Difficile Infection C. Difficile Infection Basics Overview Diarrhea is a frequent ... that change the normal colon bacteria allowing the C. difficile bacteria to grow and produce its toxins. ...

  3. Stool C difficile toxin

    Science.gov (United States)

    ... toxin; Colitis - toxin; Pseudomembranous - toxin; Necrotizing colitis - toxin; C difficile - toxin ... be analyzed. There are several ways to detect C difficile toxin in the stool sample. Enzyme immunoassay ( ...

  4. C anti c q anti q states

    Energy Technology Data Exchange (ETDEWEB)

    Chao, K T [Oxford Univ. (UK). Dept. of Theoretical Physics; Science Research Council, Chilton (UK). Rutherford and Appleton Labs.)

    1980-07-01

    Taking account of the colour magnetic and electric forces, we discuss the spectroscopy of various types of c anti c q anti q states. Their decay, hadronic production, production in e/sup +/e/sup -/ annihilation as well as photoproduction are also studied.

  5. C and C* among intermediate rings

    NARCIS (Netherlands)

    Sack, J.; Watson, S.

    2014-01-01

    Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA,

  6. Seminario C++, parte 1

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Clases en C++. Operaciones set/get/is. Tipo Referencia (&). El puntero 'this'. Los constructores. El destructor.

  7. C59N+ and C69N+: isoelectronic heteroanalogues of C60 and C70

    International Nuclear Information System (INIS)

    Lamparth, I.; Nuber, B.; Schick, G.; Skiebe, A.; Groesser, T.; Hirsch, A.

    1995-01-01

    Fragmentation reactions in the mass spectrometer were used to generate the first characterized nitrogen heterofullerene ions C 59 N + and C 69 N + from regioselectively synthesized oligoiminofullerenes. During this process one carbon atom in the fullerene core is removed and replaced with a nitrogen atom. C 59 N + has almost the same structure as the isoelectronic C 60 . (orig.)

  8. Operational Aspects of C/C++ Concurrency

    OpenAIRE

    Podkopaev, Anton; Sergey, Ilya; Nanevski, Aleksandar

    2016-01-01

    In this work, we present a family of operational semantics that gradually approximates the realistic program behaviors in the C/C++11 memory model. Each semantics in our framework is built by elaborating and combining two simple ingredients: viewfronts and operation buffers. Viewfronts allow us to express the spatial aspect of thread interaction, i.e., which values a thread can read, while operation buffers enable manipulation with the temporal execution aspect, i.e., determining the order in...

  9. Exploring C++ 11

    CERN Document Server

    Lischner, Ray

    2014-01-01

    Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat

  10. Practical C++ Programming

    CERN Document Server

    Oualline, Steve

    2003-01-01

    C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th

  11. Objective-C

    CERN Document Server

    DeVoe, Jiva

    2011-01-01

    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  12. C++ Programming Language

    Science.gov (United States)

    Shaykhian, Gholam Ali

    2007-01-01

    C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.

  13. C++ for dummies

    CERN Document Server

    Davis , Stephen R

    2014-01-01

    The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new

  14. Hepatitis C and Incarceration

    Science.gov (United States)

    ... Hepatitis Cdo to take care of their liver? People with Hepatitis C should not use alcohol or street drugs, as these can hurt the liver. Some other products can also hurt people with Hepatitis C, even if they appear to ...

  15. Cryptococcosis (C. neoformans)

    Science.gov (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. neoformans Infection Recommend on Facebook Tweet Share Compartir ... throughout the world. People can become infected with C. neoformans after breathing in the microscopic fungus, although ...

  16. Hepatitis C: Clinical Trials

    Science.gov (United States)

    ... and Public Home » Hepatitis C » Treatment Decisions Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... can I find out about participating in a hepatitis C clinical trial? Many trials are being conducted ...

  17. Hepatitis C: Managing Pain

    Science.gov (United States)

    ... Pain: Entire Lesson Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For Veterans and the Public Veterans and the Public Home Hepatitis A Hepatitis B Hepatitis C Hepatitis C Home Getting ...

  18. Cryptococcosis (C. gattii)

    Science.gov (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. gattii Infection Recommend on Facebook Tweet Share Compartir ... as British Columbia and the U.S. Pacific Northwest. C. gattii cryptococcosis is a rare infection that people ...

  19. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C

  20. K C Bhamu

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K C BHAMU. Articles written in Pramana – Journal of Physics. Volume 89 Issue 1 July 2017 pp 11 Research Article. Density functional study of A g S c O 2 : Electronic and optical properties · K C BHAMU JAGRATI SAHARIYA RISHI VYAS K R PRIOLKAR · More Details ...

  1. K C Sajjan

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K C Sajjan. Articles written in Bulletin of Materials Science. Volume 34 Issue 7 December 2011 pp 1557-1561. Synthesis, characterization and magnetic properties of polyaniline/-Fe2O3 composites · Syed Khasim S C Raghavendra M Revanasiddappa K C Sajjan Mohana ...

  2. C P Gopalakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C P Gopalakrishnan. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 6 June 2004 pp 74-85 Classroom. The Real Effects of Pseudo Forces · P Chaitanya Das G Srinivasa Murthy C P Gopalakrishnan P C Deshmukh · More Details ...

  3. c p chaudhari

    Indian Academy of Sciences (India)

    C P CHAUDHARI. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 24. A logical explanation of structurally unfit X-ray diffraction peaks in nanoferroelectrics · C M DUDHE B K SAKHARE S S PANCHBHAI S J KHAMBADKAR N V DHOKE C P CHAUDHARI U A PALIKUNDWAR.

  4. C P Anil Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C P Anil Kumar. Articles written in Journal of Earth System Science. Volume 124 Issue 8 December 2015 pp 1721-1733. Variation of surface electric field during geomagnetic disturbed period at Maitri, Antarctica · N Jeni Victor C Panneerselvam C P Anil Kumar.

  5. Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

    DEFF Research Database (Denmark)

    Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

    1997-01-01

    This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

  6. Head first C#

    CERN Document Server

    Stellman, Andrew

    2008-01-01

    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  7. TMS320C31

    International Nuclear Information System (INIS)

    Park, Gwi Tae; Lee, Sang Rak

    1998-01-01

    This book is divided into four parts, which introduces TMS320C31 with C language. The first part deals with digital signal processor on what is DPS?, types of DPS and structure of TMS320C31. The second part introduces program development by C language, cstartup cord and C compiler. The third part describes OS30, Emile 30 and BIOS. The last part is for application board design of T31 and test examples of T31 board : external flag test, ram test, external read port test and communication test.

  8. Using C-Kermit

    CERN Document Server

    da Cruz, Frank

    2014-01-01

    An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced

  9. Detecting C Program Vulnerabilities

    OpenAIRE

    Anton, Ermakov; Natalia, Kushik

    2011-01-01

    C/C++ language is widely used for developing tools in various applications, in particular, software tools for critical systems are often written in C language. Therefore, the security of such software should be thoroughly tested, i.e., the absence of vulnerabilities has to be confirmed. When detecting C program vulnerabilities static source code analysis can be used. In this paper, we present a short survey of existing software tools for such analysis and show that for some kinds of C code vu...

  10. Vitamin C and Infections.

    Science.gov (United States)

    Hemilä, Harri

    2017-03-29

    In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose-response, for the duration of common cold symptoms, with up to 6-8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3-4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  11. Vitamin C and Infections

    Directory of Open Access Journals (Sweden)

    Harri Hemilä

    2017-03-01

    Full Text Available In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose–response, for the duration of common cold symptoms, with up to 6–8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3–4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  12. Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

    DEFF Research Database (Denmark)

    Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

    1997-01-01

    This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

  13. Parylene C Aging Studies.

    Energy Technology Data Exchange (ETDEWEB)

    Achyuthan, Komandoor; Sawyer, Patricia Sue.; Mata, Guillermo Adrian; White II, Gregory Von; Bernstein, Robert

    2014-09-01

    Parylene C is used in a device because of its conformable deposition and other advantages. Techniques to study Parylene C aging were developed, and "lessons learned" that could be utilized for future studies are the result of this initial study. Differential Scanning Calorimetry yielded temperature ranges for Parylene C aging as well as post-deposition treatment. Post-deposition techniques are suggested to improve Parylene C performance. Sample preparation was critical to aging regimen. Short-term (%7E40 days) aging experiments with free standing and ceramic-supported Parylene C films highlighted "lessons learned" which stressed further investigations in order to refine sample preparation (film thickness, single sided uniform coating, machine versus laser cutting, annealing time, temperature) and testing issues ("necking") for robust accelerated aging of Parylene C.

  14. Hemoglobin C, S-C, and E Diseases

    Science.gov (United States)

    ... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

  15. Scurvy and Vitamin C

    OpenAIRE

    Mayberry, Jason A.

    2004-01-01

    This paper outlines the history of scurvy and vitamin C. The first section of the paper outlines the science of vitamin C. The second discusses outlines the medical progression of vitamin C deficiency and scurvy. The third section gives a brief timeline of scurvy throughout human history. The fourth section discusses the conditions during the age of sail that combined to make scurvy the greatest killer of sailors. The final section follows the scientific drive to find a cure and eventual elim...

  16. Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.

    Science.gov (United States)

    Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt

    2002-02-22

    C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.

  17. Seminario C++, parte 3

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Funciones amigas. Entrada / Salida. Sobrecarga de funciones y operadores. Gestión de memoria dinámica. Atributos y métodos de clase. Implementación de relaciones entre objetos.

  18. Seminario C++, parte 2

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. El compilador g++. Directivas de compilación. Make. Doxygen. Utilidad de compresión 'tar'. Introducción a UML. Ejercicio práctico.

  19. Seminario C++, parte 4

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Herencia simple. El destructor abstracto. Patrón de diseño singleton. Tipos enumerados. Declaraciones forward. Conversión entre objetos (upcasting/downcasting).

  20. C# Database Basics

    CERN Document Server

    Schmalz, Michael

    2012-01-01

    Working with data and databases in C# certainly can be daunting if you're coming from VB6, VBA, or Access. With this hands-on guide, you'll shorten the learning curve considerably as you master accessing, adding, updating, and deleting data with C#-basic skills you need if you intend to program with this language. No previous knowledge of C# is necessary. By following the examples in this book, you'll learn how to tackle several database tasks in C#, such as working with SQL Server, building data entry forms, and using data in a web service. The book's code samples will help you get started

  1. Programming C# 40

    CERN Document Server

    Griffiths, Ian; Liberty, Jesse

    2010-01-01

    With its support for dynamic programming, C# 4.0 continues to evolve as a versatile language on its own. But when C# is used with .NET Framework 4, the combination is incredibly powerful. This bestselling tutorial shows you how to build web, desktop, and rich Internet applications using C# 4.0 with .NET's database capabilities, UI framework (WPF), extensive communication services (WCF), and more. In this sixth edition, .NET experts Ian Griffiths, Matthew Adams, and Jesse Liberty cover the latest enhancements to C#, as well as the fundamentals of both the language and framework. You'll learn

  2. C++ for dummies

    CERN Document Server

    Davis, Stephen Randy

    2009-01-01

    Enter the world of computer programming with this step-by-step guide to the C++ language! C++ is a great introduction to object-oriented programming, and this friendly guide covers everything you need to know and nothing you don't. You'll write your first program by the end of Chapter 1. C++ For Dummies, 6th Edition, helps you understand C++ programming from the ground up. It's full of examples to show you how things work, and it even explains "why", so you understand how the pieces fit together. And the bonus CD includes a special code editor, an update GNU compiler, and all source code from

  3. High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems

    International Nuclear Information System (INIS)

    Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.

    1981-01-01

    The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru

  4. L C S Murthy

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. L C S Murthy. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 295-301 Thin Films. Studies on tin oxide films prepared by electron beam evaporation and spray pyrolysis methods · K S Shamala L C S Murthy K Narasimha Rao · More Details ...

  5. C M Dudhe

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M Dudhe. Articles written in Bulletin of Materials Science. Volume 38 Issue 5 September 2015 pp 1423-1427. Nucleation and evaporation of domains due to electric field at room temperature in BaTiO3 single crystals · C M Dudhe P R Arjunwadkar · More Details Abstract ...

  6. Curiosities at c=24

    International Nuclear Information System (INIS)

    Schellekens, A.N.; Yankielowicz, S.

    1989-01-01

    Two examples of c=24 holomorphic conformal field theories are given that do not correspond to Niemeier lattices or Z 2 twists of Niemeier lattices. One of these examples clarifies a recently discovered modular invariant of F 4 at level 6, which can be interpreted as the 'complement' of SU(3) level 2 within a new c=24 theory. (orig.)

  7. C M K Nair

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.

  8. S C Raghavendra

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. S C Raghavendra. Articles written in Bulletin of Materials Science. Volume 25 Issue 1 February 2002 pp 37-39 Electrical Properties. Dielectric properties of fly ash · S C Raghavendra R L Raibagkar A B Kulkarni · More Details Abstract Fulltext PDF. This paper reports the ...

  9. Weak C* Hopf Symmetry

    OpenAIRE

    Rehren, K. -H.

    1996-01-01

    Weak C* Hopf algebras can act as global symmetries in low-dimensional quantum field theories, when braid group statistics prevents group symmetries. Possibilities to construct field algebras with weak C* Hopf symmetry from a given theory of local observables are discussed.

  10. K C Manorama Thampatti

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K C Manorama Thampatti. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 3 March 1999 pp 62-70 Feature Article. Nature Watch - Rice Bowl in Turmoil: The Kuttanad Wetland Ecosystem · K C Manorama Thampatti K G Padmakumar.

  11. Learning Boost C++ libraries

    CERN Document Server

    Mukherjee, Arindam

    2015-01-01

    If you are a C++ programmer who has never used Boost libraries before, this book will get you up-to-speed with using them. Whether you are developing new C++ software or maintaining existing code written using Boost libraries, this hands-on introduction will help you decide on the right library and techniques to solve your practical programming problems.

  12. Shekhar C Mande

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Shekhar C Mande. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 9 September 2017 pp 829-833 General Article. Nobel Prize in Physiology or Medicine 2016 · Shekhar C Mande Jyoti Rao · More Details Abstract Fulltext PDF.

  13. Hepatitis C Test

    Science.gov (United States)

    ... and Prevention. Recommendations for the Identification of Chronic Hepatitis C Virus Infection Among Persons Born During 1945–1965. Prepared by ... Disease Control and Prevention. Vital Signs: Evaluation of Hepatitis C Virus Infection Testing and Reporting — Eight U.S. Sites, 2005–2011. ...

  14. Dhruv C Hoysall

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Dhruv C Hoysall. Articles written in Resonance – Journal of Science Education. Volume 13 Issue 4 April 2008 pp 378-393 Classroom. Spinning Ball Flight Under Moderate Wind · K R Y Simha Dhruv C Hoysall · More Details Fulltext PDF ...

  15. P. C. Agrawal

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. P. C. Agrawal. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 1-2 June 2000 pp 29-38. X-ray Observation of XTE J2012+381 during the 1998 Outburst · S. Naik P. C. Agrawal B. Paul A. R. Rao S. Seetha Κ. Kasturirangan · More Details ...

  16. C Sacerdoti Coen

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. C Sacerdoti Coen. Articles written in Sadhana. Volume 34 Issue 1 February 2009 pp 71-144. A compact kernel for the calculus of inductive constructions · A Asperti W Ricciotti C Sacerdoti Coen E Tassi · More Details Abstract Fulltext PDF. The paper describes the new kernel for the Calculus of ...

  17. C-TOOL

    DEFF Research Database (Denmark)

    Taghizadeh-Toosi, Arezoo; Christensen, Bent Tolstrup; Hutchings, Nicholas John

    2014-01-01

    Soil organic carbon (SOC) is a significant component of the global carbon (C) cycle. Changes in SOC storage affect atmospheric CO2 concentrations on decadal to centennial timescales. The C-TOOL model was developed to simulate farm- and regional-scale effects of management on medium- to long...

  18. C S Smith

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C S Smith. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 6 June 2006 pp 79-93 Classics. Excerpts from A Search for Structure · C S Smith · More Details Fulltext PDF ...

  19. C K Maiti

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C K Maiti. Articles written in Bulletin of Materials Science. Volume 24 Issue 6 December 2001 pp 579-582 Thin Films. Metallo–organic compound-based plasma enhanced CVD of ZrO2 films for microelectronic applications · S Chatterjee S K Samanta H D Banerjee C K Maiti.

  20. VC@C

    Indian Academy of Sciences (India)

    2012-03-09

    Mar 9, 2012 ... A novel approach to the fabrication of vanadium carbide encapsulated into carbon nanotube (VC@C) core-shell .... mixed solution was transferred into a 600 mL stainless steel autoclave after the solution became suspension. An auto- clave was sealed and maintained at 180. ◦. C for 48 h and then cooled to ...

  1. C S Sanmathi

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C S Sanmathi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene and maleic anhydride: determination of the reactivity ratios · C S Sanmathi S Prasannakumar B S ...

  2. V C Petwal

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. V C Petwal. Articles written in Pramana – Journal of Physics. Volume 68 Issue 2 February 2007 pp 235-241. Optimization studies of photo-neutron production in high- metallic targets using high energy electron beam for ADS and transmutation · V C Petwal V K Senecha K V ...

  3. C V R Murty

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C V R Murty. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 8 August 2004 pp 75-78 Classroom. Learning Earthquake Design and Construction – 1. What causes Earthquakes? C V R Murty · More Details Fulltext PDF. Volume 9 ...

  4. k c mistri

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K C MISTRI. Articles written in Sadhana. Volume 42 Issue 9 September 2017 pp 1459-1471. Influence of yielding base and rigid base on propagation of Rayleigh-type wave in a viscoelastic layer of Voigt type · S SAHA A CHATTOPADHYAY K C MISTRI A K SINGH · More Details Abstract Fulltext ...

  5. K C Mittal

    Indian Academy of Sciences (India)

    K C Mittal. Articles written in Sadhana. Volume 30 Issue 6 December 2005 pp 757-764. Development of a 300-kV Marx generator and its application to drive a relativistic electron beam · Y Choyal Lalit Gupta Preeti Vyas Prasad Deshpande Anamika Chaturvedi K C Mittal K P Maheshwari · More Details Abstract Fulltext PDF.

  6. K C Kumara Swamy

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K C Kumara Swamy. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 9 September 2006 pp 72-75 Feature Article. Molecule Matters - A Chromium Compound with a Quintuple Bond · K C Kumara Swamy · More Details Fulltext PDF ...

  7. K C Patil

    Indian Academy of Sciences (India)

    K C Patil. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 7 July 2004 pp 92-92 Book Review. Inorganic Chemistry · K C Patil · More Details Fulltext PDF. Volume 20 Issue 5 May 2015 pp 431-444 General Article. High Energy Materials: A Brief History and Chemistry of Fireworks and Rocketry.

  8. K C Deshmukh

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K C Deshmukh. Articles written in Sadhana. Volume 30 Issue 4 August 2005 pp 555-563. Thermal deformation in a thin circular plate due to a partially distributed heat supply · N L Khobragade K C Deshmukh · More Details Abstract Fulltext PDF. In this paper, we develop an integral transform to ...

  9. K C Mittal

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K C Mittal. Articles written in Pramana – Journal of Physics. Volume 71 Issue 6 December 2008 pp 1279-1289 Research Articles. RF properties of 700 MHz, = 0.42 elliptical cavity for high current proton acceleration · Amitava Roy J Mondal K C Mittal · More Details Abstract ...

  10. C P Vinod

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  11. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts

    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.

  12. Mol 7C/6

    International Nuclear Information System (INIS)

    Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.

    1995-01-01

    The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO 2 covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)

  13. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor

    2009-01-01

    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the 56...... bit key for a known S-box can be done in complexity 2^48. Finally, a C2 implementation with a 8 to 8 bit secret S-box (equivalent to 2048 secret bits) and a 56 bit secret key can be attacked in 2^53.5 C2 encryptions on average....

  14. Vitamin C revisited.

    Science.gov (United States)

    Oudemans-van Straaten, Heleen M; Spoelstra-de Man, Angelique Me; de Waard, Monique C

    2014-08-06

    This narrative review summarizes the role of vitamin C in mitigating oxidative injury-induced microcirculatory impairment and associated organ failure in ischemia/reperfusion or sepsis. Preclinical studies show that high-dose vitamin C can prevent or restore microcirculatory flow impairment by inhibiting activation of nicotinamide adenine dinucleotide phosphate-oxidase and inducible nitric oxide synthase, augmenting tetrahydrobiopterin, preventing uncoupling of oxidative phosphorylation, and decreasing the formation of superoxide and peroxynitrite, and by directly scavenging superoxide. Vitamin C can additionally restore vascular responsiveness to vasoconstrictors, preserve endothelial barrier by maintaining cyclic guanylate phosphatase and occludin phosphorylation and preventing apoptosis. Finally, high-dose vitamin C can augment antibacterial defense. These protective effects against overwhelming oxidative stress due to ischemia/reperfusion, sepsis or burn seems to mitigate organ injury and dysfunction, and promote recovery after cardiac revascularization and in critically ill patients, in the latter partially in combination with other antioxidants. Of note, several questions remain to be solved, including optimal dose, timing and combination of vitamin C with other antioxidants. The combination obviously offers a synergistic effect and seems reasonable during sustained critical illness. High-dose vitamin C, however, provides a cheap, strong and multifaceted antioxidant, especially robust for resuscitation of the circulation. Vitamin C given as early as possible after the injurious event, or before if feasible, seems most effective. The latter could be considered at the start of cardiac surgery, organ transplant or major gastrointestinal surgery. Preoperative supplementation should consider the inhibiting effect of vitamin C on ischemic preconditioning. In critically ill patients, future research should focus on the use of short-term high-dose intravenous vitamin

  15. Head first C#

    CERN Document Server

    Stellman, Andrew

    2010-01-01

    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  16. Introducing Visual C# 2010

    CERN Document Server

    Freeman, Adam

    2010-01-01

    If you're new to C# programming, this book is the ideal way to get started. Respected author Adam Freeman guides you through the C# language by carefully building up your knowledge from fundamental concepts to advanced features. The book gradually builds up your knowledge, using the concepts you have already grasped to support those that come next. You will explore all the core areas of the C# language and the .NET Framework on which it runs. Particular attention is paid to the creation of Web and Windows applications and data access - danger zones where novice programmers often go awry in the

  17. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit

    2007-01-01

    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  18. Vitamin C In Neuropsychiatry

    Directory of Open Access Journals (Sweden)

    Pavlović Dragan M.

