WorldWideScience

Sample records for actinium c

  1. Spectroscopic and computational investigation of actinium coordination chemistry

    Science.gov (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.

    2016-08-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1- ligands (3.2+/-1.1) than AmIII (0.8+/-0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour.

  2. Spectroscopic and computational investigation of actinium coordination chemistry

    Science.gov (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac–Cl and Ac–OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1– ligands (3.2±1.1) than AmIII (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour. PMID:27531582

  3. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Science.gov (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development.

  5. Relativistic small-core pseudopotentials for actinium, thorium, and protactinium.

    Science.gov (United States)

    Weigand, Anna; Cao, Xiaoyan; Hangele, Tim; Dolg, Michael

    2014-04-03

    Small-core pseudopotentials for actinium, thorium, and protactinium have been energy-adjusted to multiconfiguration Dirac-Hartree-Fock reference data based on the Dirac-Coulomb-Breit Hamiltonian and the Fermi nucleus model. Corresponding optimized valence basis sets of polarized valence quadruple-ζ quality are presented. Atomic test calculations for the first four ionization potentials show satisfactory results at both the Hartree-Fock and the multireference averaged coupled-pair functional level. Highly correlated Fock-space coupled cluster calculations demonstrate that the new pseudopotentials yield ionization potentials, which are in excellent agreement with corresponding all-electron results and experimental data. The pseudopotentials and basis sets supplement a similar set previously published for uranium.

  6. Thorium and actinium polyphosphonate compounds as bone-seeking alpha particle-emitting agents.

    Science.gov (United States)

    Henriksen, Gjermund; Bruland, Oyvind S; Larsen, Roy H

    2004-01-01

    The present study explores the use of alpha-particle-emitting, bone-seeking agents as candidates for targeted radiotherapy. Actinium and thorium 1,4,7,10 tetraazacyclododecane N,N',N'',N''' 1,4,7,10-tetra(methylene) phosphonic acid (DOTMP) and thorium-diethylene triamine N,N',N'' penta(methylene) phosphonic acid (DTMP) were prepared and their biodistribution evaluated in conventional Balb/C mice at four hours after injection. All three bone-seeking agents showed a high uptake in bone and a low uptake in soft tissues. Among the soft tissue organs, only kidney had a relatively high uptake. The femur/kidney ratios for 227Th-DTMP, 228-Ac-DOTMP and 227Th-DOTMP were 14.2, 7.6 and 6.0, respectively. A higher liver uptake of 228Ac-DOTMP was seen than for 227Th-DTMP and 227Th-DOTMP. This suggests that some demetallation of the 228Ac-DOTMP complex had occurred. The results indicate that 225Ac-DOTMP, 227Th-DOTMP and 227Th-DTMP have promising properties as potential therapeutic bone-seeking agents.

  7. Effects of spin-orbit coupling on actinium under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Rubio-Ponce, A.; Rivera, J. [Departamento de Ciencias Basicas, Universidad Autonoma Metropolitana-Azcapotzalco, Mexico (Mexico); Olguin, D. [Departamento de Fi sica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Mexico (Mexico)

    2015-04-15

    Actinium (Ac) is a radioactive metal and the first element of the actinide series. At ambient conditions Ac crystallizes in the fcc lattice, however, up to date its phase diagram is unknown. In the present work, we have studied the structural and electronic properties of Ac under hydrostatic pressure assuming the fcc structure as well as three hypothetical structures, namely the hcp, bcc, and sc, and for pressures up to 100 GPa. From our calculations, we found only one structural transition allowed, from the fcc to hcp, our calculated pressure was 39.85 GPa. The calculations were performed by means of the full potential linearized augmented plane wave (FLAPW) method and the generalized gradient approximation (GGA) for the exchange-correlation energy, where we have included in our study the spin-orbit coupling which is important for heavy elements. The total energy results were fitted to the third order Birch-Murnaghan's equation of state. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  9. Report for General Research September 18 to December 11, 1950 (Actinium Volume)

    Energy Technology Data Exchange (ETDEWEB)

    Haring, M.M.

    1951-01-15

    The purpose of the research work presented in this volume is to develop a process for the separation and purification of actinium-227 produced by neutron bombardment of radium-226 and to develop methods by which uniform films of actinium metal may be deposited on metallic surfaces. The design work on the cave structure and mechanical equipment used in the actinium separation is proceeding on schedule. As the mechanical design phase is nearing completion the emphasis is being directed toward processing equipment. The process as well as the mechanical equipment has been adapted from the research work of F. T. Hagemann and the Remote Control Group at Argonne National Laboratory. Consequently, one of the first objectives is to become familiary with the chemistry of the process and the operation of the mechanical equipment. Cold runs have been made on the T.T.A. benzene extraction using lanthanum and barium in place of actinium and radium. No difficulty with the operation was observed. The formation of precipitates was one of the difficulties encountered with the process as the precipitates carry radium. It has been found that metals such as nickel cause these precipitates to form and should, therefore, be avoided in the construction of equipment. it was also found that a T.T.A. solution exposed to 0.5 curie of polonium over a period of days develops a precipitate. Some new mechanical features hav eshown promise. The use of copper-coated glassware which will hold together even though the glass is cracked has made it possible to replace custom-built heaters with standard heating mantles. A new graphite, silicone grease mixture appears to hold up in stopcocks handling benzene and, as a result, may eliminate the necessary of entering the cave for regreasing. Tests on the preparation of dense concrete have given results which meet the shielding requirements for the cave. A strippable paint and tape combination has been studied and specified to provide for decontamination of

  10. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  11. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  12. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  13. The release of dissolved actinium to the ocean: A global comparison of different end-members

    Science.gov (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.

    2008-01-01

    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry

  14. C

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Schouten, S.; Volkman, J.K.

    2014-01-01

    A limited suite of C-27, C-29 and C-30 rearranged hopenes identified as neohop-13(18)-enes have been reported in immature Recent and ancient marine/lacustrine sediments and their presence has been explained by dehydration and isomerisation of ubiquitous hopanols or hopenes. Here we investigated the

  15. Production of actinium-225 for alpha particle mediated radioimmunotherapy.

    Science.gov (United States)

    Boll, Rose A; Malkemus, Dairin; Mirzadeh, Saed

    2005-05-01

    The initial clinical trials for treatment of acute myeloid leukemia have demonstrated the effectiveness of the alpha emitter (213)Bi in killing cancer cells. Bismuth-213 is obtained from a radionuclide generator system from decay of 10-days (225)Ac parent. Recent pre-clinical studies have also shown the potential application of both (213)Bi, and the (225)Ac parent radionuclide in a variety of cancer systems and targeted radiotherapy. This paper describes our five years of experience in production of (225)Ac in partial support of the on-going clinical trials. A four-step chemical process, consisting of both anion and cation exchange chromatography, is utilized for routine separation of carrier-free (225)Ac from a mixture of (228)Th, (229)Th and (232)Th. The separation of Ra and Ac from Th is achieved using the marcoporous anion exchange resin MP1 in 8M HNO(3) media. Two sequential MP1/NO(3) columns provide a separation factor of approximately 10(6) for Ra and Ac from Th. The separation of Ac from Ra is accomplished on a low cross-linking cation exchange resin AG50-X4 using 1.2M HNO(3) as eluant. Two sequential AG50/NO(3) columns provide a separation factor of approximately 10(2) for Ac from Ra. A 60-day processing schedule has been adopted in order to reduce the processing cost and to provide the highest levels of (225)Ac possible. Over an 8-week campaign, a total of approximately 100 mCi of (225)Ac (approximately 80% of the theoretical yield) is shipped in 5-6 batches, with the first batch typically consisting of approximately 50 mCi. After the initial separation and purification of Ac, the Ra pool is re-processed on a bi-weekly schedule or as needed to provide smaller batches of (225)Ac. The averaged radioisotopic purity of the (225)Ac was 99.6 +/- 0.7% with a (225)Ra content of < or =0.6%, and an average (229)Th content of (4(-4)(+5)) x 10(-5)%.

  16. Isolation of Actinium from Neutron-irradiated Thorium-I

    Institute of Scientific and Technical Information of China (English)

    1994-01-01

    Isolation of Actinium from Neutron-irradiated Thorium-I¥YangWeifan;YuanShuanggui;MuWantong;ZhangXueqian;LiZhongweiandZhaoLili...

  17. Hepatite C Hepatitis C

    Directory of Open Access Journals (Sweden)

    Edna Strauss

    2001-02-01

    Full Text Available Estima-se que cerca de 3% da população mundial esteja infectada pelo vírus da hepatite C. Todos os que receberam transfusão de sangue ou seus componentes e os usuários de drogas podem estar infectados. Procedimentos odontológicos, médicos, tatuagem ou acupuntura também constituem fatores de risco. A infecção se cronifica em até 85% dos indivíduos, com evolução assintomática durante anos ou décadas e apresentação clínica variada. Para o diagnóstico, a determinação do anti-VHC revela-se muito sensível e a confirmação se faz pela determinação do RNA-VHC no sangue; o estadiamento da doença e a avaliação da atividade inflamatória pela biópsia hepática. O tratamento objetiva deter a progressão da doença hepática através da inibição da replicação viral. Devido à baixa eficácia terapêutica aliada a importantes efeitos colaterais do interferon e da ribavirina, esses medicamentos encontram indicações e contra-indicações específicas. Vários fatores preditivos de resposta ao tratamento, principalmente a carga viral e o genótipo do VHC, mostram-se úteis na avaliação dos pacientes.It has been estimated that 3% of the world population is infected with the hepatitis C virus. Those who are blood product recipients or have been illicit drug users are at risk. Dental and medical procedures as well as tattooing and acupuncture are also risk factors. Chronic infection occurs in up to 85% of infected cases but they may remain without symptoms during years or even decades, and clinical presentation varies. Determination of anti-HCV in sera is a fairly sensitive tool for the diagnosis, and confirmation requires the identification of HCV-RNA. Staging of the liver disease as well as definition of its present activity can be graded by liver biopsy. The aim of treatment is to stop the progression of the hepatic disease by inhibiting viral replication. Due to the low therapeutic efficacy combined with important side

  18. Beginning C

    CERN Document Server

    Horton, Ivor

    2013-01-01

    Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

  19. Vitamin C

    Science.gov (United States)

    ... body needs to grow and develop normally. Vitamin C is an antioxidant. It is important for your ... healing and helps the body absorb iron. Vitamin C comes from fruits and vegetables. Good sources include ...

  20. Hepatitis C

    Science.gov (United States)

    ... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

  1. Professional C++

    CERN Document Server

    Gregoire, Marc; Kleper, Scott J

    2011-01-01

    Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

  2. Balanced {C_4, C_5}-Quatrefoil Systems

    OpenAIRE

    USHIO, Kazuhiko

    2004-01-01

    In graph theory, the decomposition problems of graphs are very important topics. Various types of decompositions of many graphs can be seen in the literature of gaph theory. We give the necessary and sufficient condition for the existence of a balanced {C_4, C_5}-quatrefoil decomposition of K_n for each of (C_4, C_4, C_4, C_4)-quatrefoil, (C_4, C_4, C_4, C_5)-quatrefoil, (C_4, C_4, C_5, C_5)-quatrefoil, (C_4, C_5, C_5, C_5)-quatrefoil, and (C_5, C_5, C_5, C_5)-quatrefoil. These decompositions...

  3. C++ Cookbook

    CERN Document Server

    Stephens, D Ryan; Turkanis, Jonathan; Cogswell, Jeff

    2006-01-01

    Despite its highly adaptable and flexible nature, C++ is also one of the more complex programming languages to learn. Once mastered, however, it can help you organize and process information with amazing efficiency and quickness. The C++ Cookbook will make your path to mastery much shorter. This practical, problem-solving guide is ideal if you're an engineer, programmer, or researcher writing an application for one of the legions of platforms on which C++ runs. The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't

  4. Professional C++

    CERN Document Server

    Gregoire, Marc

    2014-01-01

    Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,

  5. Advanced C and C++ compiling

    CERN Document Server

    Stevanovic, Milan

    2014-01-01

    Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

  6. Protein C

    Science.gov (United States)

    ... have an unexplained blood clot, or a family history of blood clots. Protein C helps control blood clotting. A lack of this protein or problem with the function of this protein may cause blood clots to ...

  7. Hall C

    Data.gov (United States)

    Federal Laboratory Consortium — Hall C's initial complement of equipment (shown in the figure), includes two general-purpose magnetic spectrometers. The High Momentum Spectrometer (HMS) has a large...

  8. Hepatitis C

    Science.gov (United States)

    ... Events Follow Us Home Health Information Liver Disease Hepatitis (Viral) Hepatitis C Related Topics English English Español Section Navigation Hepatitis (Viral) What Is Viral Hepatitis? Hepatitis A Hepatitis B ...

  9. Vitamin C

    Science.gov (United States)

    ... cataracts AMD and cataracts are two of the leading causes of vision loss in older people. Researchers do not believe that vitamin C and other antioxidants affect the risk of getting AMD. However, research ...

  10. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    Energy Technology Data Exchange (ETDEWEB)

    Aleissa, Khalid A.; Almasoud, Fahad I.; Islam, Mohammed S. [Atomic Energy Research Institute, King Abdul Aziz City for Science and Technology, P.O. Box 6086, Riyadh 11442 (Saudi Arabia); L' Annunziata, Michael F. [IAEA Expert, Montague Group, P.O. Box 5033, Oceanside, CA 92052-5033 (United States)], E-mail: mlannunziata@cox.net

    2008-12-15

    The activities of {sup 228}Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide {sup 228}Ac. The radium was pre-concentrated on MnO{sub 2} and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter {sup 228}Ra({sup 228}Ac), the daughter nuclide {sup 228}Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by {sup 228}Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9{+-}0.1% was measured for {sup 228}Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317{+-}0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of {sup 228}Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for {sup 228}Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure {sup 228}Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  11. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228.

    Science.gov (United States)

    Aleissa, Khalid A; Almasoud, Fahad I; Islam, Mohammed S; L'Annunziata, Michael F

    2008-12-01

    The activities of (228)Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide (228)Ac. The radium was pre-concentrated on MnO(2) and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter (228)Ra((228)Ac), the daughter nuclide (228)Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by (228)Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9+/-0.1% was measured for (228)Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317+/-0.013cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of (228)Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for (228)Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure (228)Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  12. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  13. C/C-PAA与C/C-FA弯曲性能对比%Comparison of Flexural Properties Between C/C-PAA and C/C-FA

    Institute of Scientific and Technical Information of China (English)

    张万强; 赵英民; 王涛; 詹万初

    2014-01-01

    通过PIP工艺制备了C/C-PAA、C/C-FA复合材料,对PAA、FA裂解碳的XRD、浸渍效果以及C/C-PAA和C/C-FA的弯曲强度进行了分析.结果表明:PAA裂解碳的炭质量、浸渍效果较好,C/C-PAA弯曲强度比C/C-FA弯曲强度高34.9%,弯曲模量对比不明显.

  14. Ruthenium(II)-Catalyzed C-C Arylations and Alkylations: Decarbamoylative C-C Functionalizations.

    Science.gov (United States)

    Moselage, Marc; Li, Jie; Kramm, Frederik; Ackermann, Lutz

    2017-04-05

    Ruthenium(II)biscarboxylate catalysis enabled selective C-C functionalizations by means of decarbamoylative C-C arylations. The versatility of the ruthenium(II) catalysis was reflected by widely applicable C-C arylations and C-C alkylations of aryl amides, as well as acids with modifiable pyrazoles, through facile organometallic C-C activation.

  15. Hepatitis C.

    Science.gov (United States)

    Sharara, A I; Hunt, C M; Hamilton, J D

    1996-10-15

    To review the virology, epidemiology, pathogenesis, natural history, clinical manifestations, and current treatment of hepatitis C virus (HCV) infection. The MEDLINE database (1966 to 1996) was searched for English-language articles and abstracts on HCV and non-A, non-B hepatitis. Papers cited in relevant primary articles were also reviewed. More than 500 original and review articles were evaluated, and the most relevant were selected. Data were extracted and reviewed by all authors. In most patients, HCV infection results in chronic hepatitis. The disease is insidious and subclinical but may progress over decades into end-stage liver disease and hepatocellular carcinoma, which makes HCV cirrhosis a leading indication for orthotopic liver transplantation. Current diagnostic methods are highly sensitive and specific, and quantitative assessment of viral load may help to predict and monitor response to treatment. The only available therapeutic option is interferon, and this agent is effective in only a small subset of patients. Infection with HCV is a significant public health problem that has important clinical and financial consequences. The tailoring of specific therapy according to viral load or genotype, better patient selection, and use of combination drug regimens may improve the chance of viral clearance and sustained biochemical and histologic response. Further understanding of the basic virology of HCV and the exact mechanisms of viral persistence and tissue injury is needed to help define future therapeutic and preventive strategies.

  16. Vademecum of chlorofluorocarbons (C. F. C. ) removal

    Energy Technology Data Exchange (ETDEWEB)

    1993-01-01

    Greenhouse gases such chlorofluorocarbons (C.F.C.) are responsible of ozone layer impoverishment. Montreal international agreement has proposed to stop production and C.F.C. using and realize C.F.C. removal. This guide book gives informations on recovery recycling and removal methods.

  17. Programming C# Building NET Applications with C#

    CERN Document Server

    Liberty, Jesse

    2009-01-01

    Programming C#, the top-selling book on Microsoft's high-performance C# programming language, is now in its fourth edition. Aimed at experienced programmers and web developers, this comprehensive guide focuses on the features and programming patterns that are unique to C#, and fundamental to the programming of web services and web applications on Microsoft's .NET platform.

  18. Accelerated C# 2010

    CERN Document Server

    Nash, Trey

    2010-01-01

    C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

  19. Hemoglobin C disease

    Science.gov (United States)

    Clinical hemoglobin C ... Hemoglobin C is an abnormal type of hemoglobin, the protein in red blood cells that carries oxygen. It is ... Americans. You are more likely to have hemoglobin C disease if someone in your family has had ...