    2015-06-01

    Full Text Available Vitamins are necessary factors in human development and normal brain function. Vitamin C is a hydrosoluble compound that humans cannot produce; therefore, we are completely dependent on food intake for vitamin C. Ascorbic acid is an important antioxidative agent and is present in high concentrations in neurons and is also crucial for collagen synthesis throughout the body. Ascorbic acid has a role in modulating many essential neurotransmitters, enables neurogenesis in adult brain and protects cells against infection. While SVCT1 enables the absorption of vitamin C in the intestine, SVCT2 is primarily located in the brain.

  19. C++ multithreading cookbook

    CERN Document Server

    Ljumovic, Milos

    2014-01-01

    The book is an easy-to-follow guide for creating multi-threaded applications using C++. Each topic is thoroughly explained with multiple illustrations. Many algorithms, such as Dinning Philosophers Problem give you thorough explanations that will help you to understand and solve concurrent tasks. The book is intended for enterprise developers and programmers who wish to make use of C++ capabilities to learn the multithreaded approach. Knowledge of multithreading along with experience in C++ is an added advantage. However it is not a prerequisite.

  20. Practical C programming

    CERN Document Server

    Oualline, Steve

    1997-01-01

    There are lots of introductory C books, but this is the first one that has the no-nonsense, practical approach that has made Nutshell Handbooks® famous. C programming is more than just getting the syntax right. Style and debugging also play a tremendous part in creating programs that run well and are easy to maintain. This book teaches you not only the mechanics of programming, but also describes how to create programs that are easy to read, debug, and update. Practical rules are stressed. For example, there are fifteen precedence rules in C (&& comes before || comes before ?:). The practi

  1. HIV and Hepatitis C

    Science.gov (United States)

    ... AIDS Drugs Clinical Trials Apps skip to content HIV and Opportunistic Infections, Coinfections, and Conditions Home Understanding ... 4 p.m. ET) Send us an email HIV and Hepatitis C Last Reviewed: July 25, 2017 ...

  2. The C++ programming language

    CERN Document Server

    Stroustrup, Bjarne

    2013-01-01

    The new C++11 standard allows programmers to express ideas more clearly, simply, and directly, and to write faster, more efficient code. Bjarne Stroustrup, the designer and original implementer of C++, has updated his definitive reference and tutorial for everyone who uses the language and needs to understand its latest version. The C++ Programming Language, Fourth Edition, delivers meticulous, richly explained, and integrated coverage of the entire language—its facilities, abstraction mechanisms, standard libraries, and key design techniques. Throughout, Stroustrup presents concise, “pure C++11” examples, which have been carefully crafted to clarify both usage and program design. To promote deeper understanding, the author provides extensive cross-references, both within the book and to the ISO standard.

  3. Beginning Objective-C

    CERN Document Server

    Dovey, James

    2012-01-01

    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  4. Parallelization in Modern C++

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    The traditionally used and well established parallel programming models OpenMP and MPI are both targeting lower level parallelism and are meant to be as language agnostic as possible. For a long time, those models were the only widely available portable options for developing parallel C++ applications beyond using plain threads. This has strongly limited the optimization capabilities of compilers, has inhibited extensibility and genericity, and has restricted the use of those models together with other, modern higher level abstractions introduced by the C++11 and C++14 standards. The recent revival of interest in the industry and wider community for the C++ language has also spurred a remarkable amount of standardization proposals and technical specifications being developed. Those efforts however have so far failed to build a vision on how to seamlessly integrate various types of parallelism, such as iterative parallel execution, task-based parallelism, asynchronous many-task execution flows, continuation s...

  5. LOADING SIMULATION PROGRAM C

    Science.gov (United States)

    LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for simulating hydrology, sediment, and general water quality

  6. LOADING SIMULATION PROGRAM C

    Data.gov (United States)

    U.S. Environmental Protection Agency — LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for...

  7. C-CURE

    Data.gov (United States)

    US Agency for International Development — C-CURE system manages certain aspects of the access control system, including collecting employee and contractor names and photographs. The Office of Security uses...

  8. Mishra, Dr A C

    Indian Academy of Sciences (India)

    Elected: 2009 Section: Medicine. Mishra, Dr A C . Ph.D. (Pune), FNA. Date of birth: 1 July 1950. Specialization: Human Viral Infection & Zoonotic Diseases, Public Health Address: Director, Interactive Research School of Health Affairs, Bharati Vidyapeeth University, ...

  9. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas

    The aim of the development of a forest soil carbon simulation model was to demonstrate the slow, but yet dynamic character of the forest soil C balance. We explored the sensitivity of total forest soil carbon stocks (forest floor + 0-100 cm) to litter inputs, tree root litter distributions......, and iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during...... manually in the spreadsheet to fit observed change (18 years between 1990 and 2008-10) in C concentration in each of the six layers. The cases represent classes of subsoil texture and topsoil carbon content from the SINKS resampling study (1990 and 2008-10). The sensitivity of SOC stocks to the uncertainty...

  10. Introduction to C

    DEFF Research Database (Denmark)

    Albertsen, Niels Christian

    2006-01-01

    The principles of C are very much like those of PASCAL, although the syntax differs slightly. The programs are entered in free format, which the programmer may utilise to make the text reader-friendly, and every sentence is ended with a semicolon. Comments can be entered at any point by enclosing...... them in /* and */. e.g.: /* a comment */. Note that the C compiler is case sensitive. A C program may consist of several program segments. One of them must be the main program, the rest are denoted functions. In contrast to PASCAL the concept procedure does not exist. Every segment starts with a number...... this extra complication, we will in the following consider only C programs contained in a single file....

  11. C-FERST

    Science.gov (United States)

    The Community-Focused Exposure and Risk Screening Tool (C-FERST) is an online tool which provides access to resources that can help communities learn more about their environmental issues, and explore exposure and risk reduction options.

  12. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts

    2012-03-06

    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  13. Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems

    International Nuclear Information System (INIS)

    Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.

    1991-01-01

    An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems

  14. Bioremediation of bunker C

    International Nuclear Information System (INIS)

    Emery, D.D.

    1992-01-01

    Bioremediation works extremely well for most common hydrocarbons including aviation fuel, heating oil and diesel oil. Bunker C, a high boiling point distillate, is the most recalcitrant hydrocarbon for treatment and is the topic of this paper. Bioremediation, Inc. has had an opportunity to perform two projects involving soil contaminated with bunker C. One was at a bulk terminal site which involved predominantly diesel, but also had bunker C contamination; the other was a paper-mill site which had exclusively bunker C contamination. This paper will address the authors' experiences at the paper-mill site. Bunker C lives up to its reputation of being a very recalcitrant hydrocarbon to biodegrade. They have demonstrated, however, that the soil matrix standards at industrial sites in Washington and Oregon can be achieved using new bioremediation techniques. These techniques are necessary over those typically used to biodegrade jet fuel, heating oil and diesel oil. These extra steps, as discussed later, have been developed for their own use in their treatability laboratory

  15. césarienne

    OpenAIRE

    LABIOD, Imene; KOTBI, sarrah; ABOU ANZA, MOUAID; MOUALID, imene

    2012-01-01

    Notre travail a été réalisé au Service de Gynécologie Obstétrique du complexe mère enfant de Tlemcen Ils 'agit d'une étude rétrospective descriptive et analytique des dossiers médicaux des patientes qui ont accouché par césarienne au cours de d'une période de 8 mois allant du 1e janvier 2011 au 31 Aout 2011. Nous en avons colligé 1732 cas de césarienne sur 7083 accouchements soit un taux de 24.45%. Nous constatons ainsi une augmentation significative du taux des césariennes qui es...

  16. Hepatitis C pada Anak

    Directory of Open Access Journals (Sweden)

    Yusri Dianne Jurnalis

    2014-05-01

    Full Text Available AbstrakInfeksi virus hepatitis C saat ini masih merupakan persoalan yang serius. Penularan infeksi HCV pada anak yang utama adalah melalui transfusi darah atau produk darah yang saat ini bertanggung jawab menyebabkan kasus hepatitis C kronis. Selain itu infeksi HCV pada anak dapat disebabkan oleh transmisi perinatal (vertikal. Infeksi HCV akut dapat berakhir dengan sirosis dan karsinoma hepatoselular setelah dekade ketiga (sekitar 20%, karena progresivitas infeksi HCV lebih lambat dari infeksi hepatitis B virus. Pada umumnya infeksi HCV bersifat asimptomatik termasuk pada anak. Karena tidak ada gejala yang jelas pada infeksi HCV tersebut maka diagnosis infeksi HCV hanya dapat ditegakkan dengan pemeriksaan awal laboratorium dan uji serologi, dan bila perlu dengan uji molekuler pada pasien dengan risiko tinggi. Kebijakan kuratif khusus terhadap HCV adalah terapi antivirus berupa interferon dan ribavirin yang diberikan bila diagnosis HCV sudah ditegakkanKata kunci: Hepatitis C, diagnosis and management problem, childrenAbstractHepatitis C virus infection is still a serious problem. Transmission of HCV infection in children is a major blood transfusion or blood products that are currently responsible for causing chronic hepatitis C cases. Additionally HCV infection in children can be caused by perinatal transmission (vertical. Acute HCV infection may end up with cirrhosis and hepatocellular carcinoma after the third decade (around 20%, due to a slower progression of HCV infection of hepatitis B virus infection. In most cases of HCV infection are asymptomatic, including in children. Since there are no obvious symptoms in the diagnosis of HCV infection HCV infection can only be confirmed by laboratory examinations and serologic testing early, and if necessary with molecular testing in patients at high risk. Curative policy is specific to HCV antiviral therapy such as interferon and ribavirin are given when the diagnosis of HCV has been established

  17. Practical C++ financial programming

    CERN Document Server

    Oliveira, Carlos

    2015-01-01

    Practical C++ Financial Programming is a hands-on book for programmers wanting to apply C++ to programming problems in the financial industry. The book explains those aspects of the language that are more frequently used in writing financial software, including the STL, templates, and various numerical libraries. The book also describes many of the important problems in financial engineering that are part of the day-to-day work of financial programmers in large investment banks and hedge funds. The author has extensive experience in the New York City financial industry that is now distilled in

  18. Nitpicking C++ concurrency

    OpenAIRE

    Blanchette, Jasmin Christian; Weber, Tjark; Batty, Mark; Owens, Scott; Sarkar, Susmit

    2011-01-01

    Previous work formalized the C++ memory model in Isabelle/HOL in an effort to clarify the proposed standard's semantics. Here we employ the model finder Nitpick to check litmus test programs that exercise the memory model, including a simple locking algorithm. Nitpick is built on Kodkod (Alloy's backend) but understands Isabelle's richer logic; hence it can be applied directly to the C++ memory model. We only need to give it a few hints, and thanks to the underlying SAT solver it scales much ...

  19. C2 Agility

    DEFF Research Database (Denmark)

    Mitchell, Dr. William; Alberts, David S.; Bernier, Francois

    of improving C2 Agility with empirical evidence obtained from a set of retrospective case studies and simulation-based experiments. Further, it identified next steps toward practical implementation in NATO operations and priorities for increasing the rigor and practicality of methods for measuring...... and improving C2 Agility. The 21st century military mission space is large and complex, characterized by extreme uncertainty, and exposed to increased public and media scrutiny. In addition to the high intensity combat operations traditionally associated with the military, potential missions include a wide...

  20. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M

    2010-01-01

    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  1. Hepatitis C in India

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    positivity rates in these patients, accounting for nearly 24-. 28% of cases. .... Author. Punjab. Blood donors. 44,064. ELISA. 1.09%. Gupta et al 2004. Delhi. Voluntary blood ... contribution of hepatitis C in these disease conditions is summarized ...

  2. Fundamentals of C

    CERN Document Server

    Guruprasad, N

    2009-01-01

    The book presents a contemporary approach to programming. Complte C programs are presented as and when it is required. This Book is not a cookbook . To get the maximum benefit from this book, you should take as active a role as possible. Don`t just read the examples. Enter it into your system and try them out.

  3. Umesh C S Yadav

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Umesh C S Yadav. Articles written in Journal of Biosciences. Volume 28 Issue 2 March 2003 pp 215-221 Articles. Regulation of glucose utilization and lipogenesis in adipose tissue of diabetic and fat fed animals: Effects of insulin and manganese · Najma Z Baquer M Sinclair S ...

  4. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....

  5. Revised C++ coding conventions

    CERN Document Server

    Callot, O

    2001-01-01

    This document replaces the note LHCb 98-049 by Pavel Binko. After a few years of practice, some simplification and clarification of the rules was needed. As many more people have now some experience in writing C++ code, their opinion was also taken into account to get a commonly agreed set of conventions

  6. Narayan C Pradhan

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Narayan C Pradhan. Articles written in Bulletin of Materials Science. Volume 25 Issue 6 November 2002 pp 533-536. Synthesis and performance of a novel polyurethaneurea as pervaporation membrane for the selective removal of phenol from industrial waste water.

  7. D and C - slideshow

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/presentations/100013.htm D and C - series—Normal anatomy To use the ... MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Editorial team. Related MedlinePlus Health Topics ...

  8. C to VHDL compiler

    Science.gov (United States)

    Berdychowski, Piotr P.; Zabolotny, Wojciech M.

    2010-09-01

    The main goal of C to VHDL compiler project is to make FPGA platform more accessible for scientists and software developers. FPGA platform offers unique ability to configure the hardware to implement virtually any dedicated architecture, and modern devices provide sufficient number of hardware resources to implement parallel execution platforms with complex processing units. All this makes the FPGA platform very attractive for those looking for efficient heterogeneous, computing environment. Current industry standard in development of digital systems on FPGA platform is based on HDLs. Although very effective and expressive in hands of hardware development specialists, these languages require specific knowledge and experience, unreachable for most scientists and software programmers. C to VHDL compiler project attempts to remedy that by creating an application, that derives initial VHDL description of a digital system (for further compilation and synthesis), from purely algorithmic description in C programming language. This idea itself is not new, and the C to VHDL compiler combines the best approaches from existing solutions developed over many previous years, with the introduction of some new unique improvements.

  9. Suresh C. Jhanwar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Suresh C. Jhanwar. Articles written in Journal of Genetics. Volume 79 Issue 3 2000 pp 113-123. Characterization of newly established colorectal cancer cell lines: correlation between cytogenetic abnormalities and allelic deletions associated with multistep tumorigenesis · Hans Gerdes ...

  10. C N Sundaresan

    Indian Academy of Sciences (India)

    Fascinating Organic Molecules from Nature - Colours in Flight - Pigments from Bird Feathers and Butterfly Wings · N R Krishnaswamy C N Sundaresan · More Details Fulltext PDF. Volume 18 Issue 3 March 2013 pp 218-225 Series Article. Fascinating Organic Molecules from Nature - Hunting with Poisoned Arrows: Story of ...

  11. The 5C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche

    2014-01-01

    the approaches and reach a new level of conscious action when designing? Informed by theories of design thinking, knowledge production, and learning, we have developed a model, the 5C model, accompanied by 62 method cards. Examples of how the model has been applied in an educational setting are provided...

  12. Despite phylogenetic effects, C3-C4 lineages bridge the ecological gap to C4 photosynthesis.

    Science.gov (United States)

    Lundgren, Marjorie R; Christin, Pascal-Antoine

    2017-01-01

    C 4 photosynthesis is a physiological innovation involving several anatomical and biochemical components that emerged recurrently in flowering plants. This complex trait evolved via a series of physiological intermediates, broadly termed 'C 3 -C 4 ', which have been widely studied to understand C 4 origins. While this research program has focused on biochemistry, physiology, and anatomy, the ecology of these intermediates remains largely unexplored. Here, we use global occurrence data and local habitat descriptions to characterize the niches of multiple C 3 -C 4 lineages, as well as their close C 3 and C 4 relatives. While C 3 -C 4 taxa tend to occur in warm climates, their abiotic niches are spread along other dimensions, making it impossible to define a universal C 3 -C 4 niche. Phylogeny-based comparisons suggest that, despite shifts associated with photosynthetic types, the precipitation component of the C 3 -C 4 niche is particularly lineage specific, being highly correlated with that of closely related C 3 and C 4 taxa. Our large-scale analyses suggest that C 3 -C 4 lineages converged toward warm habitats, which may have facilitated the transition to C 4 photosynthesis, effectively bridging the ecological gap between C 3 and C 4 plants. The intermediates retained some precipitation aspects of their C 3 ancestors' habitat, and likely transmitted them to their C 4 descendants, contributing to the diversity among C 4 lineages seen today. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  13. Search for C+ C clustering in Mg ground state

    Indian Academy of Sciences (India)

    2017-01-04

    Jan 4, 2017 ... Finite-range knockout theory predictions were much larger for (12C,212C) reaction, indicating a very small 12C−12C clustering in 24Mg. (g.s.) . Our present results contradict most of the proposed heavy cluster (12C+12C) structure models for the ground state of 24Mg. Keywords. Direct nuclear reactions ...

  14. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2002-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 22-26 July (6 * 3 hour lectures). The course is organised by the CERN Technical Training Programme, it costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page, accessible from the Technical Training pages. Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  15. C++ for Particle Physicists

    CERN Multimedia

    2003-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 10 - 14 March. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page : http://cern.ch/TechnicalTraining/ENSTEC/p2002/Software/cpppp_e.asp Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  16. C++ FOR PARTICLE PHYSICISTS

    CERN Multimedia

    Monique Duval

    2002-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 22-26 July (6 * 3 hour lectures). The course is organised by the CERN Technical Training Programme, it costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page, accessible from the Technical Training pages. Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  17. C++ for Particle Physicists

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 8 - 12 October. The course costs 200 CHF, and advance registration is required. Please note that this will be the last session in 2001 and the next one is planned for March 2002. People with CERN EDH accounts can apply electronically directly from the Web course description page : http://www.cern.ch/Training/ENSTEC/P2001/Software/cpppp_e.htm   Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  18. C++ FOR PARTICLE PHYSICISTS

    CERN Multimedia

    TECHNICAL TRAINING; Tel. 74460

    2001-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on March 5 to 9. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page : http://www.cern.ch/Training/ENSTEC/P9798/Software/cpppp_e.htm Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  19. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 �- 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  20. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 - 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  1. Take the "C" Train

    Science.gov (United States)

    Lawton, Rebecca

    2008-01-01

    In this essay, the author recalls several of her experiences in which she successfully pulled her boats out of river holes by throwing herself to the water as a sea-anchor. She learned this trick from her senior guides at a spring training. Her guides told her, "When you're stuck in a hole, take the "C" train."" "Meaning?" The author asked her…

  2. k c anjaneya

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K C ANJANEYA. Articles written in Bulletin of Materials Science. Volume 39 Issue 5 September 2016 pp 1279-1284. Structural, electrical and electrochemical studies of LiNi 0.4 M 0.1 Mn 1.5 O 4 ( M = Co, Mg) solid solutions for lithium ion battery · G P NAYAKA K V PAI J ...

  3. C P Singh

    Indian Academy of Sciences (India)

    ... Simon-Gillo C P Singh V Singh M Sivertz A Soldatov R A Soltz S Sorensen P W Stankus N Starinsky P Steinberg E Stenlund A Ster S P Stoll M Sugioka T Sugitate J P Sullivan Y Sumi Z Sun M Suzuki E M Takagui A Taketani M Tamai K H Tanaka Y Tanaka E Taniguchi M J Tannenbaum J Thomas J H Thomas T L Thomas ...

  4. Hepatitis C in dermatology

    Directory of Open Access Journals (Sweden)

    Zonunsanga

    2015-10-01

    Full Text Available Hepatitis C is a serious public health problem all over the world. It is caused by a single stranded RNA virus. Most acute infections are subclinical, but in 75% of individuals, infection leads to a chronic hepatitis, which in some cases can progress to cirrhosis and occasionally development of hepatoma. It has wide range of dermatological manifestations. This review article deals with the overview of epidemiology, pathogenesis, clinical manifestations, management and prevention.

  5. Dicty_cDB: VSJ516 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mlhqv ntlvtllspiktmlkspvlmliltckrik*nkik*khtix*iiy Frame C: neiiisplfrscfsfpifhps...kqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqciry sr*nr

  6. Dicty_cDB: SFC593 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****

  7. Dicty_cDB: SLH810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA

  8. Isomerisation of c4-c6 aldoses with zeolites

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevated...... temperatures. C6 and C5 aldose sugars such as glucose and xylose, which are available in large amounts from biomass precursors, are isomerized to fructose and xylulose respectively, in a one or two-step process over inexpensive commercially available zeolite catalysts, containing aluminum as the only metal...

  9. Distinct Signaling Roles of cIMP, cCMP, and cUMP.

    Science.gov (United States)

    Seifert, Roland

    2016-10-04

    The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions

    International Nuclear Information System (INIS)

    2007-01-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  11. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  12. Hot pressing of B4C/SiC composites

    International Nuclear Information System (INIS)

    Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O.

    2005-01-01

    B 4 C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B 4 C/SiC composite samples were lower than monolithic B 4 C in all experimental conditions. (authors)

  13. Hepatitis B & C and HIV

    Science.gov (United States)

    ... Find Services HIV SERVICES LOCATOR Locator Search Search Hepatitis B & C Topics Hepatitis B Hepatitis C Hepatitis ... Infections Sexually Transmitted Diseases Smoking Women's Health Issues Hepatitis B Virus and Hepatitis C Virus Infection People ...

  14. Insulin C-peptide test

    Science.gov (United States)

    C-peptide ... the test depends on the reason for the C-peptide measurement. Ask your health care provider if ... C-peptide is measured to tell the difference between insulin the body produces and insulin someone injects ...

  15. The 6C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille

    2016-01-01

    students, teachers, and clients reflect on what abilities the designer must possess in order to be able to promote transformation. The study is informed by the 6C Model, a theory describing the types of knowledge production taking place in design processes, and by the Co-creation Cards, a collection...... of methods translating knowledge production into practical approaches. Design students from six design disciplines explore a regional challenge posed by the local official tourist organization: The City of Aarhus is the European Capital of Culture 2017—how can the entire region, including nineteen...

  16. CLR via C#

    CERN Document Server

    Richter, Jeffrey

    2010-01-01

    Dig deep and master the intricacies of the common language runtime (CLR) and the .NET Framework 4.0. Written by a highly regarded programming expert and consultant to the Microsoft® .NET team, this guide is ideal for developers building any kind of application-including Microsoft® ASP.NET, Windows® Forms, Microsoft® SQL Server®, Web services, and console applications. You'll get hands-on instruction and extensive C# code samples to help you tackle the tough topics and develop high-performance applications.

  17. C programming language essentials

    CERN Document Server

    Ackermann, Ernest C

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. C Programming Language discusses fundamental notions, data types and objects, expressions, statements, declarations, function and program structure, the preprocessor, and the standar

  18. Programming with C++

    CERN Document Server

    Juneja, BL

    2009-01-01

    About the Book: Authors have taken special care to present the various topics in Programming with C++ in an easy-to-learn style. Almost every topic is followed by well designed live programmes so that it becomes easy to grasp the underlying principle or programming technique. A total of more than 450 live programmes are included in the book. It is also taken care that programmes are short and do not include such details which do not relate to the topic on hand. This makes them easy to be tested and suitable for practice students. Authors are confident that the book will prove its worth for th

  19. Dicty_cDB: VFN130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XSSXXXTPKPKPKPKPTPTTSTPNLSAKSATNSPYKSSIRNASPQP TSKPK Frame B: ---xxxxxxxxxxxhhxxx...qhqnqnqnqnqhqqhqhqiyqpnqqqihhinhqlgmhhhnp hqnqn Frame C: ---xxxxxxnxxxxiixxxntktktktktntnnintkfisqisnkfti*ii

  20. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  1. Dicty_cDB: AFL805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: ---rf*vkkkrfffxxgkkxkkxkxxxxxkxxxxxxxxxxxkxkxxxxkxsxxkkknk Frame B: ---GFRXKKKGFFLXXXKKXKNXKXXXXXKX...XXXXXXXXXXKXKXXXXKXPXEKKKIK Frame C: ---vlgxkkkvffxpwxkkxktkxxxxxxkxxxxxxxxxxxxkxxxxxkxxx

  2. Dicty_cDB: AFM354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NGXVVLXXXXIXXIHXF XQVXSVXXXXXX Frame B: ---vxxxqxxqarigxwxxxxxxkxxxxxxxxfxcwxxxcxlxmxwwffxxxx...yxxsixx fkxnqxxxxxx Frame C: ---xxxxrxxrqelxxgxxxxgxkxxvrxqxxxnvgxxxaxxxwxggslxxyxxfxpsix ssxisxxxxxx

  3. Dicty_cDB: VSD612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlw...lpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtmfk*ihiklkq Frame C:

  4. Dicty_cDB: VSD542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rlpsag vgymvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgni lgpvakecsdlwp...vkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevk gnilgpvakecsdlgqrlppmpvplfk*ihik Frame C: frcihk*cqkhkpsvv

  5. Dicty_cDB: VSF769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlwpkvatna... dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtiv*int Homology vs CSM-cDNA

  6. Selective terminal C–C scission of C5-carbohydrates

    NARCIS (Netherlands)

    Klis, van der F.; Gootjes, L.; Haveren, van J.; Es, van D.S.; Bitter, J.H.

    2015-01-01

    The selective catalytic production of C4-tetritols (erythritol and threitol) from C5-sugars is an attractive route for the conversion of non-digestible sugars to C4-building blocks from agro residues. Here we show that an unprecedented high selectivity of 20–25% C4-tertritols can be achieved under

  7. Dicty_cDB: CHH542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35.1 UCRCS08_0003L02_f Parent Washington Navel Orange Callus cDNA Library UCRCS08...cDNA library - UCR Poncirus trifoliata cDNA clone UCRPT01_02_C04, mRNA sequence. 40 0.002 2 CV714035 |CV7140

  8. Microscopic investigation of the 12C + 12C interaction

    International Nuclear Information System (INIS)

    Baye, D.; Pecher, N.; Brussels Univ.

    1982-01-01

    The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)

  9. BURNER RIG TESTING OF A500 C/SiC

    Science.gov (United States)

    2018-03-17

    AFRL-RX-WP-TR-2018-0071 BURNER RIG TESTING OF A500® C /SiC Larry P. Zawada Universal Technology Corporation Jennifer Pierce UDRI...TITLE AND SUBTITLE BURNER RIG TESTING OF A500® C /SiC 5a. CONTRACT NUMBER In-House 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62102F 6...test program characterized the durability behavior of A500® C /SiC ceramic matrix composite material at room and elevated temperature. Specimens were

  10. Bioremediation of Bunker C

    International Nuclear Information System (INIS)

    Emery, D.D.

    1992-01-01

    In the states of Washington and Oregon, the highest priority for waste management is now given to recycling, reuse and permanent solutions as opposed to landfill disposal. Bioremediation is recognized as a treatment of choice over other technologies that do not provide permanent solutions. From a business point of view, it is usually the most cost-effective. Bioremediation works extremely well for most common hydrocarbons including aviation fuel, heating oil and diesel oil. Bunker C, a high boiling point distillate, is the most recalcitrant hydrocarbon for treatment and is the topic of this paper. Bunker C lives up to its reputation of being a very recalcitrant hydrocarbon to biodegrade. The authors have demonstrated, however, that the soil matrix standards at industrial sites in Washington and Oregon can be achieved using new bioremediation techniques. These techniques are necessary over those typically used to biodegrade jet fuel, heating oil and diesel oil. These extra steps have been developed for our own use in our treatability laboratory

  11. Interfacial characterization of CVI-SiC/SiC composites

    International Nuclear Information System (INIS)

    Yang, W.; Kohyama, A.; Noda, T.; Katoh, Y.; Hinoki, T.; Araki, H.; Yu, J.

    2002-01-01

    The mechanical properties of the interfaces of two families of chemical vapor infiltration SiC/SiC composites, advanced Tyranno-SA and Hi-Nicalon fibers reinforced SiC/SiC composites with various carbon and SiC/C interlayers, were investigated by single fiber push-out/push-back tests. Interfacial debonding and fibers sliding mainly occurred adjacent to the first carbon layer on the fibers. The interfacial debonding strengths and frictional stresses for both Tyranno-SA/SiC and Hi-Nicalon/SiC composites were correlated with the first carbon layer thickness. Tyranno-SA/SiC composites exhibited much larger interfacial frictional stresses compared to Hi-Nicalon/SiC composites. This was assumed to be mainly contributed by the rather rough surface of the Tyranno-SA fiber

  12. Transport properties at 3C-SiC interfaces

    OpenAIRE

    Eriksson, Gustav Jens Peter

    2011-01-01

    For years cubic (3C) silicon carbide (SiC) has been believed to be a very promising wide bandgap semiconductor for high frequency and high power electronics. However, 3C-SiC is fraught with large concentrations of various defects, which have so far hindered the achievement of the predicted properties at a macroscopic level. These defects have properties that are inherently nanoscale and that will have a strong influence on the electrical behavior of the material, particularly at interfaces c...

  13. Meningococcal disease serogroup C

    Directory of Open Access Journals (Sweden)

    Cuevas IE

    2012-03-01

    Full Text Available Félix O Dickinson1, Antonio E Pérez1, Iván E Cuevas21Department of Epidemiology, “Pedro Kourí” Institute, Havana, Cuba; 2Pharmacovigilance Group, Finlay Institute, Havana, CubaAbstract: Despite current advances in antibiotic therapy and vaccines, meningococcal disease serogroup C (MDC remains a serious threat to global health, particularly in countries in North and Latin America, Europe, and Asia. MDC is a leading cause of morbidity, mortality, and neurological sequelae and it is a heavy economic burden. At the individual level, despite advances in antibiotics and supportive therapies, case fatality rate remains nearly 10% and severe neurological sequelae are frequent. At the population level, prevention and control of infection is more challenging. The main approaches include health education, providing information to the public, specific treatment, chemoprophylaxis, and the use of vaccines. Plain and conjugate meningococcal C polysaccharide vaccines are considered safe, are well tolerated, and have been used successfully for over 30 years. Most high-income countries use vaccination as a part of public health strategies, and different meningococcal C vaccination schedules have proven to be effective in reducing incidence. This is particularly so with conjugate vaccines, which have been found to induce immunogenicity in infants (the age group with the highest incidence rates of disease, stimulate immunologic memory, have longer effects, not lead to hyporesponsiveness with repeated dosing, and decrease acquisition of nasopharyngeal carriage, inducing herd immunity. Antibiotics are considered a cornerstone of MDC treatment and must be administered empirically as soon as possible. The choice of which antibiotic to use should be made based on local antibiotic resistance, availability, and circulating strains. Excellent options for a 7-day course are penicillin, ampicillin, chloramphenicol, and third-generation cephalosporins (ceftriaxone and

  14. Glucocorticosteroids for viral hepatitis C

    DEFF Research Database (Denmark)

    Brok, J; Mellerup, M T; Krogsgaard, K

    2004-01-01

    Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection.......Hepatitis C virus may cause liver inflammation and fibrosis. It is not known whether glucocorticosteroids are beneficial or harmful for patients with hepatitis C infection....

  15. Curiosities at c=1

    International Nuclear Information System (INIS)

    Ginsparg, P.

    1988-01-01

    We consider conformal field theories on a torus with central charge c=1, and in particular models based upon modding out string propagation on the SU(2) group manifold by its finite subgroups. We find that the partition functions for these models coincide with the continuum limit partition functions of a recently introduced class of RSOS models, defined in terms of the extended Dynkin diagrams of simply-laced Lie algebras, thus giving an alternative interpretation for the primary fields in these latter theories. Three of the models have no massless moduli and thus do not lie on the same line of critical points with the rest. The particular correspondence between simply-laced Lie algebras and finite subgroups of SU(2) that emerges coincides with that which has already appeared in other mathematical contexts. (orig.)

  16. 8C.02

    DEFF Research Database (Denmark)

    Jensen, B L; Frederiksen-Moller, B; Jorgensen, J S

    2015-01-01

    OBJECTIVE: The serine protease prostasin (PRSS8, CAP1) and its activator matriptase and inhibitor nexin-1 are necessary for normal placental development in mice. Prostasin is regulated by aldosterone in the kidney and may activate the epithelial sodium channel (ENaC). Preeclampsia is characterized...... by disturbed placentation, suppression of aldosterone and avid renal sodium retention with hypertension. It was hypothesized that preeclampsia is associated with low prostasin expression in placenta and spillover of prostasin into urine across the defect glomeular barrier. DESIGN AND METHOD: The hypothesis...... or placental weight. In summary, preeclampsia is associated with increased urine but not plasma or tissue prostasin CONCLUSIONS: : It is concluded that placental and plasma prostasin level is not controlled by aldosterone during term pregnancy. In contrast, prostasin is aberrantly filtered and may contribute...

  17. Highly Stable [C60AuC60]+/- Dumbbells.

    Science.gov (United States)

    Goulart, Marcelo; Kuhn, Martin; Martini, Paul; Chen, Lei; Hagelberg, Frank; Kaiser, Alexander; Scheier, Paul; Ellis, Andrew M

    2018-05-17

    Ionic complexes between gold and C 60 have been observed for the first time. Cations and anions of the type [Au(C 60 ) 2 ] +/- are shown to have particular stability. Calculations suggest that these ions adopt a C 60 -Au-C 60 sandwich-like (dumbbell) structure, which is reminiscent of [XAuX] +/- ions previously observed for much smaller ligands. The [Au(C 60 ) 2 ] +/- ions can be regarded as Au(I) complexes, regardless of whether the net charge is positive or negative, but in both cases, the charge transfer between the Au and C 60 is incomplete, most likely because of a covalent contribution to the Au-C 60 binding. The C 60 -Au-C 60 dumbbell structure represents a new architecture in fullerene chemistry that might be replicable in synthetic nanostructures.

  18. Oxidation protection of multilayer CVD SiC/B/SiC coatings for 3D C/SiC composite

    International Nuclear Information System (INIS)

    Liu Yongsheng; Cheng Laifei; Zhang Litong; Wu Shoujun; Li Duo; Xu Yongdong

    2007-01-01

    A CVD boron coating was introduced between two CVD SiC coating layers. EDS and XRD results showed that the CVD B coating was a boron crystal without other impurity elements. SEM results indicated that the CVD B coating was a flake-like or column-like crystal with a compact cross-section. The crack width in the CVD SiC coating deposited on CVD B is smaller than that in a CVD SiC coating deposited on CVD SiC coating. After oxidation at 700 deg. C and 1000 deg. C, XRD results indicated that the coating was covered by product B 2 O 3 or B 2 O 3 .xSiO 2 film. The cracks were sealed as observed by SEM. There was a large amount of flake-like material on hybrid coating surface after oxidation at 1300 deg. C. Oxidation weight loss and residual flexural strength results showed that hybrid SiC/B/SiC multilayer coating provided better oxidation protection for C/SiC composite than a three layer CVD SiC coating at temperatures from 700 deg. C to 1000 deg. C for 600 min, but worse oxidation protection above 1000 deg. C due to the large amount of volatilization of B 2 O 3 or B 2 O 3 .xSiO 2

  19. C. Gordon Fullerton

    Science.gov (United States)

    1989-01-01

    C. Gordon Fullerton is a research pilot at NASA's Dryden Flight Research Center, Edwards, California. His assignments include a variety of flight research and support activities piloting NASA's B-52 launch aircraft, the 747 Shuttle Carrier Aircraft (SCA), and other multi-engine and high performance aircraft. Fullerton, who has logged 382 hours in space flight, was a NASA astronaut from September 1969 until November 1986 when he joined the Flight Crew Branch at Dryden. In July 1988, he completed a 30-year career with the U.S. Air Force and retired as a colonel. As the project pilot on the NASA B-52 launch aircraft, Fullerton flew during the first six air launches of the commercially developed Pegasus space vehicle. He was involved in a series of development air launches of the X-38 Crew Recovery Vehicle and in the Pegasus launch of the X-43A Hyper-X advanced propulsion project. Fullerton also flies Dryden's DC-8 Airborne Science aircraft, regularly deployed worldwide to support a variety of research studies, including atmospheric physics, ground mapping and meteorology. In addition to these current activities, Fullerton has been involved in numerous other research programs at Dryden. He was the project pilot on the Propulsion Controlled Aircraft program, during which he successfully landed both a modified F-15 and an MD-11 transport with all control surfaces neutralized, using only engine thrust modulation for control. Assigned to evaluate the flying qualities of the Russian Tu-144 supersonic transport during two flights in 1998, he reached a speed of Mach 2 and became one of only two non-Russian pilots to fly that aircraft. He piloted a Convair 990 modified to test space shuttle landing gear components during many very high-speed landings. Other projects for which he has flown in the past include the C-140 JetStar Laminar Flow Control; F-111 Mission Adaptive Wing; F-14 Variable Sweep Flow Transition; Space Shuttle drag chute and F-111 crew module parachute tests

  20. Early antihepatitis C virus response with second-generation C200/C22 ELISA

    NARCIS (Netherlands)

    van der Poel, C. L.; Bresters, D.; Reesink, H. W.; Plaisier, A. A.; Schaasberg, W.; Leentvaar-Kuypers, A.; Choo, Q. L.; Quan, S.; Polito, A.; Houghton, M.

    1992-01-01

    Detection of early antibody to hepatitis C virus (HCV) by a new second-generation C200/C22 anti-HCV enzyme-linked immunosorbent assay (ELISA) and a four-antigen recombinant immunoblot assay (4-RIBA) was compared with the first-generation anti-HCV C100 ELISA using sequential serum samples of 9

  1. Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands

    International Nuclear Information System (INIS)

    Amiot, C.

    1983-01-01

    The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41

  2. Dicty_cDB: AFG169 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --LMKNLN*twllihhhc*krnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rf...rnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rfirqcrliwwyny vpryc*s

  3. Dicty_cDB: VSJ452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lkth*haqlllvitkri*pk*fhlml hqvntlvtllspiktmlkspvlmliltckrik*nkik*khtix* Frame C: ik*neiiisp...ydrndsi*csir* ihw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---ik*neiiisplfrscfsfpifhpslvklwyccr*ipnyq

  4. Demonstration of SiC Pressure Sensors at 750 C

    Science.gov (United States)

    Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender

    2014-01-01

    We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

  5. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  6. Dicty_cDB: CHQ769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al

  7. Dicty_cDB: VFH554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

  8. Interstellar clouds toward 3C 154 and 3C 353

    International Nuclear Information System (INIS)

    Federman, S.R.; Evans, N.J. II; Willson, R.F.; Falgarone, E.; Combes, F.; Texas Univ., Austin; Tufts Univ., Medford, MA; Meudon, Observatoire, France)

    1987-01-01

    Molecular observations of the interstellar clouds toward the radio sources 3C 154 and 3C 353 were obtained in order to elucidate the physical conditions within the clouds. Maps of (C-12)O emission in the J = 1-0 and J = 2-1 lines were compared with observations of the (C-13)O, CH, and OH molecules. The peak emission in the (C-12)O transitions does not occur in the direction of the continuum sources, and thus, an incomplete picture arises when only one line of sight in the two clouds is analyzed. The cloud toward 3C 154 appears to have a low extinction, but a relatively high CO abundance, suggesting that it is similar to high-latitude clouds and CO-rich diffuse clouds. The cloud toward 3C 353 is considerably denser than that toward 3C 154 and may be more like a dark cloud. 32 references

  9. Dicty_cDB: SHE454 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VTHTPVNVDDNNKCTIDTCTKEGGVTHTPINTDDNNACTLDSCSXXXGVSHTPNK X****xmdl*nscsklnwlx*ippinwddxnxc--- Frame C: lmitmp...vhlipvhhqlvfptpqltvmivihvp*thvqiqpvv*tlqsmlmiiihvl*mlv pnqqvshipq*m*mittnvqlmhvpkkvv*lilqstlmitm...xmiitnvqlihvpkkvv*lilqsilmitmpvplipahxxlvfpippin xddnnxwtcrihvpnstgxgkylqltgtixxxv--- Homology vs CSM-cDNA S

  10. Dicty_cDB: VFL581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla

  11. Dicty_cDB: VFM647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst

  12. Dicty_cDB: AFK702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ity*ptrkcyrnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin ...rnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin t*ywsicldrke**wy*rir*tiitrcfsfivltkwn

  13. Irradiation effect on Nite-SiC/SiC composites

    International Nuclear Information System (INIS)

    Hinoki, T.; Choi, Y.B.; Kohyama, A.; Ozawa, K.

    2007-01-01

    Full text of publication follows: Silicon carbide (SiC) and SiC composites are significantly attractive materials for nuclear application in particular due to exceptional low radioactivity, excellent high temperature mechanical properties and chemical stability. Despite of the excellent potential of SiC/SiC composites, the prospect of industrialization has not been clear mainly due to the low productivity and the high material cost. Chemical vapor infiltration (CVI) method can produce the excellent SiC/SiC composites with highly crystalline and excellent mechanical properties. It has been reported that the high purity SiC/SiC composites reinforced with highly crystalline fibers and fabricated by CVI method is very stable to neutron irradiation. However the production cost is high and it is difficult to fabricate thick and dense composites by CVI method. The novel processing called Nano-powder Infiltration and Transient Eutectic Phase (NITE) Processing has been developed based on the liquid phase sintering (LPS) process modification. The NITE processing can achieve both the excellent material quality and the low processing cost. The productivity of the processing is also excellent, and various kinds of shape and size of SiC/SiC composites can be produced by the NITE processing. The NITE processing can form highly crystalline matrix, which is requirement for nuclear application. The objective of this work is to understand irradiation effect of the NITESiC/SiC composites. The SiC/SiC composites used were reinforced with high purity SiC fibers, Tyranno TM SA and fabricated by the NITE method. The NITE-SiC/SiC composite bars and reference monolithic SiC bars fabricated by CVI and NITE were irradiated at up to 1.0 dpa and 600-1000 deg. C at JMTR, Japan. Mechanical properties of non-irradiated and irradiated NITESiC/ SiC composites bars were evaluated by tensile tests. Monolithic SiC bars were evaluated by flexural tests. The fracture surface was examined by SEM. Ultimate

  14. Dicty_cDB: VSJ304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LPIYRDGDFVLTQSSTIARYIAKKHNFMGKNLEEEFLVD--- ---prvpkklxlni*nvniispkfnlfprswirsilscfiklswnsi*kyysy*nfrcps cns...lyekyfgsfekklqetgflvgssvtladlyvyvgfdyirfrgeaalssel sdekypkiaelkkffesnegvakyikerpetkf*tvfiti Frame C: ktklni*nvniisp

  15. Integration of C1 and C2 Metabolism in Trees

    OpenAIRE

    Jardine, Kolby J.; Fernandes de Souza, Vinicius; Oikawa, Patty; Higuchi, Niro; Bill, Markus; Porras, Rachel; Niinemets, Ülo; Chambers, Jeffrey Q.

    2017-01-01

    C1 metabolism in plants is known to be involved in photorespiration, nitrogen and amino acid metabolism, as well as methylation and biosynthesis of metabolites and biopolymers. Although the flux of carbon through the C1 pathway is thought to be large, its intermediates are difficult to measure and relatively little is known about this potentially ubiquitous pathway. In this study, we evaluated the C1 pathway and its integration with the central metabolism using aqueous solutions of 13C-labele...