  20. C-Peptide Test

    Science.gov (United States)

    ... AACC products and services. Advertising & Sponsorship: Policy | Opportunities C-peptide Share this page: Was this page helpful? Also known as: Insulin C-peptide; Connecting Peptide Insulin; Proinsulin C-peptide Formal ...

  1. Travelers' Health: Hepatitis C

    Science.gov (United States)

    ... 3 - Hepatitis B Chapter 3 - Hepatitis E Hepatitis C Deborah Holtzman INFECTIOUS AGENT Hepatitis C virus (HCV), ... to child. Map 3-05. Prevalence of hepatitis C virus infection 1 PDF Version (printable) 1 Disease ...

  2. Travelers' Health: Hepatitis C

    Science.gov (United States)

    ... Chapter 3 - Hepatitis B Chapter 3 - Hepatitis E Hepatitis C Deborah Holtzman INFECTIOUS AGENT Hepatitis C virus ( ... human blood Map 3-05. Global epidemiology of hepatitis C virus infection 1 PDF Version (printable) 1 ...

  3. HIV and Hepatitis C

    Science.gov (United States)

    ... AIDS-Related Opportunistic Infections and Coinfections HIV and Hepatitis C (Last updated 8/31/2016; last reviewed ... the medicines for any side effects. What is hepatitis C? Hepatitis C is a liver disease caused ...

  4. Cryptococcosis (C. gattii)

    Science.gov (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. gattii Infection Recommend on Facebook Tweet Share Compartir Case Reporting C. gattii infection is reportable in some states. Healthcare ...

  5. Stool C difficile toxin

    Science.gov (United States)

    ... toxin; Colitis - toxin; Pseudomembranous - toxin; Necrotizing colitis - toxin; C difficile - toxin ... be analyzed. There are several ways to detect C difficile toxin in the stool sample. Enzyme immunoassay ( ...

  6. C and C* among intermediate rings

    NARCIS (Netherlands)

    J. Sack; S. Watson

    2013-01-01

    Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA, exte

  7. C and C* among intermediate rings

    NARCIS (Netherlands)

    Sack, J.; Watson, S.

    2014-01-01

    Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA, exte

  8. Photosynthesis of C3, C3-C4, and C4 grasses at glacial CO2.

    Science.gov (United States)

    Pinto, Harshini; Sharwood, Robert E; Tissue, David T; Ghannoum, Oula

    2014-07-01

    Most physiology comparisons of C3 and C4 plants are made under current or elevated concentrations of atmospheric CO2 which do not reflect the low CO2 environment under which C4 photosynthesis has evolved. Accordingly, photosynthetic nitrogen (PNUE) and water (PWUE) use efficiency, and the activity of the photosynthetic carboxylases [Rubisco and phosphoenolpyruvate carboxylase (PEPC)] and decarboxylases [NADP-malic enzyme (NADP-ME) and phosphoenolpyruvate carboxykinase (PEP-CK)] were compared in eight C4 grasses with NAD-ME, PCK, and NADP-ME subtypes, one C3 grass, and one C3-C4 grass grown under ambient (400 μl l(-1)) and glacial (180 μl l(-1)) CO2. Glacial CO2 caused a smaller reduction of photosynthesis and a greater increase of stomatal conductance in C4 relative to C3 and C3-C4 species. Panicum bisulcatum (C3) acclimated to glacial [CO2] by doubling Rubisco activity, while Rubisco was unchanged in Panicum milioides (C3-C4), possibly due to its high leaf N and Rubisco contents. Glacial CO2 up-regulated Rubisco and PEPC activities in concert for several C4 grasses, while NADP-ME and PEP-CK activities were unchanged, reflecting the high control exerted by the carboxylases relative to the decarboxylases on the efficiency of C4 metabolism. Despite having larger stomatal conductance at glacial CO2, C4 species maintained greater PWUE and PNUE relative to C3-C4 and C3 species due to higher photosynthetic rates. Relative to other C4 subtypes, NAD-ME and PEP-CK grasses had the highest PWUE and PNUE, respectively; relative to C3, the C3-C4 grass had higher PWUE and similar PNUE at glacial CO2. Biomass accumulation was reduced by glacial CO2 in the C3 grass relative to the C3-C4 grass, while biomass was less reduced in NAD-ME grasses compared with NADP-ME and PCK grasses. Under glacial CO2, high resource use efficiency offers a key evolutionary advantage for the transition from C3 to C4 photosynthesis in water- and nutrient-limited environments.

  9. Facts about Vitamin C

    Science.gov (United States)

    Facts About Vitamin C 1 Linda B. Bobroff and Isabel Valentín-Oquendo 2 FCS8702 Why do we need vitamin C? Vitamin C, also known as ascorbic acid, has a ... maintain healthy body tissues and the immune system. Vitamin C also helps the body absorb iron from ...

  10. Seminario C++, parte 1

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Clases en C++. Operaciones set/get/is. Tipo Referencia (&). El puntero 'this'. Los constructores. El destructor.

  11. Anomalous absorption in c-C_3H and c-C_3D radicals

    Science.gov (United States)

    Chandra, S.; Shinde, S. V.; Kegel, W. H.; Sedlmayr, E.

    Yamamoto et al. (1987) reported the first detection of the c-C_3H radical in TMC-1 through its transition 2_1 2 rightarrow 1_1 1 at 91.5 GHz. The column density of c-C_3H in TMC-1 was estimated to be 6 times 10^12 cm^-2, which is about one order of magnitude lower than that of the c-C_3H_2 which is ubiquitous in galactic objects. Mangum & Wootten (1990) detected c-C_3H through the transition 1_1 0 rightarrow 1_1 1 at 14.8 GHz in 12 additional galactic objects. The most probable production mechanism of both the c-C_3H and c-C_3H_2 in dark clouds is a common dissociation reaction of the C_3H_3^+ ion (Adams & Smith 1987). Although the c-C_3H is 0.8 eV less stable than its isomer l-C_3H, finding of comparable column densities of both the isomers in TMC-1 suggests that the formation rate for both, c-C_3H and l-C_3H, are of about the same order in the cosmic objects. The existence of a metastable isomer under interstellar conditions is a well known phenomenon in astronomy. The aim of this investigation is a quantitative estimate of relative line intensities under NLTE conditions. For wide ranges of physical parameters, where these molecules may be found, we have solved a set of statistical equilibrium equations coupled with the equations of radiative transfer in an on-the-spot approximation. For c-C_3H, we accounted for 51 energy levels connected by 207 radiative transitions and for c-C_3D, we accounted for 51 energy levels connected by 205 radiative transitions. Our results show that the 3_3 1 rightarrow 3_3 0 transition of c-C_3H and c-C_3D may be found in absorption against the cosmic microwave background (CMB). Furthermore, we found population inversion for the 1_1 0 rightarrow 1_1 1 transition. These findings may be useful in identifying these molecules in other cosmic objects, as well as for the determination of physical parameters in these objects.

  12. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  13. Restructuring C Programs into C++ Programs

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    There exist a lot of legacy systems written in C language, whichare di fficult to understand, modify, maintain and reuse. How to improve the quality of these non object-oriented systems has become an important issue in software en g ineering area. A possible way is to transform these procedural systems into sema ntically equivalent object-oriented systems implemented in C++ language, which p rovides object-oriented features such as data abstraction, inheritance and poly m orphism, makes software system more comprehensible, maintainable and reusable. A detailed discussion on polymorphism analysis, object discovery and possible inheritance relation extraction on C-to-C++ conversion problem i s made, wh ich is also suitable to the transformation on legacy systems implemented in othe r procedural languages to equivalent object-oriented systems.

  14. Practical C++ Programming

    CERN Document Server

    Oualline, Steve

    2003-01-01

    C++ is a powerful, highly flexible, and adaptable programming language that allows software engineers to organize and process information quickly and effectively. But this high-level language is relatively difficult to master, even if you already know the C programming language. The 2nd edition of Practical C++ Programming is a complete introduction to the C++ language for programmers who are learning C++. Reflecting the latest changes to the C++ standard, this 2nd edition takes a useful down-to-earth approach, placing a strong emphasis on how to design clean, elegant code. In short, to-th

  15. C++ for dummies

    CERN Document Server

    Davis , Stephen R

    2014-01-01

    The best-selling C++ For Dummies book makes C++ easier! C++ For Dummies, 7th Edition is the best-selling C++ guide on the market, fully revised for the 2014 update. With over 60% new content, this updated guide reflects the new standards, and includes a new Big Data focus that highlights the use of C++ among popular Big Data software solutions. The book provides step-by-step instruction from the ground up, helping beginners become programmers and allowing intermediate programmers to sharpen their skills. The companion website provides all code mentioned in the text, an updated GNU_C++, the new

  16. C++ Programming Language

    Science.gov (United States)

    Shaykhian, Gholam Ali

    2007-01-01

    C++ Programming Language: The C++ seminar covers the fundamentals of C++ programming language. The C++ fundamentals are grouped into three parts where each part includes both concept and programming examples aimed at for hands-on practice. The first part covers the functional aspect of C++ programming language with emphasis on function parameters and efficient memory utilization. The second part covers the essential framework of C++ programming language, the object-oriented aspects. Information necessary to evaluate various features of object-oriented programming; including encapsulation, polymorphism and inheritance will be discussed. The last part of the seminar covers template and generic programming. Examples include both user defined and standard templates.

  17. Objective-C

    CERN Document Server

    DeVoe, Jiva

    2011-01-01

    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  18. Exploring C++ 11

    CERN Document Server

    Lischner, Ray

    2014-01-01

    Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat

  19. Testing of DLR C/C-SiC and C/C for HIFiRE 8 Scramjet Combustor

    Science.gov (United States)

    Glass, David E.; Capriotti, Diego P.; Reimer, Thomas; Kutemeyer, Marius; Smart, Michael K.

    2014-01-01

    Ceramic Matrix Composites (CMCs) have been proposed for use as lightweight hot structures in scramjet combustors. Previous studies have calculated significant weight savings by utilizing CMCs (active and passive) versus actively cooled metallic scramjet structures. Both a carbon/carbon (C/C) and a carbon/carbon-silicon carbide (C/C-SiC) material fabricated by DLR (Stuttgart, Germany) are being considered for use in a passively cooled combustor design for Hypersonic International Flight Research Experimentation (HIFiRE) 8, a joint Australia / Air Force Research Laboratory hypersonic flight program, expected to fly at Mach 7 for approximately 30 sec, at a dynamic pressure of 55 kilopascals. Flat panels of the DLR C/C and C/C-SiC materials were installed downstream of a hydrogen-fueled, dual-mode scramjet combustor and tested for several minutes at conditions simulating flight at Mach 5 and Mach 6. Gaseous hydrogen fuel was used to fuel the scramjet combustor. The test panels were instrumented with embedded Type K and Type S thermocouples. Zirconia felt insulation was used during some of the tests to reduce heat loss from the back surface and thus increase the heated surface temperature of the C/C-SiC panel approximately 177 C (350 F). The final C/C-SiC panel was tested for three cycles totaling over 135 sec at Mach 6 enthalpy. Slightly more erosion was observed on the C/C panel than the C/C-SiC panels, but both material systems demonstrated acceptable recession performance for the HIFiRE 8 flight.

  20. Production of actinium, thorium and radium isotopes from natural thorium irradiated with protons up to 141 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Ermolaev, S.V.; Zhuikov, B.L.; Kokhanyuk, V.M.; Matushko, V.L. [Russian Academy of Sciences, Moscow (Russian Federation). Inst. of Nuclear Research; Kalmykov, S.N. [Lomonosov Moscow State Univ., Moscow (Russian Federation). Chemistry Dept.; Aliev, R.A. [Lomonosov Moscow State Univ., Moscow (Russian Federation). Skobeltsyn Inst. of Nuclear Physics; Tananaev, I.G.; Myasoedov, B.F. [Russian Academy of Sciences, Moscow (Russian Federation). A.N. Frumkin Inst. of Physical Chemistry and Electrochemistry

    2012-07-01

    Cross sections of {sup 225}Ac, {sup 227}Ac, {sup 227}Th and {sup 228}Th in thorium-232 targets irradiated with protons in the energy range 21-141 MeV have been measured. Based on these data, production yields of {sup 225}Ac and {sup 223}Ra in thick thorium targets have been calculated. It is possible to produce in proton energy range 60-140 MeV about 96 GBq (2.6 Ci) {sup 225}Ac per 10-d irradiation with 100 {mu}A proton beam current and 10-d decay, and much higher amount of {sup 223}Ra. The impurities of {sup 227}Ac and {sup 224}Ra are important and need to be assessed for further medical applications. (orig.)

  1. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  2. A generalized stoichiometric model of C3, C2, C2+C4, and C4 photosynthetic metabolism.

    Science.gov (United States)

    Bellasio, Chandra

    2017-01-01

    The goal of suppressing photorespiration in crops to maximize assimilation and yield is stimulating considerable interest among researchers looking to bioengineer carbon-concentrating mechanisms into C3 plants. However, detailed quantification of the biochemical activities in the bundle sheath is lacking. This work presents a general stoichiometric model for C3, C2, C2+C4, and C4 assimilation (SMA) in which energetics, metabolite traffic, and the different decarboxylating enzymes (NAD-dependent malic enzyme, NADP-dependent malic enzyme, or phosphoenolpyruvate carboxykinase) are explicitly included. The SMA can be used to refine experimental data analysis or formulate hypothetical scenarios, and is coded in a freely available Microsoft Excel workbook. The theoretical underpinnings and general model behaviour are analysed with a range of simulations, including (i) an analysis of C3, C2, C2+C4, and C4 in operational conditions; (ii) manipulating photorespiration in a C3 plant; (iii) progressively upregulating a C2 shuttle in C3 photosynthesis; (iv) progressively upregulating a C4 cycle in C2 photosynthesis; and (v) manipulating processes that are hypothesized to respond to transient environmental inputs. Results quantify the functional trade-offs, such as the electron transport needed to meet ATP/NADPH demand, as well as metabolite traffic, inherent to different subtypes. The SMA refines our understanding of the stoichiometry of photosynthesis, which is of paramount importance for basic and applied research. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  3. SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

  4. Hepatitis C and Incarceration

    Science.gov (United States)

    HEPATITIS C & INCARCERATION What is hepatitis? “Hepatitis” means inflammation or swelling of the liver. The liver is an important ... viral hepatitis: Hepatitis A, Hepatitis B, and Hepatitis C. They are all different from each other and ...

  5. Hepatitis C Test

    Science.gov (United States)

    ... products and services. Advertising & Sponsorship: Policy | Opportunities Hepatitis C Testing Share this page: Was this page helpful? Also known as: Hepatitis C Antibody; Anti-HCV; HCV-PCR; HCV-RNA; Hepatitis ...

  6. Cryptococcosis (C. neoformans)

    Science.gov (United States)

    ... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch C. neoformans Infection Recommend on Facebook Tweet Share Compartir ... throughout the world. People can become infected with C. neoformans after breathing in the microscopic fungus, although ...

  7. A1C test

    Science.gov (United States)

    HbA1C test; Glycated hemoglobin test; Glycosylated hemoglobin test; Hemoglobin glycosylated test; Glycohemoglobin test ... have recently eaten does not affect the A1C test, so you do not need to fast to ...

  8. Hepatitis C (image)

    Science.gov (United States)

    Hepatitis C is a virus-caused liver inflammation which may cause jaundice, fever and cirrhosis. Persons who are most at risk for contracting and spreading hepatitis C are those who share needles for injecting drugs ...

  9. C-TOOL

    DEFF Research Database (Denmark)

    Taghizadeh-Toosi, Arezoo; Christensen, Bent Tolstrup; Hutchings, Nicholas John

    2014-01-01

    Soil organic carbon (SOC) is a significant component of the global carbon (C) cycle. Changes in SOC storage affect atmospheric CO2 concentrations on decadal to centennial timescales. The C-TOOL model was developed to simulate farm- and regional-scale effects of management on medium- to long......-term SOC storage in the profile of well-drained agricultural mineral soils. C-TOOL uses three SOC pools for both the topsoil (0–25 cm) and the subsoil (25–100 cm), and applies temperature-dependent first order kinetics to regulate C turnover. C-TOOL also enables the simulation of 14C turnover. The simple...... model structure facilitates calibration and requires few inputs (mean monthly air temperature, soil clay content, soil C/N ratio and C in organic inputs). The model was parameterised using data from 19 treatments drawn from seven long-term field experiments in the United Kingdom, Sweden and Denmark...

  10. Dicty_cDB: SSL803 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IPGLEFAYANSPRSMKSLVIAG WFICVSIGNMFDAFVIELIGFPEYVFSLLFGSVMFVFPFTFTIMCLWIQGICSLGFG*ik w*ssng***c*c*fqgigccnskg...IQGICSLGFG*ik w*ssng***c*c*fqgigccnskgfiiffksnf****q***lnfg**y*lwl*s*kikli nlkikt

  11. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  12. C-60 complexation revisited

    NARCIS (Netherlands)

    Williams, R.M.; Verhoeven, J.M.

    1994-01-01

    In the recent paper by Atwood et al. (Nature 368, 229-231, 1994) on a purification procedure for C60 and C70 by selective complexation with calixarenes, it was implied that we had previously studied the complexation of C60 with cyclodextrins (Williams, R. M. & Verhoeven, J. W., Recl. Trav. Chim.

  13. Oxidation Behavior of C/C-SiC Gradient Matrix Composites

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Oxidation behavior of C/C-SiC gradient matrix composites and C/C composites were compared in stationary air. The results show that oxidation threshold of C-SiC materials increases with the amount of SiC particles in the codeposition matrix. Oxidation rate of C/C-SiC gradient matrix composites is significantly lower than that of C/C material. The micro-oxidation process was observed by SEM.