  16. Dicty_cDB: CHR636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

  17. Forging C-C Bonds Through Decarbonylation of Aryl Ketones.

    Science.gov (United States)

    Somerville, Rosie J; Martin, Ruben

    2017-06-06

    The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Dicty_cDB: SFK882 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence ptgkfhvykqinkiqvcrdlsihlfvvpcwsslfnksvhtfflvmlsk*iknlvrnhiih tytytyinkylilkngnknnsnkimiptvpkvewnilrsnlips*rvnsydaft...sisxfrxkk Frame C: ptgkfhvykqinkiqvcrdlsihlfvvpcwsslfnksvhtfflvmlsk*iknlvrnhiih tytytyinkylilkngnknnsnkimiptvpkvewnilrsnlips*rvnsydaf

  19. Dicty_cDB: SSJ391 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**nr...** lk Frame C: ---gxgi*gcvdiqvrvkkkpergfhgwldelnfrgcskq*nlngdcqgffvaknhrvsv vemeadgfkady*rksqkvrkscalavcti**

  20. Dicty_cDB: CFC794 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c*nsxw*npspwkskvvitlxmskpkxktkkvfxqin kvsfsxvnn*xxavlxxittskxnplsx*fsd*kvvckxl*kpxlvxpsxwkxkvxitxk msxpkfxtk...tiffck***liiif*ilyffkhikiffflcilfffpfxhin*lckfllklslvkps hwklkvxttlkmsxlkfktkkvfh

  1. Dicty_cDB: SHA333 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFR FISN*klkiklinkyknkfn Translated Amino...LQSASVIKEGYSLNNNFYISETPFSLASTTHIDKTFISTNKEAIIVDTIKKAEDGTSFV VRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSYKFNDT...IKINPFEIKTFR FISN*klkiklinkyknkfn Frame C: KDAIQLEYKDTKIGESFGPSWTNYWFKVTIDVPTDWKD

  2. Dicty_cDB: CFJ554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: ---LFPHCSENXLXXXQREXTTXPXRNXPRXGHXSALXXXXRXXXXRPSCTN Frame B: ---sfltvpktxxxxprexxqhxpxexnqdxdtxahxxxxxxxxxx...ghlvq Frame C: ---lsslfrkxaxxxperxxntpx*kxtkxwtlxrtxxxxsxxxxxailyk Hom

  3. Dicty_cDB: CFH318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: ---VXQXXLXXGIFXSXXVXKPGIFXIXXXGTGAXPGACWKLKKXAKXKXXXX Frame B: ---xxxxxxxxgfsfpxxxknpgflxlxxx...glgpxxghvgn*kxxxkxxsix Frame C: ---xxxxxxxxdfxfxxsxktrdf*xxlxxdwgpsxgmleiekxxxx

  4. Dicty_cDB: SFH756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PVSDNQ CQCSVGFSGDDCRQCDNGMVLWASDNGIPMCSPLNSLGKPKTCYAAY Frame B: ---xxxxxxxxxxxxxxxxxxkxxxxx*xxivnwhxxqvlvgsl...vhh*ihwvnqkpvmll Frame C: ---xxxxxxxxkxxxxxxxaxxxxxxxsxx*xigxxxkc*wvrfxk*lyvlxv*w

  5. Dicty_cDB: CHA864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ---XXXXXXXXXXXXXXXXXXXXXXMXXXIEXXXAAXESXXHGSXXFXYIMRDGXLERXX Frame B: ---xxxxxxxxxxxlxxxxxxxxxxcxvx*rxxx...qqxspxxmdxpfsxil*emvnwkexx Frame C: ---xxxxxxxxxvxxxxxxxxxxxxaxxyre

  6. Dicty_cDB: CHA554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIQILNSYFIFLYIVTFHKKKKKKKNLKXXXFXKKK--- ---xxxxxxxxxxxxxxxxxxxxvxxxmsxxxxxcxg*xwxxlcxxxxrxixr*fixrxi rwssr F...GXS GGHP Frame C: ihfyytnikfifyfsiycnis*kkkkkkkfkxxxfxkkk--- ---xxxxxxxxxxxsxxxxxxscxxxyvxlxxxvxrivmxxx

  7. Dicty_cDB: VFN350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2001.11.22 Translated Amino Acid sequence iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaick... C: iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaickakrg afketapddllapvikhiikvtkldpn*LEMLLWEQYYQDHHK

  8. Dicty_cDB: VHJ560 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Translated Amino Acid sequen...eiiryisqnivkrckdd dmvkegfveatqnckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Frame C: tivilqtynflkcl*

  9. Dicty_cDB: VSJ211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpva kecsdlwpkvatnagtiv*inthkvkti*kk--- -...lvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlgqrlppmpvpxlint* Frame C: k*cqkhkpsvvtteyhsvfqlvls*tvliilvp

  10. Dicty_cDB: VFG826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence ---LXXPLNXXTKXMXNXESXEKXKGGVMIXNVSKGALVXAXXAXVGLKSGKXXSLGXXX YENETXYFXQXPXGSIXKXXNXXLLIS*pnvmips...fxpxppxxxkkk Frame C: ---LXXPLNXXTKXMXNXESXEKXKGGVMIXNVSKGALVXAXXAXVGLKSGKXXSLGXXX YENETXYFXQXPXGSIXKXXNXXLLIS*pnvmips

  11. Dicty_cDB: VSE856 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LRTKNKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVFN QTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFA VKA*ici*milk...KNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFA VKA*ici*milknkiy*kk Frame C: klkllnsepktrlnylntsrn

  12. Dicty_cDB: VSC875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVF NQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milk...YSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy* Frame C: kklkllnsepktrlnylntsrnselssqv*

  13. Dicty_cDB: CFC703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHQAQAAHQVQAQAVLAQAV LVQGRKXI*xi* Frame C: ---ixiiiiiiixmxxxxiixkxxxiiixkxmmxxiimxxxxxxxxmxxxxxxxxx...lxxxlxxxxxxxxxllxxxxlxxxxxxiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii...iiii xkxxmxiimxxxmmxkxxxxxxxxxxxxxxmxxxxmxxxxxxxxxxlxxxqxxxxlxxxq xxxxxxxxlxxxqxxxx

  14. Dicty_cDB: SSB881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FLNDIKXGIKNQTAVWETKEFRDKYLTLDESK N*iksxxxxxxiiiiiiiiniayfpltlksqkkkkksxi*yk*ffflk...TAVWETKEFRDKYLTLDESK N*iksxxxxxxiiiiiiiiniayfpltlksqkkkkksxi*yk*ffflkk Frame C: ipihqxmmlhtqlpskklrlknnqslln

  15. Radiation effects in C cells

    International Nuclear Information System (INIS)

    Alcaraz Banos, M.; Garcia Ayala, A.; Meseguer Penalver, J.; Genoves Garcia, J.L.

    1994-01-01

    The para follicular cell (C cell) ultrastructure of euthyroid, propyl thiouracil-treated (PTU) and protyrreline-treated (TRH) irradiated rabbit thyroid gland was studied. The ultrastructural features of C cells in the non-irradiated thyroid glands were similar to those described in other mammals. We have not observed the disappearance of the C cells in irradiated thyroid glands. Clusters of C cells were occasionally observed in the irradiated glands. The irradiated C cells showed intranuclear, filamentous bundles and a dense body together with a well-developed endoplasmic reticulum and numerous secretory vesicles. C cells follicles could be observed in irradiated and TRH-treated animals. (Author)

  16. Dicty_cDB: CHM552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available actuca sativa cDNA clone QGB20J11, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA ...Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsx

  17. Dicty_cDB: SHL126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorr...hiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia m

  18. Dicty_cDB: CHJ706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA ...5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiz

  19. Dicty_cDB: SHJ838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Libra

  20. Dicty_cDB: CHN523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA... 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA L

  1. Dicty_cDB: SHG607 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sativa cDNA clone QGJ1L02, mRNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library... of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre

  2. Dicty_cDB: VSD136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c

  3. Dicty_cDB: SHE451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu

  4. Dicty_cDB: SFE866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...protein. 94 1e-21 2 AL385573 |AL385573.1 Medicago truncatula EST MtBC29C12F1 : T3 end of clone MtBC29C12 of

  5. Dicty_cDB: SSJ172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...te cds. 494 e-147 3 AL386374 |AL386374.1 Medicago truncatula EST MtBC34C06F1 : T3 end of clone MtBC34C06 of

  6. Dicty_cDB: SHJ446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available X4, complete sequence. 42 0.41 8 CX076494 |CX076494.1 UCRCS08_50C12_g Parent Washington Navel Orange Callus ... |CX076493.1 UCRCS08_50C12_b Parent Washington Navel Orange Callus cDNA Library U

  7. Dicty_cDB: VSI127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available w*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwy...ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwyssylfrs**ys...scsqnfis rkc*ny*sntkdwcsw*TSCFLTSKINEWCFSRIRRKIKIIYRIFFKKK--- ---lnk**ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**t sess*twcnn

  8. Remote mechanical C line

    International Nuclear Information System (INIS)

    Nuttall, K.R.; Gardner, P.R.

    1991-01-01

    Westinghouse Hanford Company is developing a desk-top simulation based training program on the operation of the Remote Mechanical C (RMC) Line process in the Plutonium Finishing Plant on the Hanford site, Richland, Washington. Simulations display aod contioually update current values of system parameters on computer graphics of RMC line equipment. Students are able to operate a variety of controllers to maintain proper system status. Programmed faults, selectable by the course instructor, can be used to test student responses to off-normal events. Prior to operation of the simulation, students are given computer-based tutorials on the function, processes, operation, and error conditions associated with individual components. By including the capability of operating each individual component - valves, heaters, agitators, etc. - the computer-based training (CBT) lessons become an interactive training manual. From one perspective RMC represents one step in the diffusion of the well-known and well-documented simulator training activities for nuclear reactor operators to other training programs, equally critical, perhaps, but less well scrutinized in the past. Because of the slowly responding nature of the actual process, RMC can retain many of the capabilities of practice and testing in a simulated work environment while avoiding the cost of a full scale simulator and the exposure and waste developed by practice runs of the RMC line. From another perspective RMC suggests training advances even beyond the most faithful simulators. For example, by integrating CBT lessons with the simulation, RMC permits students to focus in on specific processes occurring inside chosen components. In effect, the interactive training manual is available on-line with the simulation itself. Cost are also discussed

  9. Generation of a C3c specific monoclonal antibody and assessment of C3c as a putative inflammatory marker derived from complement factor C3

    DEFF Research Database (Denmark)

    Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette

    2010-01-01

    complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...

  10. Dicty_cDB: VHJ195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -B/AFN547Q.Seq.d/ 1342 0.0 SLE172 (SLE172Q) /CSM/SL/SLE1-C/SLE172Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...8502 ) Dictyostelium discoideum cDNA clone:dda28m11, 5' ... 839 0.0 2 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492...2597 ) Dictyostelium discoideum slug cDNA, clone SLD569. 113 2e-20 1 ( AU061182 ) Dictyostelium discoideum slug cDNA, clone SLD492

  11. Alcator C-Mod Tokamak

    Data.gov (United States)

    Federal Laboratory Consortium — Alcator C-Mod at the Massachusetts Institute of Technology is operated as a DOE national user facility. Alcator C-Mod is a unique, compact tokamak facility that uses...

  12. CoC Dashboard Reports

    Data.gov (United States)

    Department of Housing and Urban Development — Continuum of Care (CoC) Homeless Assistance Programs Dashboard Reports are available for each CoC and include information on each CoC’s awards by award amount,...

  13. Human complement component C3

    DEFF Research Database (Denmark)

    Behrendt, N

    1985-01-01

    The two common genetic variants of human C3, C3 S and C3 F, were purified and characterized by SDS-PAGE, agarose gel electrophoresis, isoelectric focusing and amino acid analysis. The difference in electrophoretic mobility between the two variants was conserved after purification, and by isoelect......The two common genetic variants of human C3, C3 S and C3 F, were purified and characterized by SDS-PAGE, agarose gel electrophoresis, isoelectric focusing and amino acid analysis. The difference in electrophoretic mobility between the two variants was conserved after purification......, and by isoelectric focusing of the hemolytically active proteins, pI values of 5.86 and 5.81 were determined for C3 S and C3 F, respectively. Any difference in amino acid composition was too small to be detected by amino acid analysis, and the two proteins had the same molecular weight as determined by SDS-PAGE....

  14. SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

  15. Hepatitis C: Sex and Sexuality

    Science.gov (United States)

    ... with Hepatitis » Sex and Sexuality: Entire Lesson Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For ... hepatitis C virus through sex. Can you pass hepatitis C to a sex partner? Yes, but it ...

  16. Preventing hepatitis B or C

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/patientinstructions/000401.htm Preventing hepatitis B or C To use the sharing features on this page, please enable JavaScript. Hepatitis B and hepatitis C infections cause irritation and ...

  17. Nitazoxanide for chronic hepatitis C

    DEFF Research Database (Denmark)

    Nikolova, Kristiana; Gluud, Christian; Grevstad, Berit

    2014-01-01

    BACKGROUND: Hepatitis C infection is a disease of the liver caused by the hepatitis C virus. The estimated number of chronically infected people with hepatitis C virus worldwide is about 150 million people. Every year, another three to four million people acquire the infection. Chronic hepatitis C......) and ribavirin was the approved standard treatment for chronic hepatitis C. In 2011, first-generation direct-acting antivirals (DAAs) have been licensed, for use in combination with peginterferon and ribavirin for treating hepatitis C virus genotype 1 infection. Nitazoxanide is another antiviral drug with broad...... antiviral activity and may have potential as an effective alternative, or an addition to standard treatment for the treatment of the hepatitis C virus. OBJECTIVES: To assess the benefits and harms of nitazoxanide in people with chronic hepatitis C virus infection. SEARCH METHODS: We searched The Cochrane...

  18. Structures, stabilities, aromaticity, and electronic properties of C66 fullerene isomers, anions (C662-, C664-, C666-), and metallofullerenes (Sc2-C66)

    International Nuclear Information System (INIS)

    Cui Yanhong; Tian, Wei Quan; Feng Jikang; Chen Deli

    2010-01-01

    Among all the 4478 classical isomers of C 66 , C 66 (C s :0060) with the lowest number of pentagon-pentagon fusions was predicted to be the most stable isomer, followed by isomers C 66 (C 2v :0011) and C 66 (C 2 :0083). The infrared spectra and aromaticity of the most stable isomers were predicted. The relative stabilities of C 66 isomers change with charges or doping of metals. The structures and relative stabilities of the most stable metallofullerenes were delineated and compared with experiment. Sc 2 -C 66 (C 2 :0083) was predicted to be the most stable metallofullerene, although Sc 2 -C 66 (C 2v :0011) was observed. Charge-transfer from Sc 2 to the fused pentagons and the bonding between these two moieties significantly decrease the strain energies caused by the pair of fused pentagons thereby stabilizing the fullerene cage.

  19. Screening effects on 12C+12C fusion reaction

    Science.gov (United States)

    Koyuncu, F.; Soylu, A.

    2018-05-01

    One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)

  20. Alcohol Use and Hepatitis C

    OpenAIRE

    Peters, Marion G.; Terrault, Norah A.

    2002-01-01

    Excess alcohol consumption can worsen the course and outcome of chronic hepatitis C. It is important to distinguish between alcohol abuse, which must be treated on its own merits, and the effect of alcohol use on progression, severity, and treatment of hepatitis C. Most studies on the effects of alcohol on hepatitis C have focused on patients, with high levels of daily alcohol intake. Indeed, the adverse effects of light and moderate amounts of alcohol intake on hepatitis C virus (HCV) infect...

  1. Hi-C First Results

    Science.gov (United States)

    Cirtain, Jonathan

    2013-01-01

    Hi-C obtained the highest spatial and temporal resolution observatoins ever taken in the solar corona. Hi-C reveals dynamics and structure at the limit of its temporal and spatial resolution. Hi-C observed ubiquitous fine-scale flows consistent with the local sound speed.

  2. Outlook on EDRS-C

    Science.gov (United States)

    Migliore, R.; Duncan, J.; Pulcino, V.; Bourne, D.; Voegt, S.; Perez, G.

    2017-09-01

    EDRS-C will operate on a geostationary orbit as the second node of the European Data Relay System (EDRS). The EDRS-C satellite, designed by OHB System as prime contractor, has been procured in the frame of a Public Private Partnership (PPP) between Airbus Defence and Space and ESA. EDRS-C is currently under assembly at OHB facilities in Bremen.

  3. A complex of cardiac cytochrome c1 and cytochrome c.

    Science.gov (United States)

    Chiang, Y L; Kaminsky, L S; King, T E

    1976-01-10

    The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of

  4. Java to C: A Primer

    DEFF Research Database (Denmark)

    McDowell, Charlie; Villadsen, Jørgen

    This book is designed to be used as a quick introduction to C for programmers already familiar with Java. It is not a replacement for a reference book on C but is instead a supplement. For the programmer already familiar with Java, the typical book on C requires the reader to wade through many...... details of already-familiar material. In this book, we quickly present the main concepts needed to begin writing serious programs in C, highlighting the differences between C and Java....

  5. Substrate-Mediated C-C and C-H Coupling after Dehalogenation.

    Science.gov (United States)

    Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald

    2017-03-15

    Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.

  6. Effective modern C++ 42 specific ways to improve your use of C++11 and C++14

    CERN Document Server

    Meyers, Scott

    2015-01-01

    At first glance, C++11 and C++14 are defined by the new features they introduce, e.g., auto type declarations, move semantics, lambda expressions, and concurrency support. Information on these features is easy to come by, but learning to apply them effectively (such that the resulting software is correct, efficient, maintainable, and portable) is more challenging. That’s the role of this book. It describes how to write effective software using C++11 and C++14, i.e., using modern C++. Topics include: * The pros and cons of uniform initialization, noexcept specifications, perfect forwarding, and smart pointer make functions. * The relationships among std::move, std::forward, rvalues references, and universal references. * The most effective forms of lambda capture. * How best practices in “old” C++ programming (i.e., C++98) require revision for modern C++. Effective Modern C++ follows the proven format of Scott Meyers’ earlier Effective books (Effective C++, More Effective C++, and Effective STL), but c...

  7. Quantification of C=C and C=O Surface Carbons in Detonation Nanodiamond by NMR

    Energy Technology Data Exchange (ETDEWEB)

    Cui, J -F; Fang, X -W; Schmidt-Rohr, K

    2014-05-08

    The ability of solid-state 13C NMR to detect and quantify small amounts of sp2-hybridized carbon on the surface of ~5 nm diameter nanodiamond particles is demonstrated. The C=C carbon fraction is only 1.1 ± 0.4% in pristine purified detonation nanodiamond, while a full single-layer graphitic or “bucky diamond” shell would contain ca. 25% of all C in a 5 nm diameter particle. Instead of large aromatic patches repeatedly proposed in the recent literature, sp3-hybridized CH and COH carbons cover most of the nanodiamond particle surface, accounting for ~5% each. C=O and COO groups also seen in X-ray absorption near-edge structure spectroscopy (XANES) but not detected in previous NMR studies make up ca. 1.5% of all C. They are removed by heat treatment at 800 °C, which increases the aromatic fraction. 13C{1H} NMR demonstrates that the various sp2-hybridized carbons are mostly not protonated, but cross-polarization shows that they are separated from 1H by only a few bond lengths, which proves that they are near the protonated surface. Together, the observed C–H, C–OH, C=O, and C=C groups account for 12–14% of all C, which matches the surface fraction expected for bulk-terminated 5 nm diameter diamond particles.

  8. Nanosized f.c.c. thallium inclusions in aluminium

    International Nuclear Information System (INIS)

    Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.

    1993-01-01

    Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)

  9. Electronically excited C 2 from laser photodissociated C 60

    Science.gov (United States)

    Arepalli, S.; Scott, C. D.; Nikolaev, P.; Smalley, R. E.

    2000-03-01

    Spectral and transient emission measurements are made of radiation from products of laser excitation of buckminsterfullerene (C 60) vapor diluted in argon at 973 K. The principal radiation is from the Swan band system of C 2 and, at early times, also from a black-body continuum. Transient measurements indicate two characteristic periods of decay 2 and 50 μs long, with characteristic decay times of ˜0.3 and 5 μs, respectively. The first period is thought to be associated with decomposition and radiative cooling of C 60 molecules or nano-sized carbon particles and the second period continues with decomposition products of laser excited C 60, C 58, C 56, etc.

  10. Dicty_cDB: SLA508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-101 SLD569 (SLD569Q) /CSM/SL/SLD5-C/SLD569Q.Seq.d/ 250 1e-65 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...oideum slug cDNA, clone SLD569. 250 2e-62 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 7

  11. Dicty_cDB: AFH685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 99 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence....dration Library Tortula ruralis cDNA, mRNA sequence. 70 4e-08 1 CK030146 |CK030146.....1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehy

  12. Dicty_cDB: AFK467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequenc....1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK03014...55.1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834

  13. Dicty_cDB: AFH538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 7...ge Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK030146.1

  14. Dicty_cDB: SLJ419 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm

  15. Dicty_cDB: SFF870 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aiiishhxhxsssxxxs xxss Frame C: anrkasicilnlylyks*innnnkknkknsiswfvriiilfffqkkx*kk--- ---adxxxxxxdhxxxhhhhxxg*x*xsxxxxsx*ssxxc...ssxxssxxcxsxcssxxxcx xxsxsxxsxxsx*xxxsxxss*sxs*xxxxsxsx*sxsssxxxssxxsxxxxxssxxsxs sxsxssss

  16. Dicty_cDB: VFA373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlfqeilkkmfnmplkvsngwvy*vlmkkl*irilqsivfalyskr nsltklvnvm*lslnitlssntlivqkkkfhhsfvmvfqmvvlqlhsllvfqlvsqlnss lmvklqlevllvq*llilftnfrei...kixkyxxxklnkk*kikkklifkkn Homology vs CSM-cDNA Score E S

  17. Dicty_cDB: VHE632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIFXFFFXKKK--- ---YKKLFINNIYIQWVTEHSKHTTVTT*aldtitsrpttvitiitltsisktteaklx* epiavntfqlvtinkftshttytvtnqxst*...tshttytvtnqxst*ntttvkxqskvittxtylltvtvmsxxpi ttiimlxskntsykqinkxkkk Homology vs CSM-cDNA Score E Sequences p

  18. Dicty_cDB: SHB845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ASNKQKK--- ---FNIVGNVKMAATATVYANIDALMSITTSTQTSIYQSSTKTVNGKTTTQSSSRSSSSI YKQFVPMIVCSGTADVAW*xqcrcfrsqsr*ncxmvlysnssqpqllkvmsx...I YKQFVPMIVCSGTADVAW*xqcrcfrsqsr*ncxmvlysnssqpqllkvmsxqlavsxqa Frame C: cwptgiqsnkqktti*knnnl**sknn*ritncffl

  19. Dicty_cDB: AFN538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshql lvvqdtlvlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkksgiilfimnf ...irwynyvpryc*sye*rinctctinnen*nyct Frame C: llnnskdfnyililnk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshql lvvqdtlvlwlvwvkrihmsx

  20. Dicty_cDB: VHH141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available avntfqlvtinkftshttytvtthssx*ntttvkxqskvittttslltvtvmsxppit tiimllskntsxkqinktikmckilk Translated Amino Acid ...tvtthssx*ntttvkxqskvittttslltvtvmsxppit tiimllskntsxkqinktikmckilk Homology vs CSM-cDNA Score E Sequences pr

  1. Dicty_cDB: CFG476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lts*pkvkkfhsqfh*nht lihhllmmvihtiqlafhfkdsiexilcyysi Translated Amino Acid sequence (All Frames) Frame A: ii...pststf*vlkksfqilklts*pkvkkfhsqfh*nht lihhllmmvihtiqlafhfkdsiexilcyysi Frame C: ns*NLFFIVLNIFFKMKKIILFLTVLLVL

  2. Dicty_cDB: VFA445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc*rt prs**krpktyl*rfss...kr*rrkln**--- ---teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc *rtprs**krpktyl*rfsspp*tpqirchgri

  3. Dicty_cDB: VSK150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NAAACAATTTAAAAAAAAAAAAACTAAAAATATCC sequence update 2001. 3.22 Translated Amino Acid sequence kvn*slllilnihrilqmmilk...rame C: kvn*slllilnihrilqmmilknslksyqklppllfqnlivnrlvsqr*TLIPTNKVLMV VLVVLINNMVVLMVIKNNNNKVLILLILVLNLVVVVHNK

  4. Efficient C/C++ programming smaller, faster, better

    CERN Document Server

    Heller, Steve

    1994-01-01

    Efficient C/C++ Programming describes a practical, real-world approach to efficient C/C++ programming. Topics covered range from how to save storage using a restricted character set and how to speed up access to records by employing hash coding and caching. A selective mailing list system is used to illustrate rapid access to and rearrangement of information selected by criteria specified at runtime.Comprised of eight chapters, this book begins by discussing factors to consider when deciding whether a program needs optimization. In the next chapter, a supermarket price lookup system is used to

  5. Dicty_cDB: VFD294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SSESLDN DDEEVNQINSKLPTKMTLRDQY Frame B: ---vxxxrxxxxxxxxxxxxxxxxxxxxx*x*fxyxxqx*f...lkmkmtmtmmmmmkkrkslklkvqighqsp*im mmkkltksipnyqlk*l*eint Frame C: ---fxxxgxxxxxxxxxxxxxxxxxxxxlxxdsxxxxkxdfx

  6. Dicty_cDB: CFF802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XTXXTKXTXSTKXTXXTKXTXSTKXTXSTKXTXXTKSPXSTXSTKPT XSTKXKXKKKTGKKKQKKTE Frame B: tfglssikfplk*y**YYKIIVIVQFVSFLFFFFXKXX--- ---d*qxxxxx...qxxxxxqnxxxqqnxxxxqnxxxxqnxxxxqnxxxqqnpxxxxxxqnxx xxqkxnxk...kkxekknkkkqk Frame C: llvylvssfh*nninniik***lynlyhsfffffxkxn--- ---inxxnxxnxxxxxnkxnxxnkxxxxxkxxxxxkxxxxxkxxxxnkipxxxxxx

  7. Dicty_cDB: AFL721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VRRADALNKILQDIGFPSICIHRDLDQKDRIEQYRKFKNFESRIMVATNIFGR GIDIERVNVVINYDMAESA Frame B: ---xxxvxxvxxxxxxxxxxxxxmvvxxlxmvxxnxxx...tlnlvswlplislvv vsilnvsmsssttiwlnl Frame C: ---xxxxxx*xxyxxxxxxxxxxw*xxxxxwxxxxxxxnx*rxke*kth*txgfirl*ss ryf

  8. Dicty_cDB: CFI277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nslated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxnxxxxxxkgxxxxxkxxxxkxyxxxxqxkx*cnxknrixtfn...NKTPVKPKLGEYG QKSIKTK Frame C: ---xxxxxxxxxxxxqxxxxxxxrxxxxxkxlxxqxixxxsxxqtxmq*xk*nxhfqslq ingsspxq*nis*vsa

  9. Dicty_cDB: CFH289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IFQKFHQHFQKNKIK*ikifk Translated Amino Acid sequence (All Frames) Frame A: ---vxxxxxnxxxxxnxxxxxnxxxxxxxxxxxkxkxxxxxxr*xxxtxxxx...VVQTNSPKSESTLSDYASYFD QFLNIVDLFTQKYNQQHQQDKKVKIITKLIIXKXKIIFQKFHQHFQKNKIK*ikifk Frame C: ---xxxxxxxxxxxxfxxxxxfxxxxxxxxxxkxkxxxxxx

  10. Dicty_cDB: SFJ266 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tpvqyenvkstvpaifdiai tiktdaknti*neindniyasndhrx*txxxxixxxxxxxxxxxxxxxxxxlxxxxxx--...k*iinmmnptktir**inwy*ksge*yqyy*ytcti*kc*insssni*hcyy hkn*c*kyhik*nq**yicfk*psxmnxtxxxxxxxxxxxxxxxxxxxxxxxxxxxx

  11. Dicty_cDB: AFM417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkkxlkxxlf*kkk--- ---xxxxxgxxxxxxxrxx*yxxcxxxxxxxxryxxxxxxixfxwxxixxwxxxx...ENVKTKI QDKEGIP Frame C: ihfyytnikfifyffiycnis*KKKKKKKXKXSXFLKKK--- ---xxxxwxxxxxxxxxxxixxxxxxxxxxxkvxxxxxkx

  12. Dicty_cDB: VSJ617 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 01. 3.26 Translated Amino Acid sequence rinfiqnqlnlkklnywrn*nqiqnqvifgklninqln*y*...msidhp*tn**mlgsstk**tnfq*ylktfrsfggki ilfftrytlvvk**srggertskerafq*nyrvftgkkihsqsfknnli Frame C: rinfiqnqlnl

  13. Dicty_cDB: SHF238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EGALKIKEITYCHAEGYSGGALKHGPFALIEQDTPIILIILE***fsinesr Translated Amino Acid sequence (All Frames) Frame A: il...YCHAEGYSGGALKHGPFALIEQDTPIILIILE***fsinesr Frame C: ssyklsniekknnnnni*LTIEIKNISKN

  14. Dicty_cDB: CHO707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available itdkkivmiiiqkqlivaiprlvnvltnhimlsqvvli*sl v*lgshwwgtggkgmqnxkxxtll Frame C: vllipqsm*miitnvqlihvpkkvv*lilqsilmitm...smpvpnqq vllipxsm*mittnvqlmhvpkxvv*lipqsilmitmpvqlmhvqkkvv*phtsxqy*** qclypltpvxhplafptpqltaxixipcxvxlmf---

  15. Dicty_cDB: SSH521 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKKKKKKKKKKKRKQIKNIYIYI* nikeiiq Translated Amino Acid sequence (All Frames) Frame A: ---enxkknfaifexapqesxg...KNLXLNTFFKKKKKKKKKKKKKKRKQIKNIYIYI* nikeiiq Frame C: ---kx*kelcnl*xcssrikxcpx*ktcx*ilflkkkkkkkkkkkkkkenkskiy

  16. Dicty_cDB: VSE508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GAPSDEDRHVGDLGNIVADGESNTKGTISDKIISLFGEHTI VGRTMVVHADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ*isn*nktllnikeappfy yyyfl...DSLTTGAAGARLGCGVIGVSQ*isn*nktllnikeappfy yyyfl Homology vs CSM-cDNA Score E Seque

  17. Dicty_cDB: SFJ810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y*rehfkqfe*cqtyy*rkcp*csknrlstkgtsswik* Frame C: yslyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassyasgi naskdqlnsnfknike...eqklikqkh*kk--- ---yslyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassya sginaskdqlnsnfknikenissnlnnakht

  18. Dicty_cDB: VSB406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTVRKAIARVLTVFNQTQKNHLR XVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Translated Ami...RRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici* milknkiy Homology vs CSM-cDNA Score E Sequences producing significant a

  19. Dicty_cDB: VSA330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Translated Am...TRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Frame C: kklkllnsepktrlnylntsrnselssqv

  20. Dicty_cDB: SLK302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qpqlqpqlplkfnqktffikyhynn nfnnnsikk*y*kspfflynf*IKYKINKKKKKISKKKKKKKK--- ---*i*sknifyqvslq**f****yqkmilk...iskkk Frame C: sassssassaattaattiattaatttatttattatttatttats*i*sknifyqvslq** f****yqkmilk

  1. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  2. Dicty_cDB: VSF365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ted Amino Acid sequence lishmnlkqklvsn*lmqvvkhltrshi*meleipilqfhsiiqvvmvgkcmvhhqshgm klwqyqlk*qfkilkm*LNHSNL...kn*lcstistckkfiitlf** ink*iiyin Frame C: lishmnlkqklvsn*lmqvvkhltrshi*meleipilqfhsiiqvvmvgkcmvhhqshgm klwqyq

  3. Dicty_cDB: AFB744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lqhpkripplpfsfxixrxyanfc*xlfxgktiplever***h*kcqsqnprqrry spxstxfhfxw*tixxwpxsl*lqhpkxipxpfsxxikrwxanxcknlxwx...xhxigsxrf **hxkcxxqnsxqxrysxrstxinfxwxtixxwxxxx*lqxskgixxpfsxxikrwxanx c*nfnr*nxpxgsxr***x*kc*sqxprqxrxspxst

  4. Dicty_cDB: SHA805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: fdeeyelakllkiqsfptiigfsngnflkkhtgpfrskshileflnhietehkkky*CKT LKKKKKKKXXXFXXK--- ---FDXEYELAKLLKIQSFPXIIGFSNGNFLKKHRGPFR...ed Amino Acid sequence fdeeyelakllkiqsfptiigfsngnflkkhtgpfrskshileflnhietehkkky*C...KT LKKKKKKKXXXFXXK--- ---FDXEYELAKLLKIQSFPXIIGFSNGNFLKKHRGPFRSKN Translated Amino Acid sequence (All Frames)

  5. Dicty_cDB: VSI877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame C: kishitkfllilstniky*ilkfrikik*ykekkkxr*kk--- ---isiwfixhcfyxiygihvxcl*eq*ryxqigcngsilxsmyfgly*inrsl...dqqiwl xxxsnawsfilylnkgmfrshl*kyvqcchygfhwwfgfiir*dfgfscfcslhhctlvw yg*isqsnhycsl

  6. Dicty_cDB: AFM145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGXP Frame B: ---xxxxxxxvxxxxxxxxxx...vxxxxmvglxxixiskxnxlsxwxxd*evvxkxlskh*x vrpsllklrxqiilxmlxqrfkxkkvshqtnkd*fslvnn*kmvv...ittfkrnplsi*fsd*evvckfl*klslvkplhsklkvvttlrm*kqkfktkkvx Frame C: ---xxxxxxrfxxxxxxxixx*xixxwxxxxxxqypkxixxpx

  7. Dicty_cDB: CHF875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fld* hskfpkwf**yfksil***kstndchlcyllqfqksp*ns Frame B: iiiiiiiiiiiiiiiiiiiiiiiixxxxmxxxxxxxxrxxxhhhhhnxxxx...VTSVIYCNFKNHLKTP Frame C: ***********************x*xx**xxxxxxxxxxxxttttttxxxxxcxxyccyx xyyxx*xxxx*xxqxx*xqxx

  8. Dicty_cDB: VHE759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

  9. Dicty_cDB: VSJ248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vrdnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtkiicsikvkymanm*kiviknsnikkkkkixwxkxxlxkx*k...kkfxgxxpfx*xfkkkxf*xffxxkk- -- ---dnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtk Frame C:

  10. Dicty_cDB: VHG647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIQVYSIFPSYTDGGEVIFYGWFTANSPISILIGSQTCTPTLVTTDQIKC NIGAGNGVKDISITQAGYTWFSPNSYEYVIXPTTPANCPTNCSNX--- ---ELNKLGY*inkfkkknee...KIQVYSIFPSYTDGGEVIFYGWFTANSPISILIGSQTCTPTLVTTDQIKC NIGAGNGVKDISITQAGYTWFSPNSYEYVIXPTTPANCPTNCSNX--- ---ELNKLGY*inkfkkknee...disitqagytwfspnsyeyvirpttpancptncsnrgycgagrcv Frame C: lnklgy*inkfkkkneensfnnfnfnfynfyk*lycrnmwkwlfkwxyl*fk*

  11. Dicty_cDB: AFE377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iikkikxtrsvglfaslfyfffqkkx*kk--- ---xixqliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiixiixxxxii...ssssssssssssssssxssxxxxsssalxxxxiixxx iixixi Homology vs CSM-cDNA Score E Sequences producing significant al

  12. Dicty_cDB: CFE102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yslnvqldpivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn...ivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn Frame C: neknniifnsttciiiw*n*itfiye

  13. Dicty_cDB: CHJ566 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence hmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqamgdwqrkl sdy*hstnafgfwvipnniadrgfifdkst...tiqikkvivktksliqie*nkllkn*vksm*tlklnfhvekkknsqdkpqlkdktk nnkkgxskdyks*enkxrssk Frame C: hmlvskikpcms

  14. Dicty_cDB: SHH309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGTAAAGGNATGCAAAACTGTAAAAATTAAATAACTCTTTT sequence update 2002.10.25 Translated Amino Acid sequence scspstgcvntpiscddknpctvdscnns...p*tvnvmtfvtlvnvvkiqenvitdkkivmiiiqkqlivaiprlvnvltnhimlsqvvli *slv*lvvslvvvqevkxcktvkik*lf Frame C: scspstgcvntpiscddknpctvdscnns

  15. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  16. Dicty_cDB: AFG886 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available anslated Amino Acid sequence *hfqhphiiltitkyri*niavytnttqasiyiyi*nkfilkfcnnsikqinr*IDNLFF FXXKFFFFKX--- ---S...nskffksinentxqtpxfthlentsx ttpn Frame C: *hfqhphiiltitkyri*niavytnttqasiyiyi*nkfilkfcnnsikqinr*IDNLFF FXXKFF

  17. Dicty_cDB: SSC483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAAA AAAAAAAAAAAAAAAAAC sequence update 1998.12. 2 Translated Amino Acid sequence eiliaiai***w****qxkyssnncnncnncnns...NSLIKNKELFIGFXRQSLNFWSEKKRNQXQRKR*kkknnkkkkiikkkktnkkkkkk kkn Frame C: eiliaiai***w****qxkyssnncnncnncnnsnns

  18. Caffeine-11C, ephedrine-11C and methylephedrine-11C: synthesis and distribution in mice

    International Nuclear Information System (INIS)

    Saji, Hideo; Ido, Tatsuo; Iwata, Ren; Suzuki, Kazutoshi; Tamate, Kazuhiko

    1978-01-01

    Caffeine, ephedrine and methylephedrine were labeled with carbon-11 by the action of methyliodide- 11 C on theophylline, norephedrine and ephedrine, respectively. Caffeine- 11 C was prepared in 44 min. with a radiochemical yield of 40%, ephedrine- 11 C in 45 min. with a 11% radiochemical yield and methylephedrine- 11 C in 36 min. with a 43% radiochemical yield. When injected in mice intravenously, these products show a high uptake in the liver, the kidney and the blood for caffeine- 11 C and in the liver and the kidney for ephedrine- 11 C and methylephedrine- 11 C. The brain uptake for these products was found to be 2.4 to 3.9% of the injected dose per gram at 5 min. after injection. These studies in mice have demonstrated that these products are potentially useful agents for the dynamic studies of the brain. (auth.)

  19. Joining of SiC ceramics and SiC/SiC composites

    Energy Technology Data Exchange (ETDEWEB)

    Rabin, B.H. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1996-08-01

    This project has successfully developed a practical and reliable method for fabricating SiC ceramic-ceramic joints. This joining method will permit the use of SiC-based ceramics in a variety of elevated temperature fossil energy applications. The technique is based on a reaction bonding approach that provides joint interlayers compatible with SiC, and excellent joint mechanical properties at temperatures exceeding 1000{degrees}C. Recent emphasis has been given to technology transfer activities, and several collaborative research efforts are in progress. Investigations are focusing on applying the joining method to sintered {alpha}-SiC and fiber-reinforced SiC/SiC composites for use in applications such as heat exchangers, radiant burners and gas turbine components.

  20. Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon

    Science.gov (United States)

    Pany, Satyabrata; Das, Joydip

    2015-01-01

    Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390

  1. TMS320C31 master

    International Nuclear Information System (INIS)

    Yun, Deok Yong

    1999-06-01

    The contents of this book are explanation of basic conception for DSP, perfect a complete master of TMS320C31, I/O interface design and memory, practice with PC print port, basic programing skill, assembly and C programing technique, timer and interrupt application skill, serial communication programing technique, application of digital conditioning and application of digital servo control. This book is divided into two parts, which is about TMS320C31 master of theory and application.

  2. Anti-C.Diff Pill

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Anand [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2018-01-30

    The anti- C.diff pill is being developed for patients who are at high risk for Clostridium difficile, a bacterium that causes diarrhea and serious intestinal conditions like colitis. C-diff is deadly, killing over 30,000 people a year in the United States and costing an average of $42,000 per treatment. The most common treatment is a fecal transplant (FT). The anti- C.diff replaces the invasive and messy FT practice with a pill.

  3. Dicty_cDB: VSK373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 2001. 3.22 Translated Amino Acid sequence *neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqcirys...kpslvemlplksnmvslhlsmkmflfavlkth*haqlllvitkri*pk*fhlmlhq vntlvtllspiktmlkspvlmliltckrik*kkkxkht Frame C: *neiiisp...cfylqfsrpismpnccw*lpkeydrndsi*csir*ih w*rcyhrskqc*nrly*c*y*lvne*nkik*NKNTPSIKKK--- ---*neiiisplfrscfsfpifhps

  4. C reaction from the Coulomb dissociation of C

    Indian Academy of Sciences (India)

    non-resonant continuum (corresponding to all multipoles and relative orbital angular ..... As mentioned earlier, 14C(n, γ )15C is in direct competition with proton, deuteron .... The local momentum approximation is also a price one has to pay to.

  5. C&S Enterprise, L.L.C.

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against C & S Enterprise, L.L.C. (“Respondent”), a business located at 2454 480th Ave, Deep River, IA 52222, for alleged violations of the Clean Water Act at property owned by Resp

  6. Dicty_cDB: CHN414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C137668.18 Medicago truncatula clone mth2-5f8, complete sequence. 52 2e-09 5 CV164410 |CV164410.1 rsmsx...sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia

  7. Dicty_cDB: SHK285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 52 4e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia m...iltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.s

  8. Dicty_cDB: CHR818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 52 5e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltior...rhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.

  9. Dicty_cDB: SHB431 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TGACATTGATAA sequence update 2002.10.25 Translated Amino Acid sequence llaywxynqinnly*kmsxsnsyfi**rir*tfas*k...skq iifc*innctknatn*INKKKKIIXKLFYLIYXLKKK--- ---YNQINNLY*kmsxvihisfneeldkxlqaexlvidfsaawcgpcxaxxpvfeklsne fv...tftxvhvdid Translated Amino Acid sequence (All Frames) Frame A: llaywxynqinnly*kmsxsnsyfi**rir*tfas*kisd*l*c...sqiilfnlxfkkk--- ---YNQINNLY*kmsxvihisfneeldkxlqaexlvidfsaawcgpcxaxxpvfeklsne fvtftxvhvdid Homology vs CSM-c

  10. Dicty_cDB: CHK742 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uncatula clone mth2-5f8, complete sequence. 52 1e-09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Librar...y of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsx

  11. Dicty_cDB: SHA189 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2, mRNA sequence. 80 8e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxl

  12. Dicty_cDB: SHA788 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia mil...tiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf

  13. Dicty_cDB: SHJ790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a cDNA clone QGJ1L02, mRNA sequence. 80 1e-10 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Sa...catula clone mth2-5f8, complete sequence. 52 8e-09 5 CV172465 |CV172465.1 rsmsxlr

  14. Dicty_cDB: SHE806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one mth2-5f8, complete sequence. 52 7e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1....scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsx

  15. Dicty_cDB: SHE135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library o...f Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_0

  16. Dicty_cDB: CHM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .ab1 QG_EFGHJ lettuce serriola Lactuca sativa cDNA clone QGJ1L02, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsx... 3e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia milti

  17. Dicty_cDB: SHG537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available catula clone mth2-5f8, complete sequence. 52 5e-09 5 CV164410 |CV164410.1 rsmsxl_...003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsx

  18. Get more control over your C/C++ service

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Are you looking for a way to better diagnose or monitor your C/C++ programs? Find out more about CMX - a neat, lightweight library (<32Kb) which targets this need. It allows to expose information from inside a process through a simple API, enabling pre-failure detection in combination with your favourite monitoring system.