  14. Learning C# 30

    CERN Document Server

    Liberty, Jesse

    2008-01-01

    If you're new to C#, Learning C# 3.0 is the ideal way to get started. Learning C# 3.0 starts with the fundamentals and takes you through intermediate and advanced C# features-including generics, interfaces, delegates, lambda expressions, and LINQ. You'll also learn how to build Windows applications and handle data with C#. Each chapter offers a self-contained lesson with plenty of annotated examples, illustrations, and a concise summary. No previous programming experience is required.

  15. Head first C#

    CERN Document Server

    Stellman, Andrew

    2008-01-01

    Head First C# is a complete learning experience for object-oriented programming, C#, and the Visual Studio IDE. Built for your brain, this book covers C# 3.0 and Visual Studio 2008, and teaches everything from language fundamentals to advanced topics including garbage collection, extension methods, and double-buffered animation. You'll also master C#'s hottest and newest syntax, LINQ, for querying SQL databases, .NET collections, and XML documents. By the time you're through, you'll be a proficient C# programmer, designing and coding large-scale applications. Every few chapters you will come

  16. Using C-Kermit

    CERN Document Server

    da Cruz, Frank

    2014-01-01

    An introduction and tutorial as well as a comprehensive reference Using C-Kermit describes the new release, 5A, of Columbia University's popular C-Kermit communication software - the most portable of all communication software packages. Available at low cost on a variety of magnetic media from Columbia University,C-Kermit can be used on computers of all sizes - ranging from desktop workstations to minicomputers to mainframes and supercomputers. The numerous examples, illustrations, and tables in Using C-Kermit make the powerful and versatile C-Kermit functionsaccessible for new and experienced

  17. Vitamin C and Infections

    Directory of Open Access Journals (Sweden)

    Harri Hemilä

    2017-03-01

    Full Text Available In the early literature, vitamin C deficiency was associated with pneumonia. After its identification, a number of studies investigated the effects of vitamin C on diverse infections. A total of 148 animal studies indicated that vitamin C may alleviate or prevent infections caused by bacteria, viruses, and protozoa. The most extensively studied human infection is the common cold. Vitamin C administration does not decrease the average incidence of colds in the general population, yet it halved the number of colds in physically active people. Regularly administered vitamin C has shortened the duration of colds, indicating a biological effect. However, the role of vitamin C in common cold treatment is unclear. Two controlled trials found a statistically significant dose–response, for the duration of common cold symptoms, with up to 6–8 g/day of vitamin C. Thus, the negative findings of some therapeutic common cold studies might be explained by the low doses of 3–4 g/day of vitamin C. Three controlled trials found that vitamin C prevented pneumonia. Two controlled trials found a treatment benefit of vitamin C for pneumonia patients. One controlled trial reported treatment benefits for tetanus patients. The effects of vitamin C against infections should be investigated further.

  18. Perspective study: governance for C2C

    NARCIS (Netherlands)

    Hovelynck, J.; Dewulf, A.; Sips, K.

    2010-01-01

    This perspective study will serve as frame of reference for follow-up activities and exchanges both within and outside the Cradle to Cradle Network (C2CN) and it aims to reflect the current challenges and opportunities associated with implementing a Cradle to Cradle approach. In total, four

  19. Structural Phase Transformation (F. C. C. - B. C. C.) in F. C. C. Metals and Their Stability on the Path of Transformation

    Science.gov (United States)

    Öztekýn, Yasemin; Çolakoðlu, Kemal

    1997-08-01

    Because of its importance in Solid-State Physics, Metalurgy, Solid Mechanics and geophysics, theoretical strength calculations are performed to locate the stress-free b.c.c phase on three f.c.c metals (Ca, Pb, Ir). Internal energies correspponding to the unstresed b.c.c. and f.c.c. phase, and the required stress and energy changes for f.c.c.-b.c.c. transformation for these crystals are computed. To determine the range of stability (G stability), the Born criterion is used by calculating the values of deformation connecting the stress-free b.c.c. and stress-free f.c.c. phases of Ca, Pb and Ir. The studied crystals are subjected to unconstrained (100) uniaxial tension in all computations, and E.G.E.P. (Extended generalized exponantial potential) model is used to carry out these calculations.

  20. Dicty_cDB: CHL685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hlhhqalphlhlhhqallhlhlhhlhlhhlhlhhlqqlqlqlqlqlqlqlq lqlq Frame C: ---fnl*klclwflccfklclwfxxcfiftiixcc...klfsifxccklfsificcklfpifi ciiklfpxficiiklcpificiiklcsificiificiificiicsnyscnyncnyscnyn c

  1. Dicty_cDB: SHB736 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KRXVKKK--- ---NXRNEMDQLEXLLEENEEEQFSNKNXQXLNENENHQQQQGQQQVQATNVEQQIVEQL KVIKEFQRQDQQKKQKIQQENDAVIXE*c*xplxlnwmlnwiki...ENEEEQFSNKNXQXLNENENHQQQQGQQQVQATNVEQQIVEQL KVIKEFQRQDQQKKQKIQQENDAVIXE*c*xplxlnwmlnwikiinkrikmri*fkrn Homol

  2. Parylene C Aging Studies.

    Energy Technology Data Exchange (ETDEWEB)

    Achyuthan, Komandoor; Sawyer, Patricia Sue.; Mata, Guillermo Adrian; White II, Gregory Von; Bernstein, Robert

    2014-09-01

    Parylene C is used in a device because of its conformable deposition and other advantages. Techniques to study Parylene C aging were developed, and "lessons learned" that could be utilized for future studies are the result of this initial study. Differential Scanning Calorimetry yielded temperature ranges for Parylene C aging as well as post-deposition treatment. Post-deposition techniques are suggested to improve Parylene C performance. Sample preparation was critical to aging regimen. Short-term (%7E40 days) aging experiments with free standing and ceramic-supported Parylene C films highlighted "lessons learned" which stressed further investigations in order to refine sample preparation (film thickness, single sided uniform coating, machine versus laser cutting, annealing time, temperature) and testing issues ("necking") for robust accelerated aging of Parylene C.

  3. Programming C# 30

    CERN Document Server

    Liberty, Jesse

    2008-01-01

    This thoroughly updated tutorial for beginning to intermediate programmers covers C# 3.0 and the newest .NET platform for developing Windows and web applications. Now in its fifth edition, our bestselling Programming C# 3.0 teaches the essentials of the C# and the .NET Framework Class Libraries, and explains how to use these tools to create applications for Windows, as well as for the Web.

  4. Multidimensional $C^0$ transversality

    OpenAIRE

    2014-01-01

    In 1994, Sakai introduced the property of $C^0$ transversality for two smooth curves in a two-dimensional manifold. This property was related to various shadowing properties of dynamical systems. In this short note, we generalize this property to arbitrary continuous mappings of topological spaces into topological manifolds. We prove a sufficient condition for the $C^0$ transversality of two submanifolds of a topological manifold and a necessary condition of $C^0$ transversality for mappings ...

  5. Properties of c meson

    Indian Academy of Sciences (India)

    Ajay Kumar Rai; P C Vinodkumar

    2006-05-01

    The mass spectrum of $c\\bar{b}$ meson is investigated with an effective quark-antiquark potential of the form $\\dfrac{-_{c}}{r} + Ar^{}$ with varying from 0.5 to 2.0. The and -wave masses, pseudoscalar decay constant, weak decay partial widths in spectator model and the lifetime of c meson are computed. The properties calculated here are found to be in good agreement with other theoretical and experimental values at potential index, = 1.

  6. Cryptanalysis of C2

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Leander, Gregor;

    2009-01-01

    We present several attacks on the block cipher C2, which is used for encrypting DVD Audio discs and Secure Digital cards. C2 has a 56 bit key and a secret 8 to 8 bit S-box. We show that if the attacker is allowed to choose the key, the S-box can be recovered in 2^24 C2 encryptions. Attacking the ...

  7. Seminario C++, parte 3

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2007-01-01

    Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Funciones amigas. Entrada / Salida. Sobrecarga de funciones y operadores. Gestión de memoria dinámica. Atributos y métodos de clase. Implementación de relaciones entre objetos.

  8. C# Database Basics

    CERN Document Server

    Schmalz, Michael

    2012-01-01

    Working with data and databases in C# certainly can be daunting if you're coming from VB6, VBA, or Access. With this hands-on guide, you'll shorten the learning curve considerably as you master accessing, adding, updating, and deleting data with C#-basic skills you need if you intend to program with this language. No previous knowledge of C# is necessary. By following the examples in this book, you'll learn how to tackle several database tasks in C#, such as working with SQL Server, building data entry forms, and using data in a web service. The book's code samples will help you get started

  9. C++ for dummies

    CERN Document Server

    Davis, Stephen Randy

    2009-01-01

    Enter the world of computer programming with this step-by-step guide to the C++ language! C++ is a great introduction to object-oriented programming, and this friendly guide covers everything you need to know and nothing you don't. You'll write your first program by the end of Chapter 1. C++ For Dummies, 6th Edition, helps you understand C++ programming from the ground up. It's full of examples to show you how things work, and it even explains "why", so you understand how the pieces fit together. And the bonus CD includes a special code editor, an update GNU compiler, and all source code from

  10. Programming C# 40

    CERN Document Server

    Griffiths, Ian; Liberty, Jesse

    2010-01-01

    With its support for dynamic programming, C# 4.0 continues to evolve as a versatile language on its own. But when C# is used with .NET Framework 4, the combination is incredibly powerful. This bestselling tutorial shows you how to build web, desktop, and rich Internet applications using C# 4.0 with .NET's database capabilities, UI framework (WPF), extensive communication services (WCF), and more. In this sixth edition, .NET experts Ian Griffiths, Matthew Adams, and Jesse Liberty cover the latest enhancements to C#, as well as the fundamentals of both the language and framework. You'll learn

  11. A PCR-RFLP assay for the detection and differentiation of Campylobacter jejuni, C. coli, C. fetus, C. hyointestinalis, C. lari, C. helveticus and C. upsaliensis.

    Science.gov (United States)

    Kamei, Kazumasa; Asakura, Masahiro; Somroop, Srinuan; Hatanaka, Noritoshi; Hinenoya, Atsushi; Nagita, Akira; Misawa, Naoaki; Matsuda, Motoo; Nakagawa, Shinsaku; Yamasaki, Shinji

    2014-05-01

    Although Campylobacter jejuni and Campylobacter coli are the most common bacterial causes of human gastrointestinal diseases, other Campylobacter species are also involved in human and animal infections. In this study, we developed a cytolethal distending toxin (cdt) gene-based PCR-RFLP assay for the detection and differentiation of C. jejuni, C. coli, C. fetus, C. hyointestinalis, C. lari, C. helveticus and C. upsaliensis. Previously designed common primers, which can amplify the cdtB gene of C. jejuni, C. coli and C. fetus, were used for detecting seven Campylobacter species and differentiating between them by restriction digestion. The PCR-RFLP assay was validated with 277 strains, including 35 C. jejuni, 19 C. coli, 20 C. fetus, 24 C. hyointestinalis, 13 C. lari, 2 C. helveticus, 22 C. upsaliensis, 3 other Campylobacter spp. and 17 other species associated with human diseases. Sensitivity and specificity of the PCR-RFLP assay were 100 % except for C. hyointestinalis (88 % sensitivity). Furthermore, the PCR-RFLP assay successfully detected and differentiated C. jejuni, C. coli and C. fetus in clinical and animal samples. The results indicate that the PCR-RFLP assay is useful for the detection and differentiation of seven Campylobacter species important for human and animal diseases.

  12. Learning Boost C++ libraries

    CERN Document Server

    Mukherjee, Arindam

    2015-01-01

    If you are a C++ programmer who has never used Boost libraries before, this book will get you up-to-speed with using them. Whether you are developing new C++ software or maintaining existing code written using Boost libraries, this hands-on introduction will help you decide on the right library and techniques to solve your practical programming problems.

  13. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas;

    , and iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during...

  14. C. diff compensation

    National Research Council Canada - National Science Library

    Eggertson, Laura

    2004-01-01

    ... [in hospitals] must be upgraded," says Montreal lawyer Jean-Pierre Menard, who is preparing lawsuits for some of the victims of the recent C. difficile outbreak in Montreal and Sherbrooke hospitals. In the last 18 months, 100 patients in Sherbrooke and at least 79 in Montreal-area hospitals died after contracting C. difficile....

  15. Deformation of C isotopes

    CERN Document Server

    Kanada-Enyo, Y

    2004-01-01

    Systematic analysis of the deformations of proton and neutron densities in even-even C isotopes was done based on the method of antisymmetrized molecular dynamics. The $E2$ transition strength was discussed in relation to the deformation. We analyze the $B(E2;2^+_1\\to 0^+_1)$ in $^{16}$C, which has been recently measured to be abnormally small. The results suggest the difference of the deformations between proton and neutron densities in the neutron-rich C isotopes. It was found that stable proton structure in C isotopes plays an important role in the enhancement the neutron skin structure as well as in the systematics of $B(E2)$ in the neutron-rich C.

  16. Thermoelectric properties of porous SiC/C composites

    NARCIS (Netherlands)

    Fujisawa, Masashi; Hata, Toshimitsu; Kitagawa, Hiroyuki; Bronsveld, Paul; Suzuki, Youki; Hasezaki, Kazuhiro; Noda, Yasutoshi; Imamura, Yuji

    2008-01-01

    We developed a porous SiC/C composite by oxidizing a SiC/C composite made from a mixed powder of wood charcoal and SiO2 (32-45 mu m) by pulse current sintering at 1600 and 1800 degrees C under a N-2 atmosphere. The microstructures of the porous SiC/C composites with oxidation and the SiC/C composite

  17. Dicty_cDB: SSA702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kv*kknkk**kikkk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*rc sssilrvnpshsyatlsnv*AVFNKKKYLKK--- ---SMYRYCSVC... Frame C: kv*kknkk**kikkk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*rc sssilrvnpshsyatlsnv*AVFNKKKYLKK--- --

  18. Practical C programming

    CERN Document Server

    Oualline, Steve

    1997-01-01

    There are lots of introductory C books, but this is the first one that has the no-nonsense, practical approach that has made Nutshell Handbooks® famous. C programming is more than just getting the syntax right. Style and debugging also play a tremendous part in creating programs that run well and are easy to maintain. This book teaches you not only the mechanics of programming, but also describes how to create programs that are easy to read, debug, and update. Practical rules are stressed. For example, there are fifteen precedence rules in C (&& comes before || comes before ?:). The practi

  19. Head first C#

    CERN Document Server

    Stellman, Andrew

    2010-01-01

    You want to learn C# programming, but you're not sure you want to suffer through another tedious technical book. You're in luck: Head First C# introduces this language in a fun, visual way. You'll quickly learn everything from creating your first program to learning sophisticated coding skills with C# 4.0, Visual Studio 2010 and .NET 4, while avoiding common errors that frustrate many students. The second edition offers several hands-on labs along the way to help you build and test programs using skills you've learned up to that point. In the final lab, you'll put everything together. From o

  20. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit

    2007-01-01

    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  1. C++ multithreading cookbook

    CERN Document Server

    Ljumovic, Milos

    2014-01-01

    The book is an easy-to-follow guide for creating multi-threaded applications using C++. Each topic is thoroughly explained with multiple illustrations. Many algorithms, such as Dinning Philosophers Problem give you thorough explanations that will help you to understand and solve concurrent tasks. The book is intended for enterprise developers and programmers who wish to make use of C++ capabilities to learn the multithreaded approach. Knowledge of multithreading along with experience in C++ is an added advantage. However it is not a prerequisite.

  2. Dicty_cDB: VSD473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vcvikgekvngvvkftqenkdspvtvnyditglekgehgfhvhafgd ttngcvsagphfnpfgknhgapsdedrhvgdlgnivadgesntkgtisdkiislfgeh...rame C: eqqqinnkmsktavcvikgekvngvvkftqenkdspvtvnyditglekgehgfhvhafgd ttngcvsagphfnpfgknhgapsdedrhvgdlgnivadgesntkgtisdkiislfgeht

  3. LOADING SIMULATION PROGRAM C

    Data.gov (United States)

    U.S. Environmental Protection Agency — LSPC is the Loading Simulation Program in C++, a watershed modeling system that includes streamlined Hydrologic Simulation Program Fortran (HSPF) algorithms for...

  4. C-FERST

    Science.gov (United States)

    The Community-Focused Exposure and Risk Screening Tool (C-FERST) is an online tool which provides access to resources that can help communities learn more about their environmental issues, and explore exposure and risk reduction options.

  5. Introduction to C

    DEFF Research Database (Denmark)

    Albertsen, Niels Christian

    2006-01-01

    The principles of C are very much like those of PASCAL, although the syntax differs slightly. The programs are entered in free format, which the programmer may utilise to make the text reader-friendly, and every sentence is ended with a semicolon. Comments can be entered at any point by enclosing...... them in /* and */. e.g.: /* a comment */. Note that the C compiler is case sensitive. A C program may consist of several program segments. One of them must be the main program, the rest are denoted functions. In contrast to PASCAL the concept procedure does not exist. Every segment starts with a number...... this extra complication, we will in the following consider only C programs contained in a single file....

  6. Beginning Objective-C

    CERN Document Server

    Dovey, James

    2012-01-01

    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  7. Parallelization in Modern C++

    CERN Document Server

    CERN. Geneva

    2016-01-01

    The traditionally used and well established parallel programming models OpenMP and MPI are both targeting lower level parallelism and are meant to be as language agnostic as possible. For a long time, those models were the only widely available portable options for developing parallel C++ applications beyond using plain threads. This has strongly limited the optimization capabilities of compilers, has inhibited extensibility and genericity, and has restricted the use of those models together with other, modern higher level abstractions introduced by the C++11 and C++14 standards. The recent revival of interest in the industry and wider community for the C++ language has also spurred a remarkable amount of standardization proposals and technical specifications being developed. Those efforts however have so far failed to build a vision on how to seamlessly integrate various types of parallelism, such as iterative parallel execution, task-based parallelism, asynchronous many-task execution flows, continuation s...