  19. Dicty_cDB: SFF302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAATTCAAGACAAAGAAGGTATT C sequence update 2001. 6. 1 Translated Amino Acid sequence ---xxxixkvxprxtxxixggxxxxxwxxxx*xqxxkxxxxpxgxxxx...nshw*nhytrs*r**qh*ecknknsrqrry Translated Amino Acid sequence (All Frames) Frame A: ---xxxixkvxprxtxxixggxxxxxwxxxx*xqxxkxxxxpxgxxxx...shw*nhytrs*r**qh*ecknknsrqrry Frame B: ---xxr*xrfxxxxxvsfxxgxx*xxgxxxxdxxxqkxxtxxxvxrxxggxqxfvxtlxg ktixxexe...tlrmlkpksktkkvfhqinnvsfspvnnwrmv vlsxdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegi Frame C: ---xxdxxgxpxxnxxhfxxvxxxxmvxxxx...xxxxkkxxlxxwsxx*xvvxkxlxkh*xv rpsxlxlrxsxnienvktkdxxqrrypxrptkinfxw*tirxwxysx*lqhsk

  20. Dicty_cDB: AFI202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mvfwi*cgsrcnsxxcnsissfniktrr*nilxxyitn*wnvykfidytnixiy*xs ykntixkkktisxgxnxdxxxxxmxrgxxxxxxxxxxx--- ---XQXVD...KDSRDNIKIRSSFISSSLFFIK ISIWFFGYSVGQGATAXFAIPYQVSILRPEDKTYXXGILPISGMFINLLITPIXGYIXDH TKTPXGRRRPYLXXGTXXXXXXXXXEAXXXXPXXXXX--- ---xxx...ligxwpfihyqxkplakxwxfgxxllsxxlxxxx Frame C: iniikriwikwnqqhqkpp*hihqniqkvqk*yqkqvvkiv...viilklevalyhhlyfl*k yqygfldivwvkvqqxxlqfhikfqy*dqkikhixxvyyqlvecl*iy*lhqyxdilxii qkhhxeeedhiyxxerxxxxxxxxx...rxhxxxxxxxxx--- ---xxx*lgxgpsfitkxnxwqkxgxlaxxfyrxxxxxsx Homology vs CSM-cDNA Score

  1. Dicty_cDB: VSH879 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vegetative cDNA clone:VS... 58 3e-04 1 ( FG283397 ) 1108770600507 New World Screwworm Egg 9261 ESTs C... 38... 0.012 2 ( FG301147 ) 1108799260169 New World Screwworm Larvae 9387 EST... 38 0.013 2 ( FG297431 ) 1108793286826 New World

  2. Dicty_cDB: VHB154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL4181, mRNA se...quence. 72 5e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cD

  3. Dicty_cDB: VHB386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10.b1_C08.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL5210,... (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1285 0.0 1 EL476977 |EL476977.1 CHUL52

  4. Dicty_cDB: VHB564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 7...2 1e-17 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone

  5. Dicty_cDB: AFL429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration... sequence. 70 5e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRN

  6. Dicty_cDB: AFL314 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration ...NA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m

  7. Dicty_cDB: AFH680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179....hyscomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy

  8. Dicty_cDB: AFK581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 BM398179 |BM398179....hyscomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy

  9. Dicty_cDB: AFJ364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh

  10. Dicty_cDB: AFL268 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dration Library Tortula ruralis cDNA, mRNA sequence. 78 4e-10 1 BM398179 |BM398179.... patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehy

  11. Dicty_cDB: AFL127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-...trahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration

  12. Dicty_cDB: AFK427 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydrati...on Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.1 500

  13. Dicty_cDB: AFI675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CN597971 |CN5... mRNA sequence. 62 1e-05 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA

  14. Dicty_cDB: AFH816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ingle read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, m...4 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK0301

  15. Dicty_cDB: AFI447 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydrati...on Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179.1 500

  16. Dicty_cDB: AFN505 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s subsp. patens cDNA clone:pph30f12, 3' end,single read. 593 e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...equence. 70 5e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA

  17. Dicty_cDB: AFK784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...N206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA,

  18. Dicty_cDB: AFH576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...A sequence. 70 4e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mR

  19. Dicty_cDB: AFH828 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 CN597971 |CN5...ila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration

  20. Dicty_cDB: AFK470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 78 3e-10 1 CN59146...NA sequence. 70 7e-08 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, m

  1. Dicty_cDB: AFH744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 78 4e-10 1 BM398179 |BM398179.1

  2. Dicty_cDB: AFK831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ydration Library Tortula ruralis cDNA, mRNA sequence. 78 2e-10 1 BM398179 |BM398179...Physcomitrella patens subsp. patens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte reh

  3. Dicty_cDB: CHH862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d Amino Acid sequence thvlkinvlnqvv*lilqllvmikmpvp*thvqiqlvvstphlpvmixihaq*thvqtql availqsmsmitmhvlkinvlnqva...lnqvv*lilqld vmiimhvl*ihvqiqlvvlixq*nvmiiihvqlthvqiqlvvsipq*iatmvtsvxlihv vqlvvlihqlllmtithvqsxlvaiqpvssilqwivmitm...tvxsccnstgvvhtpvdcndnnvxtcdycsikqggkcihv Frame C: thvlkinvlnqvv*lilqllvmikmpvp*thvqiqlvvstphlpvmixihaq*thvqtql availqsmsmitm...ihqlllmtithvqsxlvaiqpvssilqwivmitmsllvitavsnkvvnvfmf Homology vs CSM-cDNA Score E Sequences producing signif

  4. Dicty_cDB: VFD555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ashington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa...10, mRNA sequence. 54 0.003 1 CB292489 |CB292489.1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated

  5. A new f.c.c. phase in yttrium films

    International Nuclear Information System (INIS)

    Kaul, V.K.; Srivastava, O.N.

    1976-01-01

    A new polymorphic phase characterised by a face-centered cubic structure, with lattice parameter 5.83 +- 0.02A, has been identified in thin films of yttrium. Electron diffraction evidence and electrical resistivity measurements have been carried out in order to detect the new f.c.c. phase. (Auth.)

  6. SiC/SiC Cladding Materials Properties Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Snead, Mary A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Katoh, Yutai [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Koyanagi, Takaaki [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Singh, Gyanender P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-08-01

    When a new class of material is considered for a nuclear core structure, the in-pile performance is usually assessed based on multi-physics modeling in coordination with experiments. This report aims to provide data for the mechanical and physical properties and environmental resistance of silicon carbide (SiC) fiber–reinforced SiC matrix (SiC/SiC) composites for use in modeling for their application as accidenttolerant fuel cladding for light water reactors (LWRs). The properties are specific for tube geometry, although many properties can be predicted from planar specimen data. This report presents various properties, including mechanical properties, thermal properties, chemical stability under normal and offnormal operation conditions, hermeticity, and irradiation resistance. Table S.1 summarizes those properties mainly for nuclear-grade SiC/SiC composites fabricated via chemical vapor infiltration (CVI). While most of the important properties are available, this work found that data for the in-pile hydrothermal corrosion resistance of SiC materials and for thermal properties of tube materials are lacking for evaluation of SiC-based cladding for LWR applications.

  7. Dicty_cDB: SSE446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e MtBC21H02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong ... T3 end of clone MtBC21H02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago

  8. Dicty_cDB: SHJ789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 01R1 : T7 end of clone MtBC46H01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Med...d of clone MtBC46H01 of cDNA library MtBC from arbuscular mycorrhiza of cultivar

  9. Dicty_cDB: VSG433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G08F1 : T3 end of clone MtBC23G08 of cDNA library MtBC from arbuscular mycorrhiza...tula EST MtBC26G02F1 : T3 end of clone MtBC26G02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar

  10. Dicty_cDB: AHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(

  11. Dicty_cDB: VFE826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rmelon lambda zap library Citrullus lanatus cDNA clone WMLS336 5' similar to acetyl...of Vitis vinifera var. Chardonnay Vitis vinifera cDNA clone VVC055H06 5, mRNA sequence. 60 3e-08 2 AI563047 |AI563047.1 EST00171 wate

  12. Dicty_cDB: VHI596 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a

  13. Oxidative electrochemical aryl C-C coupling of spiropyrans

    NARCIS (Netherlands)

    Ivashenko, Oleksii; van Herpt, Jochem T.; Rudolf, Petra; Feringa, Ben L.; Browne, Wesley R.

    2013-01-01

    The isolation and definitive assignment of the species formed upon electrochemical oxidation of nitro-spiropyran (SP) is reported. The oxidative aryl C-C coupling at the indoline moiety of the SP radical cation to form covalent dimers of the ring-closed SP form is demonstrated. The coupling is

  14. On the Michael addition of water to C = C bonds

    NARCIS (Netherlands)

    Chen, B.

    2015-01-01

    ?-Hydroxy carbonyl compounds are an important class of compounds often found as a common structural motif in natural products. Although the molecules themselves look rather simple, their synthesis can be challenging. Water addition to conjugated C = C bonds opens up a straightforward route for the

  15. Deformation microstructure and orientation of F.C.C. crystals

    DEFF Research Database (Denmark)

    Liu, Q.; Hansen, N.

    1995-01-01

    The effect of crystallographic orientation on the microstructural evolution in f.c.c. metals with medium to high stacking fault energy is analyzed. This analysis is based on a literature review of the behaviour of single crystals and polycrystals supplemented with an experimental study of cold...

  16. Presenilin dependence of phospholipase C and protein kinase C signaling

    DEFF Research Database (Denmark)

    Dehvari, Nodi; Cedazo-Minguez, Angel; Isacsson, Ola

    2007-01-01

    -stimulated phospholipase C (PLC) activity which was gamma-secretase dependent. To further evaluate the dependence of PLC on PSs we measured PLC activity and the activation of variant protein kinase C (PKC) isoforms in mouse embryonic fibroblasts (MEFs) lacking either PS1, PS2, or both. PLC activity and PKCalpha...

  17. Multilocus sequence typing (MLST methods for the emerging Campylobacter species C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus

    Directory of Open Access Journals (Sweden)

    William G Miller

    2012-04-01

    Full Text Available Multilocus sequence typing (MLST systems have been reported previously for multiple food- and food animal-associated Campylobacter species (e.g. C. jejuni, C. coli, C. lari and C. fetus to both differentiate strains and identify clonal lineages. These MLST methods focused primarily on campylobacters of human clinical (e.g. C. jejuni or veterinary (e.g. C. fetus relevance. However, other, emerging, Campylobacter species have been isolated increasingly from environmental, food animal or human clinical samples. We describe herein MLST methods for five emerging Campylobacter species: C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus. The concisus/curvus method uses the loci aspA, atpA, glnA, gltA, glyA, ilvD and pgm, whereas the other methods use the seven loci defined for C. jejuni (i.e., aspA, atpA, glnA, gltA, glyA, pgm, and tkt. Multiple food animal and human clinical C. hyointestinalis (n=48, C. lanienae (n=34 and C. sputorum (n=24 isolates were typed, along with 86 human clinical C. concisus and C. curvus isolates. A large number of sequence types (STs were identified using all four MLST methods. Similar to Campylobacter MLST methods described previously, these novel MLST methods identified mixed isolates containing two or more strains of the same species. Additionally, these methods speciated unequivocally isolates that had been typed ambiguously using other molecular-based speciation methods, such as 16S rDNA sequencing. Finally, the design of degenerate primer pairs for some methods permitted the typing of related species; for example, the C. hyointestinalis primer pairs could be used to type C. fetus strains. Therefore, these novel Campylobacter MLST methods will prove useful in speciating and differentiating strains of multiple, emerging Campylobacter species.

  18. Oracle 12c for dummies

    CERN Document Server

    Ruel, Chris

    2013-01-01

    Demystifying the power of the Oracle 12c database The Oracle database is the industry-leading relational database management system (RDMS) used from small companies to the world's largest enterprises alike for their most critical business and analytical processing. Oracle 12c includes industry leading enhancements to enable cloud computing and empowers users to manage both Big Data and traditional data structures faster and cheaper than ever before. Oracle 12c For Dummies is the perfect guide for a novice database administrator or an Oracle DBA who is new to Oracle 12c. The book covers what

  19. Normalized cDNA libraries

    Science.gov (United States)

    Soares, Marcelo B.; Efstratiadis, Argiris

    1997-01-01

    This invention provides a method to normalize a directional cDNA library constructed in a vector that allows propagation in single-stranded circle form comprising: (a) propagating the directional cDNA library in single-stranded circles; (b) generating fragments complementary to the 3' noncoding sequence of the single-stranded circles in the library to produce partial duplexes; (c) purifying the partial duplexes; (d) melting and reassociating the purified partial duplexes to moderate Cot; and (e) purifying the unassociated single-stranded circles, thereby generating a normalized cDNA library.

  20. C*-algebras by example

    CERN Document Server

    Davidson, Kenneth R

    1996-01-01

    The subject of C*-algebras received a dramatic revitalization in the 1970s by the introduction of topological methods through the work of Brown, Douglas, and Fillmore on extensions of C*-algebras and Elliott's use of K-theory to provide a useful classification of AF algebras. These results were the beginning of a marvelous new set of tools for analyzing concrete C*-algebras. This book is an introductory graduate level text which presents the basics of the subject through a detailed analysis of several important classes of C*-algebras. The development of operator algebras in the last twenty yea

  1. A Robot Supported By C

    International Nuclear Information System (INIS)

    Shin, Junghwan

    1994-11-01

    This book introduces analog with register, diode and light emitting diode, condenser, capacitor and transistor, operational amplifier tester, oscilloscope and lapping, digital circuit such as sorts of digital lc, gate circuit flip-flop, shift register and latch, and counter, C-language including entering C-language, editor using, debugging, basic data type of C-language, operator and control structure, array and pointer, storage class, structure and union, expansion SLOT of PC, interface card and C-language such as graphic function, keyboard control, and mouse control.

  2. Fullerene C[sub 60

    Energy Technology Data Exchange (ETDEWEB)

    Koruga, D; Hameroff, S; Sundareshan, M [Univ. of Arizona, Tucson, AZ (United States); Withers, J; Loutfy, R [MER Corp., Tucson, AZ (United States)

    1993-01-01

    This book, one of the first to be published in the exciting field of fullerenes, includes a short history of scientific discovery, as well as one possible answer to the question: for what purposes can C[sub 60] be utilized. The book opens with a review of the life of Buckminster Fuller. Modern history of fivefold symmetry and the icosahedron began between 1984 and 1985, when Shechtman and his research team opened a new branch in crystallography (fivefold symmetry) and when the Kroto/Smalley research team discovered the C[sub 60] molecule (truncated icosahedron). Production of solid C[sub 60] by the Huffman/Kraeschner research team in 1990 provided a new stimulus for research by producing C[sub 60] in macroscopic amounts for use by the scientific and technological community. This achievement led to developments such as Koruga's August 1992 creation of the dimer C[sub 116] using scanning tunneling engineering and Loutfy's hydrogenation of C[sub 60] and construction of the first Ni/C[sub 60] rechargeable batteries in December 1992. New inventions based on C[sub 60] will continue to be forthcoming, particularly in the areas of superconductivity, quantum devices, and molecular electronic devices. Discovery of the C[sub 60] molecule (Kroto/Smalley), production of solid C[sub 60] (Huffman/Kraeschmer) and technological inventions such as C[sub 116] (Koruga) have been chance discoveries. A short history of these discoveries is detailed in the book along with the results of the authors' Fullerene research efforts, including atomic resolution images of Fullerene C[sub 60], Ni/C[sub 60] batteries, nanotechnology of C[sub 60], comparison of C[sub 60] with biological systems, and others. As Fullerene C[sub 60] will require control engineering, an overview of control systems, in particular, general and optimal control of the Schroedinger equation, is contained. Some experimental and theoretical work of other researchers are also presented. 140 figs., 4 tabs., 342 refs.

  3. Mol 7C/6; Mol 7C/6

    Energy Technology Data Exchange (ETDEWEB)

    Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.

    1995-08-01

    The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO{sub 2} covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)

  4. The C-12/C-13 abundance ratio in Comet Halley

    International Nuclear Information System (INIS)

    Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.

    1989-01-01

    The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs

  5. Grinding, Machining Morphological Studies on C/SiC Composites

    Science.gov (United States)

    Xiao, Chun-fang; Han, Bing

    2018-05-01

    C/SiC composite is a typical material difficult to machine. It is hard and brittle. In machining, the cutting force is large, the material removal rate is low, the edge is prone to collapse, and the tool wear is serious. In this paper, the grinding of C/Si composites material along the direction of fiber distribution is studied respectively. The surface microstructure and mechanical properties of C/SiC composites processed by ultrasonic machining were evaluated. The change of surface quality with the change of processing parameters has also been studied. By comparing the performances of conventional grinding and ultrasonic grinding, the surface roughness and functional characteristics of the material can be improved by optimizing the processing parameters.

  6. Sim3C: simulation of Hi-C and Meta3C proximity ligation sequencing technologies.

    Science.gov (United States)

    DeMaere, Matthew Z; Darling, Aaron E

    2018-02-01

    Chromosome conformation capture (3C) and Hi-C DNA sequencing methods have rapidly advanced our understanding of the spatial organization of genomes and metagenomes. Many variants of these protocols have been developed, each with their own strengths. Currently there is no systematic means for simulating sequence data from this family of sequencing protocols, potentially hindering the advancement of algorithms to exploit this new datatype. We describe a computational simulator that, given simple parameters and reference genome sequences, will simulate Hi-C sequencing on those sequences. The simulator models the basic spatial structure in genomes that is commonly observed in Hi-C and 3C datasets, including the distance-decay relationship in proximity ligation, differences in the frequency of interaction within and across chromosomes, and the structure imposed by cells. A means to model the 3D structure of randomly generated topologically associating domains is provided. The simulator considers several sources of error common to 3C and Hi-C library preparation and sequencing methods, including spurious proximity ligation events and sequencing error. We have introduced the first comprehensive simulator for 3C and Hi-C sequencing protocols. We expect the simulator to have use in testing of Hi-C data analysis algorithms, as well as more general value for experimental design, where questions such as the required depth of sequencing, enzyme choice, and other decisions can be made in advance in order to ensure adequate statistical power with respect to experimental hypothesis testing.

  7. Electronic structure of C28, Pa at sign C28, and U at sign C28

    International Nuclear Information System (INIS)

    Zhao, K.; Pitzer, R.M.

    1996-01-01

    Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs

  8. Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18

    Directory of Open Access Journals (Sweden)

    R. F. Weiss

    2012-05-01

    Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.

  9. Synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F.

    Science.gov (United States)

    Roy, Sudeshna; Spilling, Christopher D

    2010-11-19

    A convergent synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization, and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with l-selectride to give the fragments of amphidinolide C and F.

  10. Synthesis of the C(18)–C(34) Fragment of Amphidinolide C and the C(18)–C(29) Fragment of Amphidinolide F

    Science.gov (United States)

    Roy, Sudeshna; Spilling, Christopher D.

    2010-01-01

    A convergent synthesis of the C(18)–C(34) fragment of amphidinolide C and the C(18)–C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with L-selectride to give the fragments of amphidinolide C and F. PMID:21028791

  11. V S C Manga Rao

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. V S C Manga Rao. Articles written in Pramana – Journal of Physics. Volume 61 Issue 3 September 2003 pp 563-575 Research Articles. Phase conjugation of gap solitons: A numerical study · V S C Manga Rao S Dutta Gupta · More Details Abstract Fulltext PDF. We study the ...

  12. Remembering Sir J C Bose

    Indian Academy of Sciences (India)

    for this wonderful gift to Indian science. I would like to end this review with another quote for C. N. R. Rao's inspiring foreword. 'The book brings out the spirit of J. C. Bose and the flavour of the great man. I do hope it will be read by a large number of people, particularly young people of India.' M S Swaminathan, UNESCO ...

  13. Photophysics of C60 Colloids

    Science.gov (United States)

    2012-11-28

    nonlinear-optical properties and excited-state dynamics of pristine, oxygen- doped , and photopolymerized C-60 in the solid-state," Physical Review B...C45 (2009). 139. E. A. Brujan, "Numerical investigation on the dynamics of cavitation nanobubbles," Microfluidics and Nanofluidics 11(5), 511-517

  14. C9H14N

    Indian Academy of Sciences (India)

    J. Chem. Sci. Vol. 128, No. 7, July 2016, pp. 1037–1045. c Indian Academy of ..... Teraski O, Barry J C and Thomas J M 1987 Nature ... Betteridge P W, Carruthers J R, Cooper R I, Prout K and ... Clegg W and Watson D G 2007 Acta Cryst.

  15. Biomimicry of surfactant protein C.

    Science.gov (United States)

    Brown, Nathan J; Johansson, Jan; Barron, Annelise E

    2008-10-01

    Since the widespread use of exogenous lung surfactant to treat neonatal respiratory distress syndrome, premature infant survival and respiratory morbidity have dramatically improved. Despite the effectiveness of the animal-derived surfactant preparations, there still remain some concerns and difficulties associated with their use. This has prompted investigation into the creation of synthetic surfactant preparations. However, to date, no clinically used synthetic formulation is as effective as the natural material. This is largely because the previous synthetic formulations lacked analogues of the hydrophobic proteins of the lung surfactant system, SP-B and SP-C, which are critical functional constituents. As a result, recent investigation has turned toward the development of a new generation of synthetic, biomimetic surfactants that contain synthetic phospholipids along with a mimic of the hydrophobic protein portion of lung surfactant. In this Account, we detail our efforts in creating accurate mimics of SP-C for use in a synthetic surfactant replacement therapy. Despite SP-C's seemingly simple structure, the predominantly helical protein is extraordinarily challenging to work with given its extreme hydrophobicity and structural instability, which greatly complicates the creation of an effective SP-C analogue. Drawing inspiration from Nature, two promising biomimetic approaches have led to the creation of rationally designed biopolymers that recapitulate many of SP-C's molecular features. The first approach utilizes detailed SP-C structure-activity relationships and amino acid folding propensities to create a peptide-based analogue, SP-C33. In SP-C33, the problematic and metastable polyvaline helix is replaced with a structurally stable polyleucine helix and includes a well-placed positive charge to prevent aggregation. SP-C33 is structurally stable and eliminates the association propensity of the native protein. The second approach follows the same design

  16. Determination of material properties for short fibre reinforced C/C-SiC

    Directory of Open Access Journals (Sweden)

    Hausherr J.-M.

    2015-01-01

    Full Text Available Determining the mechanical properties of short fibre reinforced CMC using standard sized coupons has always been a challenge due to a high statistical scattering of the measured values. Although the random orientation of short fibres results in a quasi-isotropic material behavior of 2D-structures with a sufficiently large volume, the small volume typical for test coupons usually results in a non-isotropic fibre orientation in the tested volume. This paper describes a method for manufacturing unidirectional oriented short fibre reinforced CMC materials and presents material properties of UD-C/C-SiC. After verifying the fibre orientation of the CMC using micro-computed tomography, coupons were extracted to determine the orthotropic material properties. These orthotropic material properties were then used to predict the properties of C/C-SiC with randomly distributed short fibres. To validate the method, micro-computed tomography is used to quantitatively determine the fibre orientation within coupons extracted from randomly distributed short fibre C/C-SiC. After mechanical three-point-bending tests, the measured stiffness and bending strength is compared with the predicted properties. Finally, the data are used to devise a method suited for reducing the inherent large spread of material properties associated with the measurement of CMC materials with randomly distributed short fibres.

  17. Borane-catalyzed cracking of C-C bonds in coal; Boran-katalysierte C-C-Bindungungsspaltung in Steinkohle

    Energy Technology Data Exchange (ETDEWEB)

    Narangerel, J; Haenel, M W [Max-Planck-Institut fuer Kohlenforschung, Muelheim an der Ruhr (Germany)

    1998-09-01

    Coal, especially coking coal, was reacted with hydrogen at comparatively mild reaction conditions (150-280 degrees centigrade, 20 MPa hydrogen pressure) in the presence of catalysts consisting of borange reagents and certain transition metal halides to obtaine more than 80 percent of pyridine-soluble products. The influence of the degree of coalification, catalyst and temperature on the borane-catalyzed hydrogenolysis of C-C bonds in coal was investigated. (orig.) [Deutsch] Steinkohlen, insbesondere im Inkohlungsbereich der Fettkohlen (Kokskohlen), werden in Gegenwart von Katalysatoren aus Boran-Reagentien und bestimmten Uebergangsmetallhalogeniden mit Wasserstoff bei vergleichsweise milden Reaktionsbedingungen (250-280 C, 20 MPa Wasserstoffdruck) in zu ueber 80% pyridinloesliche Produkte umgewandelt. Der Einfluss von Inkohlungsgrad, Katalysator und Temperatur auf die Boran-katalysierte C-C-Bindungshydrogenolyse in Kohle wurde untersucht. (orig.)

  18. Is vitamin C supplementation beneficial?

    DEFF Research Database (Denmark)

    Lykkesfeldt, Jens; Poulsen, Henrik Enghusen

    2010-01-01

    of the benefit:harm ratio of antioxidant supplements. We have examined the literature on vitamin C intervention with the intention of drawing a conclusion on its possible beneficial or deleterious effect on health and the result is discouraging. One of several important issues is that vitamin C uptake is tightly...... controlled, resulting in a wide-ranging bioavailability depending on the current vitamin C status. Lack of proper selection criteria dominates the currently available literature. Thus, while supplementation with vitamin C is likely to be without effect for the majority of the Western population due...... to saturation through their normal diet, there could be a large subpopulation with a potential health problem that remains uninvestigated. The present review discusses the relevance of the available literature on vitamin C supplementation and proposes guidelines for future randomised intervention trials....

  19. Dicty_cDB: VSJ223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available etical protein ZK381.7 - Caenorhabditis elegans. 46 0.43 1 AF277887 |AF277887.1 Sida crystallina clone 67SE ...5 unordered pieces. 44 1.7 1 AF277884 |AF277884.1 Sida crystallina clone 63NA cytochrome c oxidase subunit I... (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 34 3.8 2 AF277883 |AF277883.1 Sida... 2 AF277888 |AF277888.1 Sida crystallina clone 68SE cytochrome c oxidase subunit ...cytochrome c oxidase subunit I (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 36 1.0

  20. Dicty_cDB: AFL826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c

  1. Dicty_cDB: CHD152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to

  2. C# deconstructed discover how C# works on the .NET framework

    CERN Document Server

    Rahman, Mohammad

    2014-01-01

    C# Deconstructed answers a seemingly simply question: Just what is going on, exactly, when you run C# code on the .NET Framework? To answer this question we will dig ever deeper into the structure of the C# language and the onion-skin abstraction layers of the .NET Framework that underpins it. We'll follow the execution thread downwards, first to MSIL (Microsoft Intermediate Language) then down through just-in-time compilation into Machine Code before finally seeing the results executed at the hardware level. The aim of this deep-dive is to provide you with a much more rounded know

  3. Dicty_cDB: VHK256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK256 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...56F 620 - - - - - - Show VHK256 Library VH (Link to library) Clone ID VHK256 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK256Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK256 (VHK256Q) /CSM/VH/VHK2-C/VHK256Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

  4. Dicty_cDB: VHC679 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle sunflower Helianthus paradoxus cDNA clone CHUX465, mRN...aris cDNA clone CHPX9185, mRNA sequence. 72 2e-13 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzz...le sunflower Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 2e-13 2 EL

  5. Dicty_cDB: VHO809 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin

  6. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  7. 13C/12C ratios in human urine concrementes

    International Nuclear Information System (INIS)

    Hoefs, J.; Armbruster, T.

    1978-01-01

    Oxalate, uric acid, and phosphate stones have been analyzed for their carbon isotope composition. The oxalate stones show delta 13 C values between -17.0 and -19.5 pro mille, the uric acid stones between -14.9 and -19.4 pro mille, and the phosphate stones between -13.0 and -23.9 pro mille. It is proposed that endogenic rather than exogenic sources are responsible for the 13 C/ 12 C ratios of the stones. The isotopic composition of the phosphate stones seems to be influenced primarily by bacterial activity. (orig.) [de

  8. Dicty_cDB: VHA862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 38 0.17 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS0... Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.2 1 CX072512 |CX0

  9. .. c .. . -

    African Journals Online (AJOL)

    1986-10-03

    Oct 3, 1986 ... a hundred polymorphic species (Frost 1985). The H. puncticulatus complex in east Africa was shown by. Schi~z (1975) to consist of two cryptic species, H. mit- chelli Loveridge and H. puncticulatus (Pfeffer). Both species are morphologically similar and share a range of colour patterns. They are sympatric ...

  10. C

    African Journals Online (AJOL)

    This showed me the boundless confidence which these sons .... self. He has heard our prayers. We are free! Oh, how I long to see General Smuts!' ... ing camp games, which gave us a little diver- .... mund to board the German ship which would.

  11. ,': :.' ': c'.\\>; ';,.",_".,' ,

    African Journals Online (AJOL)

    genes with small effects. For both crosses the data shows contin,uous distribution in pqd fil! period-2. Pqd fill period-2 was found to be inherited quantitatively in the cross TMO 216 x CIAT16-1 . . " ..• "'':'~' ". The knowledge' o,btained from this study together with heritability, values obtained from other studies will be valuable ...

  12. Low dose irradiation performance of SiC interphase SiC/SiC composites

    International Nuclear Information System (INIS)

    Snead, L.L.; Lowden, R.A.; Strizak, J.; More, K.L.; Eatherly, W.S.; Bailey, J.; Williams, A.M.; Osborne, M.C.; Shinavski, R.J.

    1998-01-01

    Reduced oxygen Hi-Nicalon fiber reinforced composite SiC materials were densified with a chemically vapor infiltrated (CVI) silicon carbide (SiC) matrix and interphases of either 'porous' SiC or multilayer SiC and irradiated to a neutron fluence of 1.1 x 10 25 n m -2 (E>0.1 MeV) in the temperature range of 260 to 1060 C. The unirradiated properties of these composites are superior to previously studied ceramic grade Nicalon fiber reinforced/carbon interphase materials. Negligible reduction in the macroscopic matrix microcracking stress was observed after irradiation for the multilayer SiC interphase material and a slight reduction in matrix microcracking stress was observed for the composite with porous SiC interphase. The reduction in strength for the porous SiC interfacial material is greatest for the highest irradiation temperature. The ultimate fracture stress (in four point bending) following irradiation for the multilayer SiC and porous SiC interphase materials was reduced by 15% and 30%, respectively, which is an improvement over the 40% reduction suffered by irradiated ceramic grade Nicalon fiber materials fabricated in a similar fashion, though with a carbon interphase. The degradation of the mechanical properties of these composites is analyzed by comparison with the irradiation behavior of bare Hi-Nicalon fiber and Morton chemically vapor deposited (CVD) SiC. It is concluded that the degradation of these composites, as with the previous generation ceramic grade Nicalon fiber materials, is dominated by interfacial effects, though the overall degradation of fiber and hence composite is reduced for the newer low-oxygen fiber. (orig.)

  13. Generation of Anaphylatoxins by Human β-Tryptase from C3, C4, and C51

    Science.gov (United States)

    Fukuoka, Yoshihiro; Xia, Han-Zhang; Sanchez-Muñoz, Laura B.; Dellinger, Anthony L.; Escribano, Luis; Schwartz, Lawrence B.

    2009-01-01

    Both mast cells and complement participate in innate and acquired immunity. The current study examines whether β-tryptase, the major protease of human mast cells, can directly generate bioactive complement anaphylatoxins. Important variables included pH, monomeric vs tetrameric forms of β-tryptase, and the β-tryptase-activating polyanion. The B12 mAb was used to stabilize β-tryptase in its monomeric form. C3a and C4a were best generated from C3 and C4, respectively, by monomeric β-tryptase in the presence of low molecular weight dextran sulfate or heparin at acidic pH. High molecular weight polyanions increased degradation of these anaphylatoxins. C5a was optimally generated from C5 at acidic pH by β-tryptase monomers in the presence of high molecular weight dextran sulfate and heparin polyanions, but also was produced by β-tryptase tetramers under these conditions. Mass spectrometry verified that the molecular mass of each anaphylatoxin was correct. Both β-tryptase-generated C5a and C3a (but not C4a) were potent activators of human skin mast cells. These complement anaphylatoxins also could be generated by β-tryptase in releasates of activated skin mast cells. Of further biologic interest, β-tryptase also generated C3a from C3 in human plasma at acidic pH. These results suggest β-tryptase might generate complement anaphylatoxins in vivo at sites of inflammation, such as the airway of active asthma patients where the pH is acidic and where elevated levels of β-tryptase and complement anaphylatoxins are detected. PMID:18424754

  14. Paramagnetic centers in nanocrystalline TiC/C system

    International Nuclear Information System (INIS)

    Guskos, N.; Bodziony, T.; Maryniak, M.; Typek, J.; Biedunkiewicz, A.

    2008-01-01

    Electron paramagnetic resonance is applied to study the defect centers in nanocrystalline titanium carbide dispersed in carbon matrix (TiC x /C) synthesized by the non-hydrolytic sol-gel process. The presence of Ti 3+ paramagnetic centers is identified below 120 K along with a minor contribution from localized defect spins coupled with the conduction electron system in the carbon matrix. The temperature dependence of the resonance intensity of the latter signal indicates weak antiferromagnetic interactions. The presence of paramagnetic centers connected with trivalent titanium is suggested to be the result of chemical disorder, which can be further related to the observed anomalous behavior of conductivity, hardness, and corrosion resistance of nanocrystalline TiC x /C

  15. Dicty_cDB: SHJ782 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DDLGPNTTINIF*tknhsysns*k*krwyfnksgwc*firyykckfrnfir kcfsfm*ftm*fisk*nilfk*sntkfk*krynk*y*lfimsfnefncc**nirsiisp...fm*ftm*fisk*nilfk*sntkfk*krynk*y*lfimsfnefncc**nirsiispi rpniisl*c*nrrnsiiiksiiikww*kkiiktirwcncwyynwlccwcwc

  16. Dicty_cDB: VSG174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pslvemlplksnmvslhlsmkmflfavlkth*haqlllvitkri*pk*fhlmlh qvntlvtllspiktmlkspvlhvdinl*t**nkik*nknt Frame B: k*neiiisp...kcfylqfsrpismpnccw*lpkeydrndsi*csir*i hw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---k*neiiisplfrscfs

  17. Dicty_cDB: CHP289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence ---dxh*kllxq*xhqtdcs*PCVKNNKAFDIINGVFNKPSLSGSSPKLLNNVFTDDCIV FKTSWXWINGSLFFPKSTNSFAFSI*s Trans...wift*tt**cly**lhc i*nfmxmd*wfsllskin*flclfhli Frame C: ---dxh*kllxq*xhqtdcs*PCVKNNKAFDIINGVFNKPSLSGSSPKLLNNV

  18. Dicty_cDB: AFN327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTATAATTTTATTGT AAAGGTTAA sequence update 2009. 4. 3 Translated Amino Acid sequence ifiif*itiiqtiiflilkiivillilvkiiknamak...ftieqisfhviki*mlifili s*i*nptk*qi*liknf*iqvkmnfnfqkql*fyckg* Frame C: ifiif*itiiqtiiflilkiivillilvkiiknama

  19. Dicty_cDB: VSK476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq

  20. Dicty_cDB: VSG286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

  1. Dicty_cDB: CHL558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SKTGNVYVADASX--- ---nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqs lkmklml*iyy*mksqkvlkscalavvplm...lvgltkfqvqxfkifwv*nmvlqtnitlssxk Frame C: r*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkmklm l*iyy*mksqkvlkscala

  2. Dicty_cDB: CHC212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsst...c*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyqlinkl...**itrxk elnnsvyhv--- ---tnkgk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nl*wklsri*kprttefqs lkmklml*iyy*mesqkvlkscalav

  3. Dicty_cDB: AFH242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CA sequence update 2001. 6. 2 Translated Amino Acid sequence claywvyntvysytsl*rii...r*snsynirslnykwss*nwc*sleelktslpisnklqs Frame C: claywvyntvysytsl*riikknkkkek*vmfmill*ldqvfqv*cvvin*krmdikf*

  4. Dicty_cDB: VSD425 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qkkikkmvpkdvekfd* k*fifniihilvi**hfpsfffkniysyifiqx*iiflknxxkkkkkkkfffxkk--- ---sakixxyiyrni*lffl*liiskili...s*kmvpkdv ekfd*k Frame C: kikkyiyrni*lffl*liiskilicldn*ikqqqrilcsh*eellldlfqlediikvmkn *ik*rnkiflmkelmk*sdkl

  5. Dicty_cDB: SSJ639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vih*l*i*lqeinnqlpklnhyhgqfqkvmihfvqfldlyq kiklki*imlnygvvsmvksnkkviptk*fsmfhi*fnilvql*h*nlai*f*lvhllvl vq*nldk*lnvvslv*iltcnsisf*erei...killkl*iinkkkkn* Homology vs CSM-cDNA Score E Sequences producing significant align

  6. Dicty_cDB: SHL683 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence update 2002. 9.10 Translated Amino Acid sequence ---TVSLLFSPLTKSVSPXKNL*lihmsx...xss Frame B: ---ngisslftfn*kcvtxkefvidpyvxgl*cxllnxhh Frame C: ---TVSLLFSPLTKSVSPXKNL*lihmsxdynvxy*xii Homol

  7. Dicty_cDB: CFJ391 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pxvknxxsdpidhhxxkfvh*xxhqnmnvnxmimvknvv*xfivmxxvild xw*rf*m*nxtswfkmlcpfxkatxtsxxxm**emptxp*m*x*stxkrmlrcxp*saxk mlfxmsx...ktxm*sqplw*rmlx*sspr*mfxxmstrx*mxs*stwkrmlrccp*tttkmx ikmsxkt*m* Frame C: silflinsn*kknnn*ls*k*k

  8. Dicty_cDB: VHE841 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niaqfvviq*kmkekkkil*llanivinqftix aikil*itlkmsxsfinvxivlvtsx*nxvgiigvveektpkkslgkrkkk Frame C: ---*n*merklym...l*xlffkrf**kikilpnl*sfnkr*rrrrrfynylpils*issrsl rskyyr*x*k*afhl*msxly**xanktx*e*l

  9. Online Trading C2C Operators Fight for Number One

    Institute of Scientific and Technical Information of China (English)

    DAVID HENDRICKSON

    2006-01-01

    @@ Whether shopping casually or searching for some obscure, hard to find item, more and more Chinese are logging online and turning to customer-to-customer (C2C) network operators for their trading needs rather than bother with the hassles of conventional buying and selling. Proof is in the numbers. A leading technology, new media, and telecom watchdog, Analysys International reports that China's C2C market users more than doubled in 2005 to 37.87 million, while the sector's total transaction value increased from 4.16 billion yuan in 2004, to 13.9billion yuan (US$1.74 billion). Supplanted by a web surfing pool of 100 million and counting, they are trends that Analysys and other industry groups expect will continue in China for some time, fundamentally transforming how the country's independent traders do business.

  10. Dicty_cDB: VSI166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KK Translated Amino Acid sequence (All Frames) Frame A: QKHKTIYKYQHCYFLQIFFLTHYHTKFFLILFNTHTFKKK--- ---gxxxxxxxxxxxxxfxxxfffxxx...ppxffffffspxff*kkkkkxxxxfffxtpxxf ffxxkkkk Frame B: knikqstniniaifykfff*hittpsfs*fylthill...kkk--- ---GXXXXXXXKXXXXFFXXFFFXXXXPPXFFFFFFPPXFFKKKKKKXFXXFFFXPXXXF FXPXKKKK Frame C: kt*nnlqistllfftnfffntl...phqvflnfi*htyf*kk--- ---xxxxxxxxxxxxxffxxfffxxxppxfffffffpplflkkkkkkxfxfffxnpxxxf

  11. Dicty_cDB: VFI680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FPGIADCXNKXLXX LAPSXMKIKIXAPPERKXSVWIGGSXLXSLXTFQXXWIXKXXY Translated Amino Acid sequence (All Frames) Frame...xrwxnyvpryc*lyxqxixx fsxxxhen*nxcsxrt*xlcldwwixfxfxxnxpxnxdxxxxi Frame C: aywlktnkln*iknkngw*rcssfsy**rfwyv*...SXLGMEXAGIXETTFXSXMKCDVXIRKNLXGXXVXXGGTTMFPGIADCXNKXLXX LAPSXMKIKIXAPPERKXSVWIGGSXLXSLXTFQXXWIXKXXY Homology

  12. Dicty_cDB: CHQ790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TSSSHKFTPHPTHSRKIHWQLSIPPLDGEVIKYSVFYSGLNLPASRLLKKXKN*l ilinkyk Translated Amino Acid sequence (All Frames) ...PPLDGEVIKYSVFYSGLNLPASRLLKKXKN*l ilinkyk Homology vs CSM-cDNA Score E Sequences producing significant alignm

  13. Dicty_cDB: AFI489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XTKIQDKEGI Translated Amino Acid sequence (All Frames) Frame A: llayw*xhfyytnikfifyffiycnis*kkkkkkxkkxpxxkkk--- ---vxxxxxxxxxxxx...fxxvxxxfxxxxxfsxxxxxxxfxwxxxxxxxxxx*xxxpkxix xpxgxqikrwyaxxcx...C: vgllvxsfllyky*ihilffyil*hfikkkkkkx*kxtxxekk--- ---xxxxxxxxxxxxlxxcxxxxxx*xxxfxxxxxvxfxxvxxxxmxglxxixxskkx

  14. Dicty_cDB: AFI150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RIHDPXLXEXXXXSXGXXIXXIXGXIDSLXXGXSXXAGGGVGLXR XVXXYLGLGXIXK Translated Amino Acid sequence (All Frames) Frame A: ---xlxkvxkfvxxxxx...fmixnyxkxxxnxxxxxxrxfxxxsipxxxxxpxxxxvxlvxn gxlxxi*x*xxlxk ...Frame B: ---lyxrxxnlxwxxtxs*sxitrkxxxixxxxyxgxsrxxrfpxxxxxptxxxwxwfxt gsxalfrxrxxxks Frame C: ---FXKGXXICXGA

  15. Dicty_cDB: AFL557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIQKESTLHLVLRLRGGMQIFVKTLTG KTITLEVEGSDNIENVKTKIQDKEGIPPD Frame B: yky*ihilffyil*hfikkkkkkkx*kxxfxekk--- ---xfxxxxxgxxxxxxxxrxxxxxxx...kxknsxixkvfxxxxxvxfxxvxnxxmxxlxxi tiskxnxlstwssd*evvckxlskh*lvrpsllklraqiilkmlxqrfkt...fhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslv kplhsklkvvttlrm*kqkfktkkvshqi Frame C: tnikfifyffiycnis*kkkkkkkxkxxx...fxkkk--- ---fxxxpxxvxxxxxxxxgxxxxxxxkxkixx*xrxsxxxxxxxfxw*xixxxxxxx*l qypkxixxplgxqikrwyanxcqnin

  16. Dicty_cDB: SHA692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AATNKSVLSNPTPTPSPNTSSFIPTNKGSTATTTTTTATPTPTPSNNT Translated Amino Acid sequence (All Frames) Frame A: ---sxxxxxxxx...cnsx*xw*xxyxfiixxfnvfxfk*fixxi*xxxxxxxxx*ntxntnn ninndnntinyssgnk*isfiksntntiskyiiihsnk*rihsnnynnnsntn...PNTSSFIPTNKGSTATTTTTTATPTPTPSNNT Frame C: ---xxsxxxxxm*fxlxlvkxislyyxxiqclxf*vihxmxlxxxxxxxx