  8. C-CURE

    Data.gov (United States)

    US Agency for International Development — C-CURE system manages certain aspects of the access control system, including collecting employee and contractor names and photographs. The Office of Security uses...

  9. C-section - slideshow

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/presentations/100191.htm C-section - series—Normal anatomy To use the sharing features ... M. Editorial team. Related MedlinePlus Health Topics Cesarean Section A.D.A.M., Inc. is accredited by ...

  10. D and C

    Science.gov (United States)

    Dilatation and curettage; Uterus scraping; Vaginal bleeding - dilation; Uterine bleeding - dilation; Menopause - dilation ... D and C, also called uterine scraping, may be performed in the ... are under general or local anesthesia. The health care provider ...

  11. Hepatitis C - children

    Science.gov (United States)

    ... sexual contact with a person with HCV Getting tattoos or acupuncture therapy with infected needles Hepatitis C ... for chronic HCV. These medicines: Have fewer side effects Are easier to take Are taken by mouth ...

  12. Hepatitis C and sex.

    Science.gov (United States)

    Page, Emma E; Nelson, Mark

    2016-04-01

    An outbreak of acute hepatitis C among HIV-positive men who have sex with men (MSM) in the last decade has been shown to be sexually transmitted. Initially recreational drug use, in particular drug injection, was not prevalent among those becoming infected with hepatitis C. However more recently chemsex (the use of drugs to enhance sexual experience) and its associated drugs, which are not uncommonly injected, have become more frequently reported among those diagnosed with hepatitis C. It is hoped that the widespread -introduction of direct-acting antivirals and upscaling of numbers treated may have a positive impact on this epidemic. However their introduction may negatively impact on the perceived risk of acquiring hepatitis C and in conjunction with the introduction of HIV transmission prevention strategies may result in increased transmissions and spread to the HIV-negative MSM population.

  13. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas

    The aim of the development of a forest soil carbon simulation model was to demonstrate the slow, but yet dynamic character of the forest soil C balance. We explored the sensitivity of total forest soil carbon stocks (forest floor + 0-100 cm) to litter inputs, tree root litter distributions......, and iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during...... manually in the spreadsheet to fit observed change (18 years between 1990 and 2008-10) in C concentration in each of the six layers. The cases represent classes of subsoil texture and topsoil carbon content from the SINKS resampling study (1990 and 2008-10). The sensitivity of SOC stocks to the uncertainty...

  14. Dicty_cDB: SSM514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clsppllcitllklr*srapltmllkypqg*sitflcnslkcissl*QKKI FKKKKKRKKKNIKIFFLKSILNINNNVFFFFIKKRKKKRKKKKKRKKEFKKKK Frame C: ---ls*c*gvslplcfal...lssssdnlelh*rcsssilrvnpshsyatlsnv*avfnkkky lkkkkkekkkilk

  15. Dicty_cDB: SFF811 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HILQIHSRKMNVSADVNFDELARSSEDFNGAQLKAVCVEAXXLH Frame C: ---lvpxvsivrlvviercnvqc*sys...inwmvsvvmqisklspppivliswills*dlvv wierlxshyqmkrlelisfkftlvr*tfplmlismswhvplkismaln*kqfvskxvxct Homology vs C

  16. H.C. Andersen

    DEFF Research Database (Denmark)

    Nissen, Mogens Rostgaard

    2008-01-01

    "Mit Liv er et smukt Eventyr, saa rigt og lyksaligt!" Sådan beskrev H.C. Andersens sit eget liv. Det overgik næsten indholdet af hans egne eventyr. Født i fattigdom og social nød, men kæmpede sig op og døde berømt og feteret 70 år senere. H.C. Andersen er Danmarks bedst kendte forfatter. Især hans...

  17. Stop C. difficile Infections

    Centers for Disease Control (CDC) Podcasts

    2012-03-06

    This podcast is based on the March 2012 CDC Vital Signs report. C. difficile is a germ that causes diarrhea linked to 14,000 deaths in the US each year. This podcast helps health care professionals learn how to prevent C. difficile infections.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  18. [C4 type photosynthesis].

    Science.gov (United States)

    Drozak, Anna; Wasilewska, Wioleta; Buczyńska, Alicja; Romanowska, Elzbieta

    2012-01-01

    C4 photosynthesis includes several anatomical and biochemical modifications that allow plants to concentrate CO2 at the site of Rubisco. The photorespiratory pathway is repressed in C4 plants, since the rates of photosynthesis and biomass production are increased. This is an adaptation to high light intensities, high temperatures and dryness. C4 plants contain two distinct types of photosynthetic cells, mesophyll and bundle sheath. The processes of assimilation and reduction of CO2 are separated spatiality and catayzed by two different enzymes. Only the bundle sheath chloroplasts perform the reactions of the Calvin-Benson cycle with the help of the Rubisco enzyme present exclusively in this cell type. The primary CO2 fixation occurs in mesophyll cells through the action of the phosphoenolpyruvate carboxylase. The light-dependent reactions of the photosynthesis occur exclusively in the latter cell type. These differences in photochemistry lead to distinct redox profiles in both types of cells. C4 plants are divided into three biochemical subtypes on the basis of differences in the mechanisms of decarboxylation of the C4 acids. C4 plants will provide the main source of food for humans and animals in the nearest decade.

  19. C2 Agility

    DEFF Research Database (Denmark)

    Mitchell, Dr. William; Alberts, David S.; Bernier, Francois

    Agility is the capability to successfully effect, cope with, and/or exploit changes in circumstances. While other factors will also influence outcomes, C2 Agility enables entities to effectively and efficiently employ the resources they have in a timely manner in a variety of missions and circums......Agility is the capability to successfully effect, cope with, and/or exploit changes in circumstances. While other factors will also influence outcomes, C2 Agility enables entities to effectively and efficiently employ the resources they have in a timely manner in a variety of missions...... and circumstances. SAS-085 was formed to improve the understanding of C2 Agility and assess its importance to NATO. SAS-085 accomplished these objectives by articulating the principles of C2 Agility, in the form of a C2 Agility Conceptual Model, substantially validating this model and establishing the importance...... of improving C2 Agility with empirical evidence obtained from a set of retrospective case studies and simulation-based experiments. Further, it identified next steps toward practical implementation in NATO operations and priorities for increasing the rigor and practicality of methods for measuring...

  20. Registration of CA0469C025C chickpea germplasm

    Science.gov (United States)

    Chickpea (Cicer arientinum L.) germplasm CA0469C025C (Reg. No. XXX; PI XXX), was released by the USDA-ARS in 2010. CA0469C025C was released based on its improved yield and reaction to Ascochyta blight relative to the popular commercial cultivars ‘Dwelley’, ‘Sierra’, and ‘Sawyer’. CA0490C025C is deri...

  1. Dicty_cDB: SFL120 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...E800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR...|AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to ...1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O65744 GDP DISSOC...IATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  2. Dicty_cDB: SSB187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3346.1 sm70g01.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-9289 5' similar to TR:Q4...m-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-1456 5' similar to TR:Q40203 Q40203 RAB1C. ...;, mRNA sequence. 50 4e-14 3 BG047357 |BG047357.1 saa83d10.y1 Gm-c1063 Glycine max cDNA clone GENOME SYSTEMS...m-c1086 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1431 5' similar ... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1041-929 5' similar to TR:Q40203 Q40203 RAB1C. ;, mRNA sequence

  3. Dicty_cDB: AFH224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficant alignments: (bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS... CLONEINHIBITOR. ;, mRNA sequence. 56 5e-06 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS... BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS C... 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5'...04 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212

  4. Dicty_cDB: CFH888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c10...800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:...AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to T...078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O65744 GDP DISSOCI...ATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  5. Dicty_cDB: VFD504 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW703806.1 sk13a02.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-3939 5' similar to ...9.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-2802 5' similar to SW:ASPR_CUCPE O040... 1.9 1 BG404959 |BG404959.1 sac46c02.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1062-28

  6. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    J.C. Christensen var kun regeringsleder i tre år, men i en lille menneskealder kunne stort set intet ske i dansk politik uden om ham. I et kvart århundrede var han et magtcentrum. Centralt i J.C. Christensens politiske virke i årene 1890-1924 stod kampen for det parlamentariske folkestyre....... Parlamentarismen har lige siden udgjort fundamentet for vores styreform, og dens fortsatte betydning og grundlovsfæstede status gør den til den betydeligste arv, J.C. Christensen har efterladt sig. Men hvem var J.C. Christensen egentlig? Han satte sit afgørende fingeraftryk på indførelsen af kvindelig valgret......, stiftelsen af Det Radikale Venstre og Venstre, tilblivelsen af det norske kongehus, Albertiaffæren, salget af De Vestindiske Øer, Påskekrisen og genforeningen med Sønderjylland. Nu har J.C. Christensens efterkommere for første gang givet adgang til hans efterladte dagbøger og breve. Det har gjort det muligt...

  7. Dicty_cDB: VFC328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W705505 |AW705505.1 sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mR...NA sequence. 46 0.40 1 AI900122 |AI900122.1 sc01b07.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ...2.1 sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-6285 5', mRNA sequence. 46 ...0.40 1 AW705268 |AW705268.1 sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS... Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA

  8. Dicty_cDB: CHE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available f75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 ... sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O...HIBITOR. ;, mRNA sequence. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS.... 62 8e-06 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...ce. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-

  9. Dicty_cDB: AFI337 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O6...4 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 GDI2. ;, mRNA...ion inhibitor (gdi). 38 9e-06 3 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...05 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 ... sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-262

  10. Dicty_cDB: SFI510 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i). 38 3e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...uence. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...9 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:... |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar t...Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar

  11. Dicty_cDB: AFI273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r (gdi). 38 9e-10 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...A sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ...RNA sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLON...15670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' simi...9.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' si

  12. Dicty_cDB: CHD702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:INHIBITOR. ;, mRNA sequence. 54 0.002 1 AW397479 |AW3...97479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...I315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to T...c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to...06227 |AW306227.1 se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' simil

  13. Curiosities at c = -2

    CERN Document Server

    Kausch, H G

    1995-01-01

    Conformal field theory at c=-2 provides the simplest example of a theory with ``logarithmic'' operators. We examine in detail the (\\xi,\\eta) ghost system and Coulomb gas construction at c=-2 and show that, in contradistinction to minimal models, they can not be described in terms of conformal families of {\\em primary\\/} fields alone but necessarily contain reducible but indecomposable representations of the Virasoro algebra. We then present a construction of ``logarithmic'' operators in terms of ``symplectic'' fermions displaying a global SL(2) symmetry. Orbifolds with respect to finite subgroups of SL(2) are reminiscent of the ADE classification of c=1 modular invariant partition functions, but are isolated models and not linked by massless flows.

  14. Amino acid sequences of bacterial cytochromes c' and c-556.

    OpenAIRE

    Ambler, R. P.; Bartsch, R. G.; Daniel, M.; Kamen, M. D.; McLellan, L; Meyer, T. E.; Van Beeumen, J

    1981-01-01

    The cytochrome c' are electron transport proteins widely distributed in photosynthetic and aerobic bacteria. We report the amino acid sequences of the proteins from 12 different bacterial species, and we show by sequences that the cytochromes c-556 from 2 different bacteria are structurally related to the cytochromes c'. Unlike the mitochondrial cytochromes c, the heme binding site in the cytochromes c' and c-556 is near the COOH terminus. The cytochromes c-556 probably have a methionine sixt...

  15. Dicty_cDB: VHJ558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ificant alignments: (bits) Value N ( BJ442636 ) Dictyostelium discoideum cDNA clone:ddv50c15, 3' ... 1296 0.... ) Dictyostelium discoideum cDNA clone:ddv50k22, 3' ... 1219 0.0 2 ( BJ441840 ) Dictyostelium discoideum cDN...deum cDNA clone:dda54e23, 3' ... 1211 0.0 2 ( BJ423817 ) Dictyostelium discoideum cDNA clone:ddv50c15, 5' ..

  16. Dicty_cDB: VFG375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SToab47d06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:NO50_CAEEL ...02.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' simila...|BU498441.1 PfESToab97c06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to

  17. Dicty_cDB: VSE884 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone PP095G12 similar to RAS RELATED PROTEIN RAB7. 68 6e-08 1 AW290476 |AW290476.1 NXNV027C10F Nsf Xylem Normal wood Vertical...27C10 Nsf Xylem Normal wood Vertical Pinus taeda cDNA clone NXNV027C10 5' similar... |CD018114.1 NXLV_002_C09_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV_002_C09 5' simil

  18. Hepatitis C pada Anak

    Directory of Open Access Journals (Sweden)

    Yusri Dianne Jurnalis

    2014-05-01

    Full Text Available AbstrakInfeksi virus hepatitis C saat ini masih merupakan persoalan yang serius. Penularan infeksi HCV pada anak yang utama adalah melalui transfusi darah atau produk darah yang saat ini bertanggung jawab menyebabkan kasus hepatitis C kronis. Selain itu infeksi HCV pada anak dapat disebabkan oleh transmisi perinatal (vertikal. Infeksi HCV akut dapat berakhir dengan sirosis dan karsinoma hepatoselular setelah dekade ketiga (sekitar 20%, karena progresivitas infeksi HCV lebih lambat dari infeksi hepatitis B virus. Pada umumnya infeksi HCV bersifat asimptomatik termasuk pada anak. Karena tidak ada gejala yang jelas pada infeksi HCV tersebut maka diagnosis infeksi HCV hanya dapat ditegakkan dengan pemeriksaan awal laboratorium dan uji serologi, dan bila perlu dengan uji molekuler pada pasien dengan risiko tinggi. Kebijakan kuratif khusus terhadap HCV adalah terapi antivirus berupa interferon dan ribavirin yang diberikan bila diagnosis HCV sudah ditegakkanKata kunci: Hepatitis C, diagnosis and management problem, childrenAbstractHepatitis C virus infection is still a serious problem. Transmission of HCV infection in children is a major blood transfusion or blood products that are currently responsible for causing chronic hepatitis C cases. Additionally HCV infection in children can be caused by perinatal transmission (vertical. Acute HCV infection may end up with cirrhosis and hepatocellular carcinoma after the third decade (around 20%, due to a slower progression of HCV infection of hepatitis B virus infection. In most cases of HCV infection are asymptomatic, including in children. Since there are no obvious symptoms in the diagnosis of HCV infection HCV infection can only be confirmed by laboratory examinations and serologic testing early, and if necessary with molecular testing in patients at high risk. Curative policy is specific to HCV antiviral therapy such as interferon and ribavirin are given when the diagnosis of HCV has been established

  19. Hepatitis C in India

    Indian Academy of Sciences (India)

    Ashis Mukhopadhya

    2008-11-01

    Hepatitis C is an emerging infection in India and an important pathogen causing liver disease in India. The high risk of chronicity of this blood-borne infection and its association with hepatocellular carcinoma underscores its public health importance. Blood transfusion and unsafe therapeutic interventions by infected needles are two preventable modalities of spread of hepatitis C infection. In addition, risk factor modification by reducing the number of intravenous drug users will help curtail the prevalence of this infection. This review summarizes the extent, nature and implications of this relatively new pathogen in causing disease in India.

  20. Themenheft 15 "Hepatitis C"

    OpenAIRE

    Schreier, Eckart; Radun, Doris; Neuhauser, Hannelore; Stark, Klaus

    2003-01-01

    Die Hepatitis C, die durch ein auf dem Blutweg übertragenes Virus verursacht wird, hat weltweit eine große medizinische, epidemiologische und gesundheitsökonomische Bedeutung. Die Infektion mit dem Hepatitis-C-Virus (HCV) verläuft in 60 bis 80 Prozent der Fälle chronisch und kann zu schwerwiegenden Folgeerkrankungen wie Leberzirrhose und Leberzellkarzinom führen. In Deutschland leben schätzungsweise 400.000 bis 500.000 Menschen mit einer chronischen HCV-Infektion.

  1. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M

    2010-01-01

    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  2. Practical C++ financial programming

    CERN Document Server

    Oliveira, Carlos

    2015-01-01

    Practical C++ Financial Programming is a hands-on book for programmers wanting to apply C++ to programming problems in the financial industry. The book explains those aspects of the language that are more frequently used in writing financial software, including the STL, templates, and various numerical libraries. The book also describes many of the important problems in financial engineering that are part of the day-to-day work of financial programmers in large investment banks and hedge funds. The author has extensive experience in the New York City financial industry that is now distilled in

  3. Dicty_cDB: SSD420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TOR. ;, mRNA sequence. 62 5e-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...79.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007...0797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O6...64 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR...IBITOR. ;, mRNA sequence. 44 1e-05 3 BI426472 |BI426472.1 sag03f09.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS

  4. Dicty_cDB: SFJ116 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 62 1e-05 1 AI437629 |AI437629.1 sa37e...09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 ...R. ;, mRNA sequence. 62 1e-05 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...e-05 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS... 1e-05 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-

  5. Dicty_cDB: SSL425 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-888 5' similar t...42 3e-05 2 BM094849 |BM094849.1 saj22d08.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS...11983 |BE611983.1 sr02d07.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1478 5' simil...16219 |BI316219.1 saf62g05.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLON...5.1 sah72f05.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-4089 5' similar to TR:Q402

  6. Dicty_cDB: SFL479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O657...4653 GDI2. ;, mRNA sequence. 62 5e-08 2 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...nce. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...uence. 62 5e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O2

  7. Dicty_cDB: SFH229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nd,single read. 1013 0.0 1 AW395348 |AW395348.1 sh46h12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS...27021.1 sae30b10.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-4292 5' similar to TR:...6 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1086-1674 5' similar to TR:...Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1080-173 5' similar to TR:Q9XHH0 Q9XHH0 ACETOAC...-c1056 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1056-1716 5' similar to TR:Q9XHH0 Q9XHH0 ACETOACE

  8. Dicty_cDB: AFI123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE...INHIBITOR. ;, mRNA sequence. 62 1e-05 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm... |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to...Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar

  9. Dicty_cDB: SFD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 90353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:...049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to T...c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSO...TION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  10. Dicty_cDB: AFN814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence. 38 3e-08 4 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:...sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317...1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-51... BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5'

  11. Dicty_cDB: SFA692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , mRNA sequence. 36 0.013 2 BI320995 |BI320995.1 saf23h06.y3 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS ...42d11.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1062-2494 5...m-c1018 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1018-391 5' similar to TR:O74224 O74224 SONA. ;,... mRNA sequence. 48 0.063 1 BI894072 |BI894072.1 sai59g03.y1 Gm-c1068 Glycine max cDNA clone GENOME SYSTEMS C...uence. 48 0.063 1 BE191388 |BE191388.1 sn71h11.y1 Gm-c1038 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G

  12. Dicty_cDB: CHB577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS... INHIBITOR. ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...nce. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...|AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to

  13. Dicty_cDB: AFE576 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar....1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...35.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9Z...e chromosome IV reading frame ORF YDL084w. 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  14. Dicty_cDB: CHQ518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-7762 5' similar to TR:Q9XEU0 Q9XEU0 ZINC-FI...66 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-1230 5' similar to TR:Q9XEU0 Q9XEU0 ZINC-FINGER ...sequence. 42 5.5 1 BE023156 |BE023156.1 sm79a08.y1 Gm-c1015 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: ...U090925 |BU090925.1 su09e03.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-990 5' simi...-c1066 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-1066 5' similar t

  15. Dicty_cDB: CFC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' sim...12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 ...9d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O6574...cima018l21, 5'end, single read. 46 7e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...quence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  16. Dicty_cDB: VSB739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI320483 |BI320483.1 sah56b01.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' ... sh92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-759...111.1 sh40a06.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar to TR:O49

  17. Dicty_cDB: SFL383 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 st5...9b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS06...4435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q

  18. Dicty_cDB: CHD833 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 ...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9Z...I974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' si

  19. D and C - slideshow

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/presentations/100013.htm D and C - series—Normal anatomy To use the ... MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Editorial team. Related MedlinePlus Health Topics ...

  20. Hepatitis C and HIV

    Science.gov (United States)

    ... Hepatitis A and Hepatitis B . Hepatitis C and HIV About 25% of people living with HIV in ... Notice Network blog.aids.gov • locator.aids.gov • HIV/AIDS Service Locator Locator Widgets • Instructions • API Find ...

  1. Fundamentals of C

    CERN Document Server

    Guruprasad, N

    2009-01-01

    The book presents a contemporary approach to programming. Complte C programs are presented as and when it is required. This Book is not a cookbook . To get the maximum benefit from this book, you should take as active a role as possible. Don`t just read the examples. Enter it into your system and try them out.

  2. J.C. Christensen

    DEFF Research Database (Denmark)

    Duedahl, Poul

    I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....

  3. Dicty_cDB: SHF821 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cloneUI-D-GC1-aau-c-07-0-UI 3', mRNA sequence. 30 0.007 3 DT338982 |DT338982.1 JBW092C02.b_012.abi Pineapp...le week 5-10 nematode-infected gall cDNA library Ananas comosus cDNA clone JBW092C0

  4. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  5. Dicty_cDB: CHQ862 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fiiiikfiifytinefnsmwwwlwkwr itrwswwscwwcscwywcnhwfcftrsrfhfnwrfkqlwl*lklqt*IIIKILNQPKIKP NFLICKIKKK--- ---KN...n*nikptk nktqffn Frame C: kqtnk*y*iiikndnlrfnlinw*c*vnykik*fiiiikfiifytinefnsmwwwlwkwr itrwswwscwwcscwywcnhwfcftr...c*vnykik*fiiiikfiifytinefnsmwwwlw kwritrwswwscwwcscwywcnhwfcftrsrfhfnwrfkqlwl*lklqt*iiikilnqpk ikpnfli Homol

  6. Dicty_cDB: CFH741 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yellr*rsmyinrmr*wrmyi*vdlwirrfiiwccrfiiwccrfii*c y*ffryyy*ffirypntntitfpstitfpn*y...iqki* ikivyivki*vay*lvkvv Frame C: ---*ywfwmy*ftykl**wklly*rll*sniwmftyrncklh*mfrnrlyncspmfpsnm *qfk**plcc*c

  7. Dicty_cDB: SLI621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G DRAFT SEQUENCE, 9 unordered pieces. 58 5e-08 4 AW201445 |AW201445.1 sf03c02.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3045 5' similar to SW:ERF1_ARATH P35614 ...y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-2790 5' similar to SW:ERF1_ARATH P35614...1 AW831104 |AW831104.1 sm08g04.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-8335 5'

  8. Dicty_cDB: VSK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N BE608288 |BE608288.1 sq27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE I....y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9XFY7 Q9XFY7 PU...cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' similar to WP:D1005....uence. 50 2e-06 2 AW704694 |AW704694.1 sk39d02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G... 50 3e-06 2 AW317457 |AW317457.1 sg50a11.y1 Gm-c1025 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c102

  9. Dicty_cDB: SFJ186 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONEINHIBITOR. ;, mRNA sequence. 56 6...e-04 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...97.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O657...Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O6...7 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' similar to TR:O65744 O65744 GDP DISSOCIAT

  10. Dicty_cDB: AFN644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 71471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE...9.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS0...435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c10...ae chromosome IV reading frame ORF YDL084w. 42 3e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  11. Dicty_cDB: AFB707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS...y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06 Q9ZS06 RNA...10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06 Q9ZS06 ...e IV reading frame ORF YDL084w. 42 7e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  12. Dicty_cDB: AFJ131 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available I437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' sim...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653 O24653 GDI2. ;, mRNA seque...ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION INH...IBITOR. ;, mRNA sequence. 62 1e-05 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...e max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O

  13. Dicty_cDB: AFN656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...ence. 56 7e-04 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...m-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DIS... Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 GDP D...ISSOCIATION INHIBITOR. ;, mRNA sequence. 56 7e-04 1 BI972870 |BI972870.1 sai84a09.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  14. Dicty_cDB: AFH664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 O657...ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION INH...TOR. ;, mRNA sequence. 62 3e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...2 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS... max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O6

  15. Dicty_cDB: CFH515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 O65744 GDP DISS...OCIATION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...SSOCIATION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...A sequence. 62 4e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE...I437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLO

  16. Dicty_cDB: AFE889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744 O65744 GDP DISSOCIATION I...NHIBITOR. ;, mRNA sequence. 62 5e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...e. 62 5e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS.... 62 6e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...I437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-

  17. Dicty_cDB: SSD524 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence update 1997.10.13 Translated Amino Acid sequence ---lsffkyhahslflk*c*fri*ifqmmpi...ssncgktnnkikknnkkkkkkif**lk** kkkiiik*flfyf Frame C: ---lsffkyhahslflk*c*fri*ifqmmpiniqlf*YQFILSNSXQFVLAFLLI

  18. Dicty_cDB: SLI174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ssapssasssapsssasssaassaassessesssa ts*ikl*s Homology vs CSM-cDNA Score E Sequences producing significant al...lis hfinktli Frame C: hasattaastiattastvatttsattagtttggtttggstsdssaassadssaassspss saassaassepsssaasssapssas

  19. Dicty_cDB: SLC739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sapssasssapsssasssa assaassessesssats*ikl*skkkk Homology vs CSM-cDNA Score E Sequences producing significant...fk*csilcfk*rsilclk*csiiisfkfs ciiscklrklrklishfinktlikkkk Frame C: ---adssaassspsssaassaassepsssaasssapssass

  20. Complement C3c as a Biomarker in Heart Failure

    Directory of Open Access Journals (Sweden)

    A. Frey

    2013-01-01

    Full Text Available Introduction. Experimental data indicates an important role of the innate immune system in cardiac remodeling and heart failure (HF. Complement is a central effector pathway of the innate immune system. Animals lacking parts of the complement system are protected from adverse remodeling. Based on these data, we hypothesized that peripheral complement levels could be a good marker for adverse remodeling and prognosis in patients with HF. Methods and Results. Since complement activation converges on the complement factor C3, we measured serum C3c, a stable C3-conversion product, in 197 patients with stable systolic HF. Subgroups with normal and elevated C3c levels were compared. C3c levels were elevated in 17% of the cohort. Patients with elevated C3c levels exhibited a trend to better survival, slightly higher LVEF, and lower NTpro-BNP values in comparison to patients with normal C3c values. No differences were found regarding NYHA functional class. Significantly more patients with elevated C3c had preexisting diabetes. The prevalence of CAD, arterial hypertension, and atrial fibrillation was not increased in patients with elevated C3c. Conclusion. Elevated C3c levels are associated with less adverse remodeling and improved survival in patients with stable systolic heart failure.

  1. Dicty_cDB: AFF396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone ...cTOD1C15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon ... |AW219042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA c...1.1 EST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15

  2. Dicty_cDB: SSK263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequen...ce. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycoper...4 tomato root during/after fruit set, Cornell University Lycopersicon esculentum ...flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' end, mRNA sequence... pennellii cDNA clone cLPP8K18 5' sequence, mRNA sequence. 92 3e-15 2 BG642411 |BG642411.1 EST355887 tomato

  3. Dicty_cDB: VFC392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 17896.1 EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C...15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon escule...9042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone c...T355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' end

  4. Dicty_cDB: SFF287 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLON...471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS...08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  5. Dicty_cDB: SLJ376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence. 44 0.075 2 BM093255 |BM093255.1 saj06h02.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...m-c1065-9939 5', mRNA sequence. 42 0.24 2 BE329911 |BE329911.1 so71b06.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS...033.1 sah65a10.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-3092 5', mRNA sequence.

  6. Dicty_cDB: SSD708 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3815 5' similar to TR...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-3784 5' similar to TR:O80678...lycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-155 5' similar to TR:O80678 O80678 PUTATIVE RNA-BIND...ING PROTEIN. ;, mRNA sequence. 46 0.30 1 BI469404 |BI469404.1 sai11e07.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS

  7. Dicty_cDB: AFI284 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE I....1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 ...3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  8. Dicty_cDB: SFH176 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yylpmvp *fknnqpix*vylnslihhtkirqyiitadsvtlsiipsplptssipynaatmvnxkati snxhildpmiasssx*fx Homology vs CSM-cDNA...fnysitstnfiysl*rcnng*xksnn fxxsyfrsndsfk*xmix Frame C: ---ylwqsigswstcsxlfxktxlplvvlslliqmvmvfknhgskvnkvlplv

  9. Isomerisation of c4-c6 aldoses with zeolites

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevated...... temperatures. C6 and C5 aldose sugars such as glucose and xylose, which are available in large amounts from biomass precursors, are isomerized to fructose and xylulose respectively, in a one or two-step process over inexpensive commercially available zeolite catalysts, containing aluminum as the only metal...

  10. Dicty_cDB: VFH573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ldisqlklltlpskintrnsssdtl lkktqpnfslviyylvvllvqphyslfth*ilpvlv*llmlvlvqlvnslv*vtvslqst ret--- ---c*cwxwfsssi...xcxp*rxncllqrxfikxxqrxrwxxsfsyl**xpktygf*rwxwf*xxkxxkkktgf*l kkktymkykikllkkntkkk Frame C: cwptgfhi*lynyv*pk

  11. Dicty_cDB: SLF592 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QQQQQQTNDGGGSGISSNTNTSISGDNSENGDSLNSSTSNQSPLNSSILTQLSNQ* sflkynikivksfkrnk Translated Amino Acid sequence (A...rame C: ---QQQQQQQTNDGGGSGISSNTNTSISGDNSENGDSLNSSTSNQSPLNSSILTQLSNQ* sflkynikivksfkrnk Homology vs CSM-cDNA

  12. Dicty_cDB: AFC104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XKIKKK--- ---XFXKKKKKXKKFFLVFKXXXFXKKKKKTPFXXX*kkikn*kkkkxkkxxisysmglx enxkvxkknxk*xkikkk*kkkllklsfyflvllls*c*gvslplcfalls...xk*xkikkk*kkkllklsfyflvllls*c*gvslplcfallss Frame B: kmsnk*KKKKKNXKKFXXVXKGXXFNKKKKXPXFFXGKKKXKIKKK--- ---xf

  13. Dicty_cDB: SSL836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kmv*f**kkkknhyh***kknkk*kkkk*kkiiisytmglren kkv*kknkk**kikkk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*r css...kk*kkkllklsfyflvllls*c*gvslplcfallssssdnlelh*r csssilrvnpshsyatlsnv*AVFNKKKYLKKKK

  14. -C/Fe System

    Science.gov (United States)

    Ikram-ul-Haq, M.; Khanna, R.; Wang, Y.; Sahajwalla, V.

    2014-12-01

    Sessile drop investigations were carried out on Al2O3-12.9C refractory substrates in contact with molten iron at 1823 K (1550 °C) for 30 minutes. Chemical reactions in this system resulted in the generation of trace quantities of ferro-aluminum alloys. An X-ray micro-diffraction approach was developed to localize and structurally identify these phases based on epitaxial mapping using X'Pert materials research Diffractometer. Using this technique, a small peak in the standard XRD pattern could be enhanced to four diffraction peaks with much higher intensities, leading to a much improved indexing of diffraction peaks and structural characterization of the reaction product.

  15. C++ for Particle Physicists

    CERN Document Server

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 �- 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  16. C++ for Particle Physicists

    CERN Multimedia

    Monique Duval

    2004-01-01

    Please note that Paul Kunz will be giving his very popular and highly recommended C++ course again on 15 - 19 November. The course costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page: Team Visitors should ask their Group Leader to send an e-mail to the DTO of PH Department, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent. ENSEIGNEMENT TECHNIQUE TECHNICAL TRAINING Monique Duval 74924 technical.training@cern.ch

  17. C++ for Particle Physicists

    CERN Document Server

    Monique Duval

    2002-01-01

    Paul Kunz will be giving his very popular and highly recommended C++ course again on 22-26 July (6 * 3 hour lectures). The course is organised by the CERN Technical Training Programme, it costs 200 CHF, and advance registration is required. People with CERN EDH accounts can apply electronically directly from the Web course description page, accessible from the Technical Training pages. Team Visitors should ask their Group Leader to send an e-mail to the DTO of EP Division, M. Burri, referring to the 'C++ for Particle Physicists' course and giving their name, CERN ID number, the Team account number to which the course fee should be charged, and VERY IMPORTANTLY an email address to which an invitation to the course can be sent.

  18. TransparC

    DEFF Research Database (Denmark)

    Callesen, Ingeborg; Vesterdal, Lars; Magnussen, Andreas;

    soil horizons and the fraction of the organic horizon that is translocated to spodic material in a B-horizon is to be chosen from a range of values. Four cases were selected in that reflect common forested soil types in Denmark. In the four selected cases turnover rates (k, year-1) were adjusted......, and iterated turnover rates in horizontal fixed depth soil sections to 1 meter depth. The intended use is mainly for outlier detection in resampling studies and teaching soil C dynamics. The simulation utilized repeated measurements of soil C (SINKS 2007-12) and will be validated with new data collected during......, bioturbation by macrofauna (earthworms) and podzolisation were included, allowing transfer of SOC between the forest floor and mineral soil layers. The forest soil carbon simulator incorporates all types of new and old organic matter into one pool. It is organized in six horizontal soil layers and runs for 40...

  19. Hepatitis C Virus.

    Science.gov (United States)

    Kim, Arthur

    2016-09-06

    This issue provides a clinical overview of hepatitis C virus, focusing on transmission, prevention, screening, diagnosis, evaluation, and treatment. The content of In the Clinic is drawn from the clinical information and education resources of the American College of Physicians (ACP), including MKSAP (Medical Knowledge and Self-Assessment Program). Annals of Internal Medicine editors develop In the Clinic in collaboration with the ACP's Medical Education and Publishing divisions and with the assistance of additional science writers and physician writers.

  20. Hepatitis C Virus Genotypes

    OpenAIRE

    Kayhan Azadmanesh; Safie Amini; Seyed-Moayed Alavian; Malek Hossein Ahmadipour

    2005-01-01

    IntroductionHepatitis C virus (HCV) is an important cause of chronic liver disease. HCV causes 20% of acute hepatitis cases, 70% of all chronic hepatitis cases, 40% of all cases of liver cirrhosis, 60% of hepatocellular carcinomas, and 30% of liver transplants in Europe(1). It is also recognized as the leading cause of liver transplantation in the world(2). Only 20% of infected individuals will recover from this viral infection, while the rest become chronically infected(3). While the majorit...

  1. Holographic c-Function

    CERN Document Server

    Haque, S Shajidul

    2016-01-01

    We propose a simple and generic holographic $c$-function that is defined purely from geometry by using the non-affine expansion for null congruences. We examined the proposal for BPS black solutions in $\\mathcal{N}=2$ gauged supergravity that interpolate between two different dimensional AdS spacetimes and also for domain wall solutions. Moreover, we commented on the relation of this geometric proposal with the one from the holographic entanglement entropy.

  2. Dicty_cDB: VSA824 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-161 3 CF423215 |CF423215.1 NcEST3d69b03.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' simila...e07.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' similar to TR:Q9ZN...equence. 36 0.018 2 CF423272 |CF423272.1 NcEST3d69h07.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDN...8 2 CF260143 |CF260143.1 NcEST3c94e11.y2 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' similar to ...-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' similar to TR:Q9ZNS3 Q9ZNS3

  3. Dicty_cDB: VFD348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q...9ZS06 RNA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...ASE P47 HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c101

  4. Dicty_cDB: AFO646 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q...9ZS06 RNA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...ASE P47 HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c101

  5. Dicty_cDB: AFO484 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...SE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...6749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar

  6. Dicty_cDB: AFK433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available roducing significant alignments: (bits) Value N AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS... BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS ...5 1 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5...ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 ...cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION I

  7. Dicty_cDB: SSF112 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 sa81e11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-5733 5' similar to SW:VSPA_SO...47.1 sae29c02.y1 Gm-c1067 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1067-4323 5' similar to TR:O49...855 O49855 ACID PHOSPHATASE. ;, mRNA sequence. 44 1.3 1 BU091184 |BU091184.1 st77g08.y1 Gm-c1054 Glycine max cDNA clone GENOME SYSTEM...ACID PHOSPHATASE. ;, mRNA sequence. 44 1.3 1 BE331581 |BE331581.1 sp15g08.y1 Gm-c1042 Glycine max cDNA clone GENOME SYSTEMS

  8. Dicty_cDB: SFJ795 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 64 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR...1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 GDP DISSOC...-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISS..., 5'end, single read. 46 7e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS... 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  9. Dicty_cDB: AFA836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequence 6225 from Patent WO02053728. 40 5e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...8e-09 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...OG. [1] ;, mRNA sequence. 38 4e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...I966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' simi

  10. Dicty_cDB: AFN831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Sequence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...ELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...OLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' si

  11. Dicty_cDB: VFD181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 925.1 Sequence 6225 from Patent WO02053728. 40 8e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...NA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5

  12. Dicty_cDB: AFA616 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6225 from Patent WO02053728. 40 5e-10 5 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CL...;, mRNA sequence. 38 4e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...|AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to T

  13. Dicty_cDB: VFF253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 |AW705505.1 sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mRNA seq...uence. 46 0.46 1 AI441512 |AI441512.1 sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm... Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', mRNA sequence. 46 0.46 1 BI317694 |BI3176...94.1 saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA sequence. 4

  14. Dicty_cDB: AFO440 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q...9ZS06 RNA HELICASE ;, mRNA sequence. 56 1e-08 2 AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS...ASE P47 HOMOLOG. [1] ;, mRNA sequence. 38 5e-08 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS... 42 2e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c101

  15. Dicty_cDB: AFK259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW306469.1 se51b09.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2418 5', mRNA seque...nce. 34 8e-04 3 BF008963 |BF008963.1 ss71e08.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS... 0.001 3 AI899992 |AI899992.1 sb97c10.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-6...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-3950 5', mRNA sequence. 34 0.002 3 AQ501049 |AQ501049.1

  16. Dicty_cDB: VSK364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 36 0.031 2 AW100096 |AW100096.1 sd20c05.y2 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...4 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1084-470 5' similar to TR:Q39835 Q39835 EXTENSIN. ;, m... AW164667 |AW164667.1 se76a06.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-587 5' si...sac11f12.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-4487 5', mRNA sequence. 36 0.1

  17. Insulin C-peptide test

    Science.gov (United States)

    C-peptide ... the test depends on the reason for the C-peptide measurement. Ask your health care provider if ... C-peptide is measured to tell the difference between insulin the body produces and insulin someone injects ...

  18. Manganese(I)-Catalyzed Dispersion-Enabled C-H/C-C Activation.

    Science.gov (United States)

    Meyer, Tjark H; Liu, Weiping; Feldt, Milica; Wuttke, Axel; Mata, Ricardo A; Ackermann, Lutz

    2017-03-20

    C-H/C-C Functionalizations were achieved with the aid of a versatile manganese(I) catalyst. Thus, an organometallic manganese-catalyzed C-H activation set the stage for silver-free C-H/C-C transformations with ample substrate scope and excellent levels of chemo-, site-, and diastereo-selectivities. The robust nature of the manganese(I) catalysis regime was reflected by the first C-H/C-C functionalization on amino acids under racemization-free reaction conditions. Detailed experimental and computational mechanistic studies provided strong evidence for a facile C-H activation and a rate-determining C-C cleavage, with considerable contribution from London dispersion interactions.

  19. Dicty_cDB: VFJ639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar...00797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' simil....y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GD.... 66 9e-07 1 AW831512 |AW831512.1 sm26g12.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c10...AW306227 |AW306227.1 se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-2109 5' si

  20. Dicty_cDB: CFI456 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LPVPAFNVINGGSHAGNKLAMQEFMIL P--- ---XIXXVGDDLLXTXPXKIXTGIXKKACNAXLXKVNXIGSXXEXIXAALDXXXASWGVX VSXRSGETEXTX T...INGGSHAGNKLAMQEFMIL P--- ---XIXXVGDDLLXTXPXKIXTGIXKKACNAXLXKVNXIGSXXEXIXAALDXXXASWGVX VSXRSGETEXTX Frame C:

  1. Dicty_cDB: SFK804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YQFQHSMLSMGGSHAGNKLA MQEFMI--- ---XFIKXXPIISIXXPFDQXDWESYXXLTASVDIQIVGDDLLVTXPXKIXTGIXKKACX AXLLKVNXIGSVXEXIXAALDXXNASWGVMVSXRSGETEXT...VXEXIXAALDXXNASWGVMVSXRSGETEXTXXADLXVGLGTGXIKTGAP CRSXRL Frame C: fflslsiyisffkmsviksikareildsrgnptvevdlytek

  2. Dicty_cDB: CHF675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 48 0.15 1 BG453581 |BG453581.1 NF092A07LF1F1050 Developing leaf Medicago truncatula cDNA...15 1 BG453480 |BG453480.1 NF092C08LF1F1055 Developing leaf Medicago truncatula cDNA clone NF092C08LF 5', mRN

  3. Dicty_cDB: CHA105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73-367476 strain AX4, complete sequence. 38 0.39 6 BE317387 |BE317387.2 NF068C10LF1F1070 Developing...49770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA sequence. 36 0.5

  4. Dicty_cDB: SFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124-6045772 strain AX4, complete sequence. 34 0.50 7 BE317387 |BE317387.2 NF068C10LF1F1070 Developing leaf M...249770 |BE249770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA seque

  5. Dicty_cDB: VSD192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SNYRVSLGLPVGAVMNSADNSGAKNLYVIAVKGIKGRLNRLPSAGVGDMVM ATVKKGKPELRKKVCTGLVVRQRKHWKRKDGVYIYFEDNAGVMCNP...ATVKKGKPELRKKVCTGLVVRQRKHWKRKDGVYIYFEDNAGVMCNPKGEVKGNILGPVAK ECSDLGQRLPPMPVP Fram...e C: rpkaqavgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmvma tvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnp

  6. Dicty_cDB: SHG618 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 WHE2108_D02_H04ZT CS wheat salt-stressed crown cDNA library Triticum aestivum cDNA clone WHE2108_D02_H04, ...04ZY Wheat salt-stressed crown cDNA library Triticum aestivum cDNA clone WHE2108_D02_H04, mRNA sequence. 44

  7. Dicty_cDB: SHD182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xnkxvxpinnnxnnnnnnnnnnnkiknxiii xvixviiiik***xk*fxfkk*ik*KXXKIKKKXIFFFKKLKFXKK---...RPYSEYXXIXMXFXIMXNSKEGLXPTLPQNTPPGXXA Frame C: nkkkkkxwxxlkptxaiiixiiinnnnnnxnkxvxpinnnxnnnnnnnnnnnkiknxiii xvixviii

  8. Dicty_cDB: SLA681 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PSSSAASSSPSSSAASSSPS SSASSSSSPSSSASSSSAPSSSASSSSAPSSSASSSSASSSSASSAATTAATTIATTAAT TTATTTATTATTTATTTATTTAATIATTTAATTTCNYNRNHSYNHSYNHS...sificcklfsificcklfpi ficiiklfpificiiklcpificiiklcsificiificiificiicsnyscnyncnyscn yncnynrnhsynhshnhsynhscnhsynhs...SSSSAPSSSASSSSASSSSASSAATTAATTIATTAAT TTATTTATTATTTATTTATTTAATIATTTAATTTCNYNRNHSYNHSYNHSYLLNLIK--- Frame C:

  9. Dicty_cDB: CFB889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llii cDNA clone cLPP11A1 5' sequence, mRNA sequence. 66 9e-10 2 CF811515 |CF811515.2 NA716 cDNA non acclim...ated Bluecrop library Vaccinium corymbosum cDNA 5', mRNA sequence. 70 7e-09 2 AF352

  10. Dicty_cDB: SHB246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available JBW092C02 similar to undiscovered sequence, mRNA sequence. 30 0.004 3 AC141063 |AC141063.1 Homo sapiens chr...8982.1 JBW092C02.b_012.abi Pineapple week 5-10 nematode-infected gall cDNA library Ananas comosus cDNA clone

  11. Dicty_cDB: SLA708 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klrklishfinktlikkkk k Frame B: ---stvatttsattagtttggtttggstsdssaassadssaassspsssaassaasseps ssaasssapssasssapssasssapsssasssaassaasse...ssesssats*ikl*skkkk Frame C: ---QLSQLQPLQLLQVQQLVELQLVVQ

  12. Dicty_cDB: CHG613 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available faattaattiattaaxttattxat Frame C: lsnnnnknnnnnkel*snnniaiiynycskitytyinnyyyhcf*k*ink**kk--- ---xiixcc...kxfsifxcxkxfxifxcckxfpificiiklfpxfxciikxcpificiiklc sificiifixhhlhlhhlqqlqlqlqlqlqlxlqlq

  13. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  14. Dicty_cDB: AFM354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NGXVVLXXXXIXXIHXF XQVXSVXXXXXX Frame B: ---vxxxqxxqarigxwxxxxxxkxxxxxxxxfxcwxxxcxlxmxwwffxxxx...yxxsixx fkxnqxxxxxx Frame C: ---xxxxrxxrqelxxgxxxxgxkxxvrxqxxxnvgxxxaxxxwxggslxxyxxfxpsix ssxisxxxxxx

  15. Dicty_cDB: VFN130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XSSXXXTPKPKPKPKPTPTTSTPNLSAKSATNSPYKSSIRNASPQP TSKPK Frame B: ---xxxxxxxxxxxhhxxx...qhqnqnqnqnqhqqhqhqiyqpnqqqihhinhqlgmhhhnp hqnqn Frame C: ---xxxxxxnxxxxiixxxntktktktktntnnintkfisqisnkfti*ii

  16. Dicty_cDB: AFL805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: ---rf*vkkkrfffxxgkkxkkxkxxxxxkxxxxxxxxxxxkxkxxxxkxsxxkkknk Frame B: ---GFRXKKKGFFLXXXKKXKNXKXXXXXKX...XXXXXXXXXXKXKXXXXKXPXEKKKIK Frame C: ---vlgxkkkvffxpwxkkxktkxxxxxxkxxxxxxxxxxxxkxxxxxkxxx

  17. Dicty_cDB: SSB877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VVLVVLINNMVVLMVIKNNXNKVLILLILVLNLVVVVHNKHNSVNNNKQFKKKKN *kypkiskypki*n*kkkkknfqnyy*inlynn... C: NKVLMVVLVVLINNMVVLMVIKNNXNKVLILLILVLNLVVVVHNKHNSVNNNKQFKKKKN *kypkiskypki*n*kkkkknfqnyy*inlynn

  18. Dicty_cDB: SFD774 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence. 34 0.002 14 BF298760 |BF298760.1 021PbB01 Pb cDNA #20, Charles Yowell and Jane Carlton Plasmodium b...erghei cDNA 5', mRNA sequence. 36 0.005 3 BF298776 |BF298776.1 021PbC06 Pb cDNA #20, Charles

  19. Dicty_cDB: AFG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ielielpeyvlsllfgsvmfvfififiiiayrfkeidqsvldelngdt pmtddnananskeldvvtqkdlssssnpiinn...nnnnnnstlgns Frame C: kkennyyykkwr*kknhqilvyqhqlii*ghqlmervhlkvnkviwkvlimkflfmegmk iifhhqlnilwvmkfvkgihtml*e

  20. Dicty_cDB: AFF239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SSESD XDRFXNINNDDXDXPXXQQQPVXQPEXEXXXQEXEKVXEPIXEXXXKVEXKVEEPVAEQX XXKVXEPVXAEXXKVEEPXTEEXKVEE Translated Am...VXEPIXEXXXKVEXKVEEPVAEQX XXKVXEPVXAEXXKVEEPXTEEXKVEE Frame C: lfifvlyslfisflyidkf

  1. Dicty_cDB: AFI377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NEEYYENPEQFDPSRFLKVESNVAFLPFSIGIRSCVGQSFAQDELYXCISN ILLNFKLKSIDGXKIDETEEXGLTLXTKNRFNV Translated Amino Acid ...SNVAFLPFSIGIRSCVGQSFAQDELYXCISN ILLNFKLKSIDGXKIDETEEXGLTLXTKNRFNV Frame C: laywxktkkylnqklki*IKNIKNKNIIVEKKK

  2. Dicty_cDB: SSB291 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence DVMILDNQKQIFVWVGKESSDTEKLMANETALEYIMNAPTHRRDDPIFTIQDGFEPHEFT FNFHAWQVNKTQQDSYKSKLSAILGSNNSGPASPIMLPTS...cnfkanncnysi*scyhykylysitnynynilsiisfktk n*ft--- Frame C: DVMILDNQKQIFVWVGKESSDTEKLMANETALEYIMNAPTHRRDDPIFTI

  3. Dicty_cDB: SLH749 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A, clone SSM443. 448 e-122 1 ( FG607393 ) stem_S022_C12.SEQ Opium poppy stem cDNA library P... 50 0.069 1 ( ....27 1 ( FG611075 ) stem_S068_C04.SEQ Opium poppy stem cDNA library P... 48 0.27 1 ( CS374673 ) Sequence 776

  4. Dicty_cDB: AFJ476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *lcfnaccndi*cctlfcsn crsfsw*yslgryrtnskstcaxnfrrs Frame C: kkmkvisgllffiliscslflvqgqvdcvtnssdasctnfqyplani...tadinnlcgsmpy mpvctiqqscnqesstsgicdpfsilgdsclhdmpgmsgcnnfkklcasgsvveqcstvd svtdlptt

  5. Dicty_cDB: VHD155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KVSIMSQKEFSIVPLENIFKEIITPIEQKVD ELKEKIEKENQENPLVEQNEISLIDPQQTLLFSYMKYLFEAYKAMIEVLTRQN--- ---lpqkkxevvxxvsvvxvxmppqnvxkvvivxvx...vkmxpxqxvxxvvivgvxvimxpq kktvvvvxvlvxikexkvxktxxgxxxtkxxktkxxxmvg Frame C: fhlynyfifi*ikkcq

  6. Dicty_cDB: VSD732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c*qssfrfwlfry**ryyaih i*n*c*ysn*tcfnkhekhc*scwfingksc*nyhliking*fpsc*hclfyl*vftin...kscs*nh*ctrcywpiqssnyc*qssfrfwlfry**ryyaih i*n*c*ysn*tcfnkhekhc*scwfingksc*nyhliking*fpsc*hclfyl*vftind lln*...drkscs*nh*ctrcywpiqssnyc*qssfrfwlfry**ryy aihi*n*c*ysn*tcfnkhekhc*scwfingksc*nyhliking

  7. Dicty_cDB: VHF261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence ---vecgxtntdkciqlscneatgcqqsavvcpdvgscxvg*CDSKQGCLTKPRSCDTGV FCLTGECIENAGGCIVYEKRCDADNGRCQQGVCVNNTAXEE...w* Frame C: ---vecgxtntdkciqlscneatgcqqsavvcpdvgscxvg*CDSKQGCLTKPRSCDTGV FCLTGECIENAGGCIVYEKRCDADNGRCQQGVCVN

  8. Dicty_cDB: VSG854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 12C10.yg.ab1 QG_ABCDI lettuce salinas Lactuca sativa cDNA clone QGD12C10, mRNA sequence. 36 0.42 2 BQ866091 ...|BQ866091.1 QGC7A06.yg.ab1 QG_ABCDI lettuce salinas Lactuca sativa cDNA clone QGC

  9. Dicty_cDB: SFH171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA c...82264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA se

  10. Dicty_cDB: AFI206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ19K... AI782264 |AI782264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRN

  11. Dicty_cDB: SSJ182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE342564.1 EST395408 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA20O8, mRNA sequence...2683 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES17M3, mRN

  12. Dicty_cDB: CFJ532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2039 |AW622039.1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cD...1828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5', ... 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell Lycopersicon esculent

  13. Dicty_cDB: CFJ845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3754.1 EST321699 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB13E3 5... EST402393 tomato root, plants pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cLEY19A14

  14. Dicty_cDB: VHG423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence ---FTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICT CDNEHIGNGCEIKFIECKHKCSTKHGICDNDSGNCKCDT...*vpisr*knknlkniercncwyccwlccccfin Frame C: ---FTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGIC

  15. Dicty_cDB: SHF724 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IRDRGGDLDRDVGTYDMLRACFDGDQLILENSGICG GVXGAHLLPSGYFGTPDGINSGEYYN Translated Amino Acid sequence (All Frames) ...TMDGEDMIISIRDRGGDLDRDVGTYDMLRACFDGDQLILENSGICG GVXGAHLLPSGYFGTPDGINSGEYYN Frame C

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available persicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.042 1 BE459099 |BE459099.1 EST414391 tomato developing...1 BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone c

  17. Dicty_cDB: VFD346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsicon esculentum cDNA clone cTOC1D13 5', mRNA sequence. 50 0.041 1 BE459099 |BE459099.1 EST414391 tomato developing...BF051619 |BF051619.1 EST436849 tomato developing/immature green fruit Lycopersicon esculentum cDNA clone cLE

  18. Dicty_cDB: SFE203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available viimdesfnsilepenawlflfddvsqlqqlpivqnnqenfinsidf ntgdvtttnisglnfqsleeslnsdtsienkpq...i Frame C: ilktviiykqciiviimdesfnsilepenawlflfddvsqlqqlpivqnnqenfinsidf ntgdvtttnisglnfqsleeslnsdtsienkpqiie

  19. Dicty_cDB: VSJ470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lssqqksnnndsddsdddnek*r***qyy*ssriilysm*rslf*ky yrksis*nhsktfiilsitrfkmlkm**c*i**pw*ylstm...Frame C: rvrkykynfylfrlssqqksnnndsddsdddnek*r***qyy*ssriilysm*rslf*ky yrksis*nhsktfiilsitrfkmlkm**c*i**pw*ylstm...nek*r***qyy*ssriilysm*rslf*ky yrksis*nhsktfiilsitrfkmlkm**c*i**pw*ylstmfwsmgmysik*fif*rfny l*kycris*f*mvr*dc

  20. Dicty_cDB: VSH844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ictyostelium discoideum cDNA clone:ddv50m11, 5' ... 942 0.0 2 ( C23686 ) Dictyostelium discoideum gamete cDN...7 ) Dictyostelium discoideum cDNA clone:ddv50m11, 3' ... 942 0.0 2 ( AU265127 ) Dictyostelium discoideum veg

  1. Dicty_cDB: VSI126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 268192 ) Dictyostelium discoideum vegetative cDNA clone:VS... 418 e-113 1 ( BJ442592 ) Dictyostelium discoideum cDNA clone:ddv50...lium discoideum cDNA clone:ddv50m22, 3' ... 400 e-107 1 ( BJ441082 ) Dictyostelium discoideum cDNA clone:ddv

  2. Dicty_cDB: VHF201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 442499 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 1352 0.0 1 ( BJ442525 ) Dictyostelium discoideum cDNA clone:ddv50...um discoideum cDNA clone:ddc55m02, 3' ... 1193 0.0 2 ( BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f

  3. Dicty_cDB: VHJ861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostelium discoideum cDNA clone:ddv50j16, 3' ... 1475 0.0 1 ( BJ446334 ) Dictyostelium discoideum cDNA clone:...J442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1467 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50

  4. Dicty_cDB: VHL643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SRQRSTTRIAS Frame C: qildkndriii*fs*yiyinlfillifsktkkk--- ---rwkkklssks*rmpktmknlismkrtkhsmtkskrrntnfvsiiklk...KDSSKPQLSKG RRGIDTKEMASHLKSMHHEDDEIGDIIQSVRDHSKSRISGKKRSRSASRSDSQAPTSEER GLSLNRSK

  5. Dicty_cDB: VSD206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mino Acid sequence kqdqldllaqvlgegedsgkneileedfdditrgakkskssaptvsrttggstralsggn dmnymeyqapaiyksiptqhalfkqrak...ikllqfikvfqlnmhylnnvlkinnkk*ikk*tkk Frame C: kqdqldllaqvlgegedsgkneileedfdditrgak

  6. Dicty_cDB: VSJ733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KVLXGAXQKKXVESXEDI--- ---YLVSNSYKTNCILI*nqikemdvqtkygagqnkvlgganqkkiveseedialpelnp svpqaiqrarnalkmtqkelafkinerpgviney...rame C: ikyxvvpxkkrxlnlxkil--- ---YLVSNSYKTNCILI*nqikemdvqtkygagqnkvlgganqkkiveseedialpelnp svpqaiqrarnalkmtqkelafkinerpgviney

  7. Dicty_cDB: AHA485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aisn**rmklkhltiflfifihrflfvksdcylinnerpetkitkircddqvisill npnnrtdatlekdtdgkfyfdvvnfpykdrlcdytydiyflpeipslpsv...C: n*paisn**rmklkhltiflfifihrflfvksdcylinnerpetkitkircddqvisill npnnrtdatlekdtdgkfyfdvvnfpykdrlcdytydiyflpei

  8. Dicty_cDB: SHA752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssowii Tamarix androssowii cDNA, mRN...A sequence. 58 4e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssowii leaf Tamarix androssowii cDNA, mRNA

  9. Dicty_cDB: SFJ784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 30e06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to TR:O96369 O96369 GL...16321.1 PfESToaa39a10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to TR:

  10. Dicty_cDB: SSC664 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BU497913 |BU497913.1 PfESToab90a05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' ...007 1 BI814952 |BI814952.1 PfESToaa08d03.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDN

  11. Dicty_cDB: VSJ535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 815113 |BI815113.1 PfESToaa14e05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' sim... Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to

  12. Dicty_cDB: VHA506 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BU497602.1 PfESToab81g05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...Q596061 |BQ596061.1 PfESToab28g07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' si

  13. Dicty_cDB: VFK513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MTELITSILNSINHNSHXG MSNQKKQQIQAKVNQIKKTDLVVKRQQDIDTLCANKIQHNYNEIVAYRLRSISSLLDSKY ...ls*scscclsnksfpkitfklkt kk Frame C: lkykkkrnknil*MAELTNHFNKVNELLNDWDGVGLSHELSMTELITSILNSINHNSHXG MSNQKKQQIQAKVNQIKKTDLVVKRQQDIDTLCAN

  14. Dicty_cDB: AFK713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cD...NA clone NXLV_039_C04 5', mRNA sequence. 46 0.018 2 BM158719 |BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical

  15. Dicty_cDB: SSE754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NWFPLAFVLDESFMVVHGGLFGKDGVTLDDIRKI KRNAPDPKDNELVQCLLWSDPQSNPGIAPSSRGVGVYFGPDVTRRFLKENNLSTIIRSHE VKEKGYQIDDDGSLITVFSAPNYCDQSGNLGSFINIT...EKGYQIDDDGSLITVFSAPNYCDQSGNLGSFINITEDKIKITTFEAVEHPNIPPMHYA KKYF Homology vs CSM-c

  16. Dicty_cDB: CFH749 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 949067E10.y2 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, ...leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence. 42 7e-11 4 dna update 2004. 2. 2 Homology

  17. Dicty_cDB: VSF452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available moeba histolytica genomic, DNA sequence. 38 0.15 2 N98113 |N98113.1 2203C3 czapPFDd2.1, Debopam Chakrabarti ...Plasmodium falciparum cDNA clone PF2203C, mRNA sequence. 34 0.20 2 N98046 |N98046.1 2110C3 czapPFDd2.1, Debo

  18. Dicty_cDB: AHA261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EAVYRDERGTPHNFHFCLQIHSMFAYKKGDTFYFNGDDDVWVF MNKILVVDLGGIHGKATTSINLDRLGLTEGTNYP--- ---YNYTESTCDDNDACTSDVCTEYG...c*fgrnsr*snnky*fg*irfd*ghqls--- ---YNYTESTCDDNDACTSDVCTEYGCEHYTYTGCMNCTNGGCFTTPDTCNHYGCNFTGD GKCFFTHLECDDNDP

  19. CLR via C#

    CERN Document Server

    Richter, Jeffrey

    2010-01-01

    Dig deep and master the intricacies of the common language runtime (CLR) and the .NET Framework 4.0. Written by a highly regarded programming expert and consultant to the Microsoft® .NET team, this guide is ideal for developers building any kind of application-including Microsoft® ASP.NET, Windows® Forms, Microsoft® SQL Server®, Web services, and console applications. You'll get hands-on instruction and extensive C# code samples to help you tackle the tough topics and develop high-performance applications.

  20. C programming language essentials

    CERN Document Server

    Ackermann, Ernest C

    2012-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. C Programming Language discusses fundamental notions, data types and objects, expressions, statements, declarations, function and program structure, the preprocessor, and the standar

  1. Vitamin C and chiropractic.

    Science.gov (United States)

    Dryburgh, D R

    1985-06-01

    A review of the literature relating to possible clinical implications of ascorbic acid (AA) supplementation was conducted. Factors requiring a higher AA intake include smoking, alcohol ingestion, stress, diabetes mellitus, pregnancy, and certain drugs, including oral contraceptives, some antibiotics, acetylsalicylate and anti-inflammatory medications. AA has been found to significantly increase wound healing, reduce the inflammatory response, lessen respiratory distress, enhance immune function and serve to benefit many common conditions including osteoarthritis. It is concluded that vitamin C supplementation could be utilized for many conditions seen by chiropractors.

  2. Programming with C++

    CERN Document Server

    Juneja, BL

    2009-01-01

    About the Book: Authors have taken special care to present the various topics in Programming with C++ in an easy-to-learn style. Almost every topic is followed by well designed live programmes so that it becomes easy to grasp the underlying principle or programming technique. A total of more than 450 live programmes are included in the book. It is also taken care that programmes are short and do not include such details which do not relate to the topic on hand. This makes them easy to be tested and suitable for practice students. Authors are confident that the book will prove its worth for th

  3. Dicty_cDB: VSF154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 121 |BF298121.1 060PbE12 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA ...5', mRNA sequence. 38 0.096 3 BF296904 |BF296904.1 044PbC10 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clar...73.1 061PbC05 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA se

  4. Dicty_cDB: SFE435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1C5, mRNA se...on esculentum cDNA clone cTOF19D15 5' sequence, mRNA sequence. 38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell...sculentum cDNA clone cTOE14I10 5' sequence, mRNA sequence. 38 0.10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Cornell

  5. Dicty_cDB: SFL133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE I...D:sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ...CRLFL1008H03 5', mRNA sequence. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS

  6. Dicty_cDB: CFF586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09....y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06 Q9ZS06 RNA ...|BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:

  7. Dicty_cDB: VFI705 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 215.1 NcEST3d69b03.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' sim...d98e07.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' similar to TR:Q9ZNS3 Q9ZNS3 RIBOSOMAL PROT...Z Tachyzoite cDNA Library Neospora caninum cDNA 5' similar to TR:Q9ZNS3 Q9ZNS3 RIBOSOMAL PROTEIN S27. ;, mRN...A sequence. 36 0.034 2 CF423272 |CF423272.1 NcEST3d69h07.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum ... NcEST3c94e11.y2 Nc-LIV Tachyzoite cDNA Library Neospora caninum cDNA 5' similar

  8. Dicty_cDB: AFO278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7E2 map 21q22.2,D21S349-MX1. 32 0.61 6 BM093255 |BM093255.1 saj06h02.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS...cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-1068 5', mRNA sequence. 42 0.78 2 BI424033 |BI424033.1... sah65a10.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-30...2.3 2 BE802815 |BE802815.1 sr45a02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-963

  9. Dicty_cDB: SFD789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available roducing significant alignments: (bits) Value N BG046427 |BG046427.1 saa63f08.y1 Gm-c1060 Glycine max cDNA clone GENOME SYSTEMS...NA sequence. 48 0.17 1 AW759353 |AW759353.1 sl41b12.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ...80578.1 sl72g01.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1...EHYDROGENASE E1 ALPHA SUBUNIT ;, mRNA sequence. 48 0.17 1 AW201355 |AW201355.1 sf02b05.y1 Gm-c1027 Glycine max cDNA clone GENOME SYST...EMS CLONE ID: Gm-c1027-1066 5' similar to TR:Q9ZT57 Q9ZT57 BRANCHED-CHAIN ALPHA KET

  10. Dicty_cDB: SFD132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1080 0.0 2 BI317339 |BI317339.1 saf70a03.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c107...RNA sequence. 56 6e-04 1 BG362767 |BG362767.1 sac08f03.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLO... mRNA sequence. 56 6e-04 1 AW620967 |AW620967.1 sj98c05.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS...DE ISOMERASE P5 PRECURSOR ;, mRNA sequence. 56 6e-04 1 AW508381 |AW508381.1 si40c04.y1 Gm-r1030 Glycine max cDNA clone GENOME SYSTEMS

  11. Dicty_cDB: SFG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEM...nce. 56 9e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...nce. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...E12 5', mRNA sequence. 48 2e-08 3 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  12. Dicty_cDB: SLI839 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 05g10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' sim...PfESToab50b05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:R15A_PIC...|BU495424.1 PfESToab72g08.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...b21g01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' si... PfESToaa91e11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:R15A_PI

  13. Human C4 haplotypes with duplicated C4A or C4B.

    OpenAIRE

    Raum, D; Awdeh, Z; Anderson, J.; Strong, L; Granados, J.; Teran, L; Giblett, E; Yunis, E J; Alper, C A

    1984-01-01

    In the course of study of families for the sixth chromosome markers HLA-A, C, B, D/DR, BF, and C2, the two loci for C4, C4A, and C4B, and glyoxalase I, we encountered five examples of probable duplication of one or the other of the two loci for C4. In one of these, both parents and one sib expressed two different structural genes for C4B, one sib expressed one, and one sib expressed none, suggesting that two C4B alleles were carried on a single haplotype: HLA-A2, B7, DR3, BFS1, C2C, C4A2, C4B...

  14. Dicty_cDB: VHE677 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eavy chain gene, complete cds. 874 0.0 5 EC388470 |EC388470.1 C06_C06gm2n11_pDNRf_491054 Myzus persicae, lin...e G006, whole aphid library Myzus persicae cDNA clone C06_C06gm2n11_pDNRf_491054, mRNA sequence. 32 1.5 3 ES

  15. Dicty_cDB: SSA671 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68 |BF295868.1 029PbD04 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontal...laria mosquito). 46 0.82 1 BF297693 |BF297693.1 055PbA03 Pb cDNA #17, Tommaso Pace, Marta...058PbC01 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequenc

  16. Dicty_cDB: CFI693 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 852.1 057PbA12 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA s...a cDNA clone pMHRP-45K18, mRNA sequence. 50 0.020 1 BF294187 |BF294187.1 001PbC04 Pb cDNA #17, Tommaso Pace, Marta

  17. Dicty_cDB: SHJ605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 JBW092C02.b_012.abi Pineapple week 5-10 nematode-infected gall cDNA library Ananas comosus cDNA clone JBW...GC1 Alexandrium tamarense cDNA clone UI-D-GC1-aau-c-07-0-UI 3', mRNA sequence. 30 0.004 3 DT338982 |DT338982

  18. Dicty_cDB: SHJ827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2.1 JBW092C02.b_012.abi Pineapple week 5-10 nematode-infected gall cDNA library Ananas comosus cDNA clone JB...-GC1 Alexandrium tamarense cDNA clone UI-D-GC1-aau-c-07-0-UI 3', mRNA sequence. 30 0.003 3 DT338982 |DT33898

  19. Dicty_cDB: SHF788 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Alexandrium tamarense cDNA cloneUI-D-GC1-aau-c-07-0-UI 3', mRNA sequence. 30 0.007 3 DT338982 |DT338982.1 JBW092C02.b_012.abi Pinea...pple week 5-10 nematode-infected gall cDNA library Ananas comosus cDNA clone JBW092

  20. Dicty_cDB: VHA688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 74530.1 NDL1_44_C08.g1_A029 Needles control Pinus taeda cDNA clone NDL1_44_C08_A029 5', mRNA sequence. 48 0....30 1 CO174449 |CO174449.1 NDL1_44_C08.b1_A029 Needles control Pinus taeda cDNA cl

  1. Dicty_cDB: CHS483 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ey sequence. 38 0.14 2 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA...490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic acid...34.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38 0.15

  2. Dicty_cDB: SSE709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sicon esculentum cDNA clone cLEI12C1 5', mRNA sequence. 54 0.003 1 BF187220 |BF187220.1 EST443507 potato stolon, Cornell...tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5', ... 1 BE473010 |BE473010.1 EST417863 potato stolon, Cornell University Solanum tuber

  3. Dicty_cDB: AHB122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ot during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5', mRNA sequence...e QHJ21N12, mRNA sequence. 54 1e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...T311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9 5

  4. Dicty_cDB: CHO881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX1...se (ACO) mRNA, complete cds. 66 9e-15 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10C9

  5. Dicty_cDB: VFG581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDN...A clone cTOD1C15, mRNA sequence. 92 3e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycop...524 tomato root during/after fruit set, Cornell University Lycopersicon esculentu...o flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cT

  6. Dicty_cDB: AFB456 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AI773934 |AI773934.1 EST255034 tomato resistant, Cornell...AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic ac...AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1C5, mRNA sequence. 38

  7. Dicty_cDB: VHO133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available deum cDNA clone:ddv59a09, 3' ... 1411 0.0 1 ( BJ442525 ) Dictyostelium discoideum cDNA clone:ddv50...l04, 3' ... 1292 0.0 2 ( BJ442499 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 12..., 3' ... 1233 0.0 2 ( BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 1225 0.0 3 ( C25574 )

  8. Dicty_cDB: VHP414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostelium discoideum cDNA clone:ddv50g15, 3' ... 1635 0.0 3 ( BJ437910 ) Dictyostelium discoideum cDNA clone:...J442583 ) Dictyostelium discoideum cDNA clone:ddv50g12, 3' ... 1614 0.0 2 ( BJ430...cDNA clone:ddv38n15, 3' ... 1608 0.0 3 ( BJ442531 ) Dictyostelium discoideum cDNA clone:ddv50m05, 3' ... 159

  9. Dicty_cDB: AFA851 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-07 4 BU495443 |BU495443.1 PfESToab73a04.y1 Plasmodium falciparum 3D7 asexual cD...04 1 BQ633344 |BQ633344.1 PfESToab40g06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA...SToac03a07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5

  10. Dicty_cDB: SSA643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:VATL_AVESA P23957 VACUOLAR...98482.1 PfESToab97g07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:...8405.1 PfESToab96g09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falcipa

  11. Dicty_cDB: SSH722 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar...2 |BU498482.1 PfESToab97g07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar ...equence. 46 0.23 1 BU498405 |BU498405.1 PfESToab96g09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium f

  12. Dicty_cDB: VSD390 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ', mRNA sequence. 36 0.057 2 CB980143 |CB980143.1 CAB70002_IIIaF_C08 Cabernet Sau... CB980214 |CB980214.1 CAB70002_IIIaR_C08 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera cDNA c...0636_A06 Vitis vinifera cv. cabernet sauvignon Stem - CAST Vitis vinifera cDNA clone CAST0003_IVR_A06 3', mR

  13. Dicty_cDB: VHO217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF828602 |CF828602.1 UCRCR01_01N10_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus retic...R01_01H10_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus reticulata cDNA clone CR_CEa01...28476.1 UCRCR01_01K07_r Clementine Mandarin Albedo at Rind Separation cDNA Library Citrus reticulata cDNA cl

  14. CSO$_c$ superpotentials

    CERN Document Server

    Guarino, Adolfo

    2015-01-01

    Motivated by their application to holographic RG flows and hairy black holes in Einstein-scalar systems, we present a collection of superpotentials driving the dynamics of $\\mathcal{N}=2$ and $\\mathcal{N}=1$ four-dimensional supergravities. These theories arise as consistent truncations of the electric/magnetic families of $\\textrm{CSO}(p,q,r)_{c}$ maximal supergravities, with ${p+q+r=8}$, discovered by Dall'Agata et al. The $\\mathcal{N}=2$ and $\\mathcal{N}=1$ truncations describe $\\textrm{SU}(3)$ and $\\mathbb{Z}_{2} \\times \\textrm{SO}(3)$ invariant sectors, respectively, and contain AdS$_4$ solutions preserving $\\mathcal{N}=1,2,3,4$ supersymmetry within the full theories, as well as various gauge symmetries. Realisations in terms of non-geometric type IIB as well as geometric massive type IIA backgrounds are also discussed. The aim of this note is to provide easy to handle superpotentials that facilitate the study of gravitational and gauge aspects of the $\\textrm{CSO}(p,q,r)_{c}$ maximal supergravities avoi...

  15. InlfammatoryboweldiseasesandhepatitisC virusinfection

    Institute of Scientific and Technical Information of China (English)

    Yan-Dong Li; Jian-Jiang Lin; Shu-Sen Zheng

    2010-01-01

    BACKGROUND: Data on the prevalence of hepatitis C in patients with inlfammatory bowel diseases (IBD) are limited and conlficting. This study was to assess the prevalence of hepatitis C virus (HCV) infection in IBD patients and to deifne the clinical and immunologic proifle of IBD associated with HCV infection. METHODS: Ten patients (seven females and three males) with IBD and HCV infection were consecutively recruited in our department between June 2005 and May 2010. We analyzed the clinical and serologic description of all patients. RESULTS: The mean age of the 10 patients was 41 years and the median disease duration was 7 years. With present and/or past HCV infection, the patients had clinical manifestations and were positive for endoscopic study or histological test. Compared with the HCV-negative IBD group, the HCV-positive IBD group have a higher positive rate of autoantibodies (antinuclear antibodies, antieutrophil cytoplasmic antibody, and anti-SSa/SSb). In the HCV-positive group, 8 patients were positive for p-antieutrophil cytoplasmic antibody, 4 positive for antinuclear antibodies, and 3 positive for anti-SSa/SSb. Four patients had an elevated level of transaminase (alanine transminase, and aspartate transminase). CONCLUSIONS: HCV positive in IBD may induce autoanti-bodies (antinuclear antibodies, antieutrophil cytoplasmic antibody, anti-SSa/SSb) and damage of liver function. In managing IBD patients, physicians should be aware of screening of HCV and prescribe antiviral treatment.

  16. Hepatitis viral C

    Directory of Open Access Journals (Sweden)

    Pedro A. Poma

    2011-12-01

    Full Text Available El virus de la hepatitis C se trasmite por contacto directo con la sangre de la persona infectada. La mayoría de los pacientes no presenta síntomas en la fase aguda o crónica de la hepatitis. Dos a tres décadas después, algunos pacientes progresan a la cirrosis compensada, que también es asintomática. En un examen de sangre, los anticuerpos se presentan como una sorpresa, porque no se les relaciona con un episodio de contagio. Un embarazo ocasiona la posibilidad de efectos negativos de la infección en la madre o el niño. El tratamiento actual no ofrece la certeza de cura, dependiendo del genotipo viral, y presenta efectos adversos que pueden ser severos. La cirrosis descompensada causa la mayoría de muertes relacionadas con esta infección; algunos de estos pacientes desarrollan carcinoma hepatocelular. La reproducción viral causa partículas virales diferentes del virus original, característica que ha impedido el desarrollo de una vacuna. Actualmente, la prevención consiste en evitar el contacto con sangre infectada. Este artículo revisa la infección con el virus de la hepatitis C, incluyendo los últimos progresos en tratamiento. Es necesario educar a la comunidad acerca de los efectos de este virus en la salud pública.

  17. Dicty_cDB: CHD258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar t...797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar...1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' simil...SOCIATION INHIBITOR. ;, mRNA sequence. 62 4e-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  18. Dicty_cDB: SFI237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5...-05 1 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-218....1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1...INHIBITOR. ;, mRNA sequence. 62 1e-05 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...N INHIBITOR. ;, mRNA sequence. 62 1e-05 1 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS

  19. Dicty_cDB: SFD673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O65744 GDP... DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS...gdi). 38 7e-06 3 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to T... |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to

  20. Photosynthesis of C3, C3–C4, and C4 grasses at glacial CO2

    Science.gov (United States)

    Pinto, Harshini; Sharwood, Robert E.; Tissue, David T.; Ghannoum, Oula

    2014-01-01

    Most physiology comparisons of C3 and C4 plants are made under current or elevated concentrations of atmospheric CO2 which do not reflect the low CO2 environment under which C4 photosynthesis has evolved. Accordingly, photosynthetic nitrogen (PNUE) and water (PWUE) use efficiency, and the activity of the photosynthetic carboxylases [Rubisco and phosphoenolpyruvate carboxylase (PEPC)] and decarboxylases [NADP-malic enzyme (NADP-ME) and phosphoenolpyruvate carboxykinase (PEP-CK)] were compared in eight C4 grasses with NAD-ME, PCK, and NADP-ME subtypes, one C3 grass, and one C3–C4 grass grown under ambient (400 μl l–1) and glacial (180 μl l–1) CO2. Glacial CO2 caused a smaller reduction of photosynthesis and a greater increase of stomatal conductance in C4 relative to C3 and C3–C4 species. Panicum bisulcatum (C3) acclimated to glacial [CO2] by doubling Rubisco activity, while Rubisco was unchanged in Panicum milioides (C3–C4), possibly due to its high leaf N and Rubisco contents. Glacial CO2 up-regulated Rubisco and PEPC activities in concert for several C4 grasses, while NADP-ME and PEP-CK activities were unchanged, reflecting the high control exerted by the carboxylases relative to the decarboxylases on the efficiency of C4 metabolism. Despite having larger stomatal conductance at glacial CO2, C4 species maintained greater PWUE and PNUE relative to C3–C4 and C3 species due to higher photosynthetic rates. Relative to other C4 subtypes, NAD-ME and PEP-CK grasses had the highest PWUE and PNUE, respectively; relative to C3, the C3–C4 grass had higher PWUE and similar PNUE at glacial CO2. Biomass accumulation was reduced by glacial CO2 in the C3 grass relative to the C3–C4 grass, while biomass was less reduced in NAD-ME grasses compared with NADP-ME and PCK grasses. Under glacial CO2, high resource use efficiency offers a key evolutionary advantage for the transition from C3 to C4 photosynthesis in water- and nutrient-limited environments. PMID:24723409

  1. Meningococcal disease serogroup C

    Directory of Open Access Journals (Sweden)

    Cuevas IE

    2012-03-01

    Full Text Available Félix O Dickinson1, Antonio E Pérez1, Iván E Cuevas21Department of Epidemiology, “Pedro Kourí” Institute, Havana, Cuba; 2Pharmacovigilance Group, Finlay Institute, Havana, CubaAbstract: Despite current advances in antibiotic therapy and vaccines, meningococcal disease serogroup C (MDC remains a serious threat to global health, particularly in countries in North and Latin America, Europe, and Asia. MDC is a leading cause of morbidity, mortality, and neurological sequelae and it is a heavy economic burden. At the individual level, despite advances in antibiotics and supportive therapies, case fatality rate remains nearly 10% and severe neurological sequelae are frequent. At the population level, prevention and control of infection is more challenging. The main approaches include health education, providing information to the public, specific treatment, chemoprophylaxis, and the use of vaccines. Plain and conjugate meningococcal C polysaccharide vaccines are considered safe, are well tolerated, and have been used successfully for over 30 years. Most high-income countries use vaccination as a part of public health strategies, and different meningococcal C vaccination schedules have proven to be effective in reducing incidence. This is particularly so with conjugate vaccines, which have been found to induce immunogenicity in infants (the age group with the highest incidence rates of disease, stimulate immunologic memory, have longer effects, not lead to hyporesponsiveness with repeated dosing, and decrease acquisition of nasopharyngeal carriage, inducing herd immunity. Antibiotics are considered a cornerstone of MDC treatment and must be administered empirically as soon as possible. The choice of which antibiotic to use should be made based on local antibiotic resistance, availability, and circulating strains. Excellent options for a 7-day course are penicillin, ampicillin, chloramphenicol, and third-generation cephalosporins (ceftriaxone and

  2. $\\Lambda_c\\Sigma_c\\pi$ coupling and $\\Sigma_c \\rightarrow\\Lambda_c \\pi$ decay in lattice QCD

    CERN Document Server

    Can, K U; Oka, M; Takahashi, T T

    2016-01-01

    We evaluate the $\\Lambda_c\\Sigma_c\\pi$ coupling constant ($G_{\\Lambda_c \\Sigma_c \\pi}$) and the width of the strong decay $\\Sigma_c \\rightarrow\\Lambda_c \\pi$ in 2+1 flavor lattice QCD on four different ensembles with pion masses ranging from 700 MeV to 300 MeV. We find $G_{\\Lambda_c \\Sigma_c \\pi}=18.332(1.476)_{\\rm{stat.}}(2.171)_{\\rm{syst.}}$ and the decay width $\\Gamma(\\Sigma_c \\rightarrow\\Lambda_c \\pi)=1.65(28)_{\\rm{stat.}}(30)_{\\rm{syst.}}$~MeV on the physical quark-mass point, which is in agreement with the recent experimental determination.

  3. Dicty_cDB: VFK428 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 0.004 1 AI772499 |AI772499.1 EST253599 tomato resistant, Cornell Lycopersicon e...3 L. hirsutum trichome, Cornell University Lycopersicon hirsutum cDNA clone cLHT3...0 cSTD Solanum tuberosum cDNA clone cSTD13M7 5' sequence, mRNA sequence. 54 0.004 1 BF187223 |BF187223.1 EST443510 potato stolon, Cor...nell University Solanum tuberosum cDNA clone cSTA39F1 5' sequence, mRNA sequence. 5...Lycopersicon esculentum cDNA clone cLEG70A23 5' end, mRNA sequence. 54 0.004 1 BE353311 |BE353311.1 EST40044

  4. Dicty_cDB: VFF530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C15, mRNA sequence. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon escul...19042.1 EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone ...ST355887 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' en...sculentum cDNA clone cTOE2D11 5' sequence, mRNA sequence. 92 2e-16 3 AW217896 |AW217896.1 EST296610 tomato flower buds, anthesis, Cor...nell University Lycopersicon esculentum cDNA clone cTOD1

  5. Dicty_cDB: CFJ662 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available J PROTEIN. ;, mRNA sequence. 60 2e-05 2 BF595059 |BF595059.1 su63e08.y1 Gm-c1069 Glycine max cDNA clone GENOME SYSTEMS...-05 2 BE805892 |BE805892.1 ss62f10.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS... Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-3332 5' similar to TR:O...e max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1069-197 5' similar to TR:O24074 O24074 DNAJ-LIKE PROTEIN. ;, ...24074 O24074 DNAJ-LIKE PROTEIN. ;, mRNA sequence. 58 4e-05 2 BF424117 |BF424117.1 su46e03.y1 Gm-c1069 Glycin

  6. Dicty_cDB: AFF828 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06 Q9ZS06 RNA HELICASE ;, mR...NA sequence. 56 8e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE...yces exiguus. 38 1e-09 4 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLO...e 6225 from Patent WO02053728. 40 1e-07 4 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  7. Dicty_cDB: SFH857 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 73 |BU498573.1 PfESToab99a02.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium...4e-61 3 BU495626 |BU495626.1 PfESToab75e05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum c...5.1 PfESToab75e04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum...241.1 PfESToaa16c01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:PR...I670760 |BI670760.1 PfESToaa03h11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' si

  8. Dicty_cDB: CHR571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 32 0.002 3 BQ739501 |BQ739501.1 PfESToab46g04.y1 Plasmodium falciparum 3D7 asexual cDNA ...Plasmodium falciparum cDNA 5', mRNA sequence. 32 0.003 3 BQ596812 |BQ596812.1 PfESToab22h07.y1 Plasmodium falciparum 3D7 asexual...3 BU494691 |BU494691.1 PfESToab66c05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5'..., mRNA sequence. 32 0.003 3 BQ633658 |BQ633658.1 PfESToab45a03.y1 Plasmodium falciparum 3D7 asexual cDNA Pla...ab31c07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 32 0.003 3 B

  9. Dicty_cDB: AFE732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 26 |BU495626.1 PfESToab75e05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar...e04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' simil...16c01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:PRS4_HUMAN Q0352...98573.1 PfESToab99a02.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:...ubunit 4 of D. melanogaster, mRNA sequence. 163 2e-47 2 BI670760 |BI670760.1 PfESToaa03h11.y1 Plasmodium falciparum 3D7 asexual

  10. Dicty_cDB: CHR677 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Toac03h06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 38 0.093 2... BQ596676 |BQ596676.1 PfESToab21a07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5',... mRNA sequence. 38 0.093 2 BU496791 |BU496791.1 PfESToab58h08.y1 Plasmodium falciparum 3D7 asexual cDNA Plas...b77d04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 38 0.093 2 BQ...596343 |BQ596343.1 PfESToab32e07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mR

  11. Understanding Rotation about a C=C Double Bond

    Science.gov (United States)

    Barrows, Susan E.; Eberlein, Thomas H.

    2005-09-01

    In this article, twisting about the C=C double bond and the consequential pyramidalization of sp 2 carbon atoms in alkenes were examined in a molecular modeling study using trans -2-butene as a model system. According to our trans -2-butene model and other similar work, most of the strength of a π bond is retained upon twisting, even for remarkably large C C=C C dihedral angles (up to 90°). The phenomenon of sp 2 carbon atom pyramidalization and preservation of π bond strength upon twisting a C=C double bond is well established in the literature, but is rarely discussed in introductory textbooks. This absence is noteworthy because profound manifestations of this effect do occur in compounds that are covered in an introductory organic chemistry curriculum. We present a simple method of introducing the concept of a flexible C=C π bond into beginning organic chemistry courses. We report the energetic demands of partial twisting about the C=C bond in 2-butene as calculated using DFT, LMP2, and MCSCF methods. Finally, using the results of these calculations, we assessed the degree of strain introduced by the twisted nature of the C=C bond in trans cycloalkenes.

  12. Dicty_cDB: AFO611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2...79.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O657...7629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O2...4653 O24653 GDI2. ;, mRNA sequence. 56 5e-04 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...quence. 56 5e-04 1 AW306227 |AW306227.1 se47g11.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS

  13. Dicty_cDB: SFC277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ue N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184...5e-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-15...lycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP DISSOCIATION... INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...ON INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS

  14. Dicty_cDB: AFH834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...equence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS... sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE I...70 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar...37629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' simil

  15. Dicty_cDB: CFE844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA for GDP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEM...OR. ;, mRNA sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184...1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-15.... ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYST

  16. Dicty_cDB: AFJ402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA for GDP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS...;, mRNA sequence. 62 2e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEM.... ;, mRNA sequence. 62 2e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS... 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5...-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505

  17. Dicty_cDB: VFE739 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 46 0.88 1 AI900122 |AI900122.1 sc01b07.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1012-...878 5', mRNA sequence. 46 0.88 1 AW705505 |AW705505.1 sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS...AW705268 |AW705268.1 sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', m...RNA sequence. 46 0.88 1 BI317694 |BI317694.1 saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLON... CLONE ID: Gm-c1019-5952 5', mRNA sequence. 46 0.88 1 AI441512 |AI441512.1 sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTE

  18. Dicty_cDB: SFJ449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R. ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...TOR. ;, mRNA sequence. 62 4e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...-08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-218....1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1... inhibitor (gdi). 38 2e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTE

  19. 8C.02

    DEFF Research Database (Denmark)

    Jensen, B L; Frederiksen-Moller, B; Jorgensen, J S;

    2015-01-01

    by disturbed placentation, suppression of aldosterone and avid renal sodium retention with hypertension. It was hypothesized that preeclampsia is associated with low prostasin expression in placenta and spillover of prostasin into urine across the defect glomeular barrier. DESIGN AND METHOD: The hypothesis...... was addressed in a cross-sectional case-control design with 20 healthy pregnant women and 20 women with new onset of preeclampsia (hypertension and 1+ for protein on urine dipstick). Blood and urine samples were obtained in relation to delivery and placental biopsies were taken immediately after delivery...... to renal EnaC activation and suppression of aldosterone in preeclampsia. Potential impact of prostasin-matriptase on placental development is likely to be at the level of activity and not protein abundance....

  20. The 5C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche

    2014-01-01

    , and sketching. As teachers of philosophy of science and design methods at a design school, we are invested in the following question: How might we expand design students’ understanding of the many ways in which knowledge is produced during a design process? How can we help students actively experience......During a design process, designers produce knowledge in many ways. An ever-expanding field, design continuously includes new approaches from other fields such as anthropology, business, and innovation, which are implemented side by side with traditional design approaches e.g. prototyping...... the approaches and reach a new level of conscious action when designing? Informed by theories of design thinking, knowledge production, and learning, we have developed a model, the 5C model, accompanied by 62 method cards. Examples of how the model has been applied in an educational setting are provided...

  1. Hepatitis C: extrahepatic manifestations.

    Science.gov (United States)

    Metts, Julius; Carmichael, Lesley; Kokor, Winfred; Scharffenberg, Robert

    2014-12-01

    Chronic hepatitis C virus (HCV) infection is associated with multiple extrahepatic manifestations (EHM) affecting various organs in the body. Approximately 40% to 75% of patients with chronic HCV infection experience at least one clinical EHM during the course of the HCV infection. Mixed cryoglobulinemia (type 2) is the most documented EHM associated with chronic HCV infection. This has been documented in up to 50% of patients. Clinically, it presents as arthralgia, weakness, and cutaneous symptoms. Morphologically