  17. Dicty_cDB: CHA402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IXXXXKMNEXKXKIXLXGXFLKXIXNXYSXXIKXGX PXKIGKIRAKXSFX Translated Amino Acid sequence (All Frames) Frame A: ---kixxxefxlxxkxxsxfxxx...nxlxxxxk*mxkxiklx*xxxf*kxxkixixxxlkxx xxxkleklgxkxxsx Frame B: ---kfxxxnfx*xxxx...fxxfxxktxyxxxxne*xkx*nxfkxxxfkxnxkslfxxn*kxx sxxnwkn*gxxfxxx Frame C: ---NSTXGISFXXKXXFXXX

  18. Dicty_cDB: SHC825 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (All Frames) Frame A: wptgknvk*ikkkkkikknfxxf*kgxvlikkkkxpxffxxkkxxkxkkkkxkkxxxxx...p rgx*kkkkxxkkxkkxxkkkkkxkkxxfkxpxxxlgxxxxxxxggxxppxxxxxppxpkx fgppxxxppxxxxgexpxxxxxxxxxxtpfxxkkxflkkkxxkxx...xkkxxf*xffxkxllkk--- Frame C: aywxkcqinkkkkkn*kkfxxvlkgxsfnkkkkxpxfffxkkkxkxkkkkxkkxxxxxxp galkkkkxxkkkxkxxkkkkkxkkkxf*xpxxxfggxxkxxx...xgxxppxxxxxxpxpxkx wapxkxapkxxxggxpxxxxxxfxxxnpxxxkkxffkkkxxkxxffkxffxxxf*kk--- Hom

  19. Dicty_cDB: CFI279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fvymni**ikhnknxiiyifivtlyeylkigkhflkigkhy*kkk*idf*l*kk--- ---xxxxxxxxxxxxxxxxxxxxxxxaxfxxvxxvyxxxxxxxxx...lxxxlxlxxxlxlxl xxxllxxpllqplpqlq Frame C: lfi*tfnk*ntikxilfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---xxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxcmxxxxxxxxxsxcxxxcxxxcxxxc xxxcyxxrysnrypns Homology vs CS

  20. Dicty_cDB: AFO366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available o Acid sequence ---qkxtqxrvatnspqxigxlfnxlfqnvmptspfxlpqknvxqfvaxtxxxiaqilyv qkvx...ll Frames) Frame A: ---qkxtqxrvatnspqxigxlfnxlfqnvmptspfxlpqknvxqfvaxtxxxiaqilyv ...xcsxscskm*cqrvpxhspkkmlxnl*pxpxxxlpkyfms krxiv*ldgxlinqkxnvxinvnktapl*nxpcqxvkmvp...nxsktxxnvatnvqxxixxp lnvlxxxxxkxnxfxpxqenvxxfxxxxxiaptpyvqhx*xpxnqxnxvxxxxxfqlxqi xpl*nxpxxfxkxxqnxqkxqmxxxtxxpx*xxxlxxvlxqxxx...ptxpfxlpqkxxxxfv dxt Frame C: ---kxnpxkgcykfppxnwxxvqxlvpkcnaneslxtppkkcxpicspnptlxcpntlcp

  1. Dicty_cDB: CHC603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YDEITEKILLVHNESTFNGWTYAEEGSKTTTSGFKYFDF TKHYYNDKFFPVDSLGFGNNGLDHNYKWCARLHFVSFFPPDNPPMNFYASHSDDLFIFID GVSVYSYIGITDKS--- ---xxxxvxxxxxx...xxxxxvxxxxxvxxxmxxxxglxppxxhvki*ialpkd*nvyplkl tgikilhxe...mnqllmvghmqkkvqkqlhlvlnilil qniitminsfqliv*vleimdwiiiingaqdyil*afshqiilq*ifmhrilmiflfslm vfqfililellin--- ---xxxxsxxxxpxxxxxmwxxxxxxx...xxxfxxxdxxrxxim*rfrlpfpriemyil*s* qa*kyymxslxpi Frame C: likledngffns*ffmyifdflyfhi

  2. Dicty_cDB: AFL617 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkki*kxxffekk--- ---fxxxpxgxxxxxxxr*xxxxxxxxxiqxxxgxsxrsxxxxfxw*xxxxxx...QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI TLEVEGSDNIENVXTKIQDKEGI Frame C: ihfyytnikfifyffiycnis*kkkkkknlkxxlf*kkk--- ---xxx...pxrxxxxxxxkvvxxxxxxxxxsx*xrvfxqixxvxfxxvxxxxmxglxxxtis kknxlstwssx*xvvckxlskh*lvrps

  3. Dicty_cDB: SFH765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mni**ikhnknqyylyiysnii*ifknwktffknwktllkkein*flii kkk--- ---xxxxxxxxxxvxxxxxxxxxxxxxxxxxxxxxxxxxxxyaxqgnvxqxxxxxv*xxx...yifivtlyeylkigkhflkigkhy*kkk*idf*l* kk--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxmlxkxm*xxrxxxx...fnxxy xlxxx*smhffix*kwcmyxnxhlysnsicnsncypxcysncypncytnrysnrypnsny nc Frame C: cwptgnlfvsyeh

  4. Dicty_cDB: SFG756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TP Frame B: yehlinktq*ksilfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---xxx*xxxxxxxxxxvxixxhxxxxxvxxx*xxxx...isxxxvxhvxlxxxvxxxxyaxq xnviqxxxxxv**xxlixqaxihaffhxvxmvyvxxxtfvlxlhl*lxllxxlllxllpq... llhqpllqplpqlqlqlqlh Frame C: mni**ikhnknqyylyiysnii*ifknwktffknwktllkkein*fliikkk--- ---xxnxxxxxxxxxxx*x*xxmxxxxxxxxxrxxxx*vxxxxx...m*xcxxxyxkxxmlxx xm*sxxxxxxfnxpy*lxkxxsmhffixxxwcmyxxxhlyx

  5. Dicty_cDB: VFM738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FNQVEVKPEMIGHY TGEFSLSYKSVNHGRPGIGATHSSRFIPLK*ifyislvalf*nnkvikl*tvvivekekk xkxkxxxxxxxxxxx...vlltlqdssh*srffiyll*lcfkiik**sykq****kkkk kxkxxxxxxxxxxxxxkxfffffx--- Frame B: ff...s*s*trndwsl hw*iltliqecqpwssrywcyslfkihpievdflyiscsfvlk**sdkvinssnsrkrkk kxxkxxxxxxxxxxxxxxffffx--- Frame C:...LVKTHARNILIVPEMIGSVIGIYNGKVFNQVEVKPEMIGHY TGEFSLSYKSVNHGRPGIGATHSSRFIPLK*ifyislvalf*nnkvikl*tvvivekekk xkxkxxxxxxxxxxx

  6. Dicty_cDB: CHR861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence ---ETTELXNKXIKFXSXXAXGEIXSISTWXXXFVXNXPAYXHDSXVNDEIXXDYFQRCL XISXGTXYDXSIQGDKXDYYC*ixyfxlfxxxxxixxxxx...ame A: ---*nxrig**xy*ixfkxsxwxnxixfxlxxxicxkxsxlxs*fxxk**nsx*lfstlf xyfkxxxl**xxsrr*x*llllnixfxpipxlxxxlxxxs...XGEIXSISTWXXXFVXNXPAYXHDSXVNDEIXXDYFQRCL XISXGTXYDXSIQGDKXDYYC*ixyfxlfxxxxxixxxxxfxinfkniiiikq*x*xkkk kvkngk...*iksqyknnnqiknkknkknktfi Frame C: ---kxpnwxixilnsfqxxxxxkxnxfxlgqxnlxkxixptimipx*mmkfxxiifnvvx ifqxxpfmixxfkaixmiiivkyxixsysxtxxxfxxx

  7. Dicty_cDB: AFM869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLH341. 404 e-128 3 ( AF305060 ) Dictyostelium discoideum Wiscott-...ucing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-

  8. Dicty_cDB: VFH765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATTTTTTTAT sequence update 2001.11.22 Translated Amino Acid sequence tvgllxlhsfykkxknexssyslf*c*qpwllvedyqlr...sildh*klmgcrlg*swllks*kky* *mwccqfrffincwfiklktinkillnf*fyff Translated Amino Acid sequence (All Frames) Frame A: tvgllxlhsfykkxknexs

  9. Dicty_cDB: SHF556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sqvvli*slv*lvvslvvvqevkviaklvkik*lf Frame C: iihvpsmpvlnqqvllipqsm*miitnvqlihvpkkvv*lilqsilmitmpvplipahhq lv...fpipq*tvmiiinvl*ihvqtqlvv*ilqltvtivihvp*thaiiqlvv*tlqsmlmi iihvpsmpvpnqqvllipqsm*mittnvqlmhvpkxvv*lipqsilmitmpvqlmhvqkx vv*lilxsilmit

  10. Dicty_cDB: CHJ796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHJ796 (Link to dictyBase) - - - - - (Link to Original site) -... - CHJ796Z 123 - - - - Show CHJ796 Library CH (Link to library) Clone ID CHJ796 (Link to dictyBase) Atlas ID - NBRP ID - dic...ssues normalized and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (...ed and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 36 0.47 2 AF239838...0804 |pid:none) Roseiflexus castenholzii DSM 139... 33 2.3 AY714838_16( AY714838 |pid:none) Uncultured archa

  11. Dicty_cDB: VSD133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SILKLSFKINEKNKNKNKKR**kivf Translated Amino Acid sequence (All Frames) Frame A: icnts...isilklsfkineknknknkkr**KIVFSLFLILYNKKK--- ---fksicntsdnanfnfeall*n**kk*k*k*kkiiensi Frame C: l*y***ckfqf*ssp

  12. Dicty_cDB: SSD104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available v i*sncfrs*pcrikiftnvl*iwheyitnslfstdiq*ncic*ctwgsdtsd Homology vs CSM-cDNA Score E Sequences producing sign...kkklmcftnkgwitiifwtsicfscseli*titcwtkwhtqgte*rls aswrs*ttifitrvchnrttwtf**wq*itftnwiw*mnesi*ycnfsttectltd*ti

  13. Dicty_cDB: SSD114 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TAAATAATTTAAAATAAAAAAAA AA sequence update 1999. 4. 5 Translated Amino Acid sequence yykql***qkksyfridw*cgyn...f*ty*nfkinfskcfyn*sn*keiilw*ywygcwv qwnkylkslilq*ii*nkkk Frame C: yykql***qkksyfridw*cgyn*AKLLVEQLIQHFNLIVIP

  14. Dicty_cDB: VSA784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrh... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62...13 |AL382813.1 Medicago truncatula EST MtBC10B03R1 : T7 end of clone MtBC10B03 of

  15. Dicty_cDB: CHL445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2002.10.25 Translated Amino Acid sequence nikekes*rg*hctinq*YSLIIKYLIKFNFIYIYKKMKTIKSLFLLSLLIVNLLI...WAQVTPXVKMLXGFQKVDXMPAKSQQISFTXNAYEFSXIGV DNKITLESVNSSLXLVINN*vyiynkkkn*k Frame C: nikekes*rg*hctinq*YSLIIKY

  16. Dicty_cDB: VSB580 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TACAAATTAATAAATGGTTACTTT AATTAT sequence update 2000. 3.23 Translated Amino Acid sequence ---*imwmmimmimikenike...pihtltht*i*yklingyfny Frame C: ---*imwmmimmimikenikemnfqy*kkv*iny*it*rllkiiiik*LN

  17. Dicty_cDB: VSG453 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A TATGAAAATANAAT sequence update 2001. 3.22 Translated Amino Acid sequence ltk**milkkrlttlvll*lhflfqnln*rnsq...rkiqh*kknmkix Frame C: ltk**milkkrlttlvll*lhflfqnln*rnsqsnkklylpntlqklvyri*qrslsqkn *ilp*kklkii*kiltdlaeqii*

  18. Dicty_cDB: SHD666 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ickrislelfir *f*fhfrefntr*yw*icnlfciingfpskn*sn*tifhrcssnpslfvgkcyikysiq* ng*ktkh...ciingfpskn*sn*tifhrcssnpslfvgkcyikysiq* ng*ktkhxtcif*ixixf Homology vs CSM-cDNA Score E Sequences producing

  19. Dicty_cDB: CHP479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lxixxktfkqivxp*y*vy*lt**ylxq*lxgy iixflgillnipkts*rxrpklqkkx--- ---xsnf*kkkkikkkiify*sl*ncelytklsnr*fspnirfid...*pnntcsnn*lgi*f i Frame C: cwptgfsnf*kkxkikkkixfy*sl*nxelxxklsnr*fxpnirfid*pnntcxnn*xgi *xifwaff*tyqkrvkggv

  20. Dicty_cDB: CFI534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TATNTTATAANCAGGTTTTAGG sequence update 2001.11.22 Translated Amino Acid sequence sl*ncelytklsnr*fspnirfid*pn...isl ntlsmvvvpitfsmlalvlmvd*lllgngllksqrnlmiqyxixrf* Frame C: sl*ncelytklsnr*fspnirfid*pnntcsnn*lgi*fifwaff*T

  1. Dicty_cDB: VFE203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tfyfyvngakxsefsganeatlxxtlxanx*ffv kliiaqkm Translated Amino Acid sequence (All F...yfyvngakxsefsganeatlxxtlxanx*ffv kliiaqkm Homology vs CSM-cDNA Score E Sequences producing significant align...iaqkmqqik*INKKK--- ---NQINNLY*kmskvihvtsnexlxkylqhqxvvvdfsaewcgpcxxxapvfdklsnef ttftfvhvdidkvxthpivkxixsxptf

  2. Dicty_cDB: CHI526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YVPXIESCXNNHYNXQLSXSIN*iny*xki kkiilitiii**ln*fansn Translated Amino Acid sequenc...ALDGTHMNPSYVPXIESCXNNHYNXQLSXSIN*iny*xki kkiilitiii**ln*fansn Homology vs CSM-cDNA Score E Sequences produci

  3. Dicty_cDB: SLC455 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC455 (Link to dictyBase) - - - Contig-U16584-1 SLC455Z (Link... to Original site) - - SLC455Z 379 - - - - Show SLC455 Library SL (Link to library) Clone ID SLC455 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC455Q.Seq.d/ Representative seq. ID SLC45...5Z (Link to Original site) Representative DNA sequence >SLC455 (SLC455Q) /CSM/SL/SLC4-C/SLC455Q.Seq.d/ XXXXX...57 ) Dictyostelium discoideum slug cDNA, clone SLC469. 468 e-177 3 ( AU034549 ) Dictyostelium discoideum slug cDNA, clone SLC4

  4. Order-disorder transitions in C60 and C70

    International Nuclear Information System (INIS)

    Ramasesha, S.K.

    1995-01-01

    In recent years enormous effort has been put in understanding the chemical and physical properties of C 60 and C 70 . Order-disorder transition in C 60 occurs around 250 K at ambient pressure. At the transition freely rotating molecules get orientationally ordered in a simple cubic lattice. Application of pressure increases the transition temperature at a rate of ≅ 10 K kbar -1 , indicating that pressure favours the ordered state. The DSC and x-ray studies on C 70 indicate two phase transitions, one around 270 K and the other around 340 K at room pressure. These transitions also occur at higher temperatures at higher pressures. Application of pressure is found to lift the degeneracy of the energetically equivalent rotational configurations. The high pressure studies are reviewed in the light of existing literature. (author)

  5. Dicty_cDB: VSE445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATTTA sequence update 2000. 6.23 Translated Amino Acid sequence ---vyvlgldgreyidkmnghkit*EVNDKVPISNETDRVYLNV...id **w*snfnysnl*lsvcqmllfgihglxnqskwkilvimniki*fvlklvlsill*nyhq inhsklniqyylqinlhykkkkkkkksk*******klsfii Frame C: ---vyvlgldgrey

  6. Dicty_cDB: CHB142 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sqfh*nhtlihhllmmvihtiqla fhfkdsiemnsmlllylvmxfk*xiirvqsisls Translated Amino Acid sequence (All Frames) Fram...KAA AEESRKHKSTIFQYIMRDGKLEREFSSASWGPYSRRRLNIMKLDQYLEMFYSLNVRLDPI VYQVKAKEPSTSTF*vlkksfqilklts*pkvkkfhsqfh*nh...tlihhllmmvihtiqla fhfkdsiemnsmlllylvmxfk*xiirvqsisls Frame C: ksffllf*ifflk*kk*yyf*qyylyyylvklnhihl*nvwigilv

  7. Dicty_cDB: CFE281 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KICPQWPARNHATAL RAGTVSFYLSPKMTSDAPADPSQDVFFQNSIHSSPFGN--- ---CLSSKGKRTLNINILGLKEIISKYSSXPLNQR*knstlnfirtix*fiiy**w*fiq yn*rstskxsiem...tlnfirtix*fiiy**w*fiq yn*rstskxsiemnsspxnsxwl Homology vs CSM-cDNA Score E Sequen

  8. Dicty_cDB: AFF372 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ll*tra*r clsfeilfrfpfpylfiresip*lsigfpnhl*kypfkik*kfnwlfrnyklsngis Frame C: tnntn...lsk*vwsklchfnplgq**wsk*yggfpsi*sst*igenrrippnst*snqm*ik itsf*rrh*nyqcryllfhryrsiegkrr*ihl*hlfpsgk*ntckyplgfg

  9. Dicty_cDB: VHK334 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTGCGTATAAAGAAATTAGGCTTTTTAATTAA GGTTTAAGNAGTAAGTGGNCTTGTCAGATTT sequence update 2002.10.25 Translated Amino Acid sequence mlvskikpcm...icpcplytppvaptdrmir*s*rivlsvatli*iksylnli v*rkeks*qgirr*tcgwiifylniinfmffwimellaykeirlfn*glxskwxcqi Frame C: mlvskikpcms

  10. Dicty_cDB: VHN529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tltciivavyddklqpgaaaniaekladyl idnnc*isilfknk*RKIIYKIKKK--- ---FHTLKTLNKYIIYNDLASIRR*qltwcwfrisc...c*kisrlfn*qqlln*ysfqk*it*nn Translated Amino Acid sequence (All Frames) Frame A: yndlasirr*qltwcwfriscsfrcc*...lvssllsmmtnynqvllltllkn*pii* ltttvklvffskinnvk*yik*kk--- ---FHTLKTLNKYIIYNDLASIRR*qltwcwfrisc

  11. Dicty_cDB: VFK707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qvll ltllkn*pii*ltttvklvffskinnvk*yik***KNVVTLYIYKKK--- ---TLKTLNKYIIYNDLASIRR*qltwcwfriscsfrcc*r*clgtlswiqc...kn*pii*ltttvklvffskinnvk*yik***kn Frame C: tlktlnkyiiyndlasirr*qltwcwfriscsfrcc*r...it*nni*nnnkkml*lyiyikkk--- ---TLKTLNKYIIYNDLASIRR*qltwcwfriscsfrcc*r*clgtlswiqcr*r*gnnr tfskgwscirnwhprcw*ei

  12. Dicty_cDB: VSF233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lllks*vit*eimvikilisc*nqldlilrikknnnnnki*msl Frame B: ***sptrisctyc*kvr*llkr*wllry*ylvktn*i*f*elkkiiiiikfkch...y*nk*i kkk--- ---***sptrisctyc*kvr*llkr*wllry*ylvktn*i*f*elkkiiiiikfkch Frame C:

  13. Dicty_cDB: SHA396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence sknfiql*itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn* liqkkykkpeifclerklkkfm*wvelesqiktiiqs...C: sknfiql*itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn* liqkkykkpeifclerklkkfm*wvelesqiktiiqsipfiltq

  14. Dicty_cDB: SHL846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vlivyhviq*iqlllmkhqeyyisn *aqhhiimmlkskkfnhh*ihhhqmvvkenhqnyqvvqllvlqlvvllvlvl*lvlsfil n*slvlkkhsiniliivfdgvnyklgsklq*iihkfk*itlitlen...in*ciiknihnixt vsyxyxiil Homology vs CSM-cDNA Score E Sequences producing significa

  15. Dicty_cDB: CHE547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX

  16. The Colletotrichum dracaenophilum, C. magnum and C. orchidearum species complexes

    NARCIS (Netherlands)

    Damm, U.; Sato, T.; Alizadeh, A.; Groenewald, J.Z.; Crous, P.W.

    2019-01-01

    Although Glomerella glycines, Colletotrichum magnum and C. orchidearum are known as causal agents of anthracnose of soybean, Cucurbitaceae and Orchidaceae, respectively, their taxonomy remains unresolved. In preliminary analyses based on ITS, strains of these species appear basal in

  17. Dicty_cDB: SHD119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available snih**ipqkvlvh*dsrtvamevgir*gvcnnspakwt speng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadldgsskyskeft lkaevgk...eatlx xtxxanq*ffxklxigxkxppi**ikkkkysq Frame C: sgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwt

  18. Dicty_cDB: SLG376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 572Q) /CSM/SS/SSD5-C/SSD572Q.Seq.d/ 555 e-157 CHB571 (CHB571Q) /CSM/CH/CHB5-C/CHB571Q.Seq.d/ 494 e-139 CFD492 (CFD492...Q) /CSM/CF/CFD4-D/CFD492Q.Seq.d/ 474 e-133 own update 2003.10.30 Homology vs DNA Score E Sequences

  19. Dicty_cDB: SLE172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d/ 1126 0.0 VHJ195 (VHJ195Q) /CSM/VH/VHJ1-D/VHJ195Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492... 0.0 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 817 0.0 1 ( C83939 ) Dictyostelium dis

  20. Cervical myelography via C1/C2 lateral puncture

    International Nuclear Information System (INIS)

    Grange, B.

    1981-01-01

    The use of the water soluble, tri-iodinated contrast medium, metrizamide, in cervical myelography via C1/C2 lateral puncture is described. Details of the tomographic apparatus and the technique employed are given. The advantages of water soluble myelography using metrizamide are overwhelming due to its miscibility with CSF, improved anatomical demonstration, radiographic visualisation and diagnostic accuracy and advantageous pharmacological properties with reduced toxicity. This technique provided successful diagnoses in a series of 104 patients. (U.K.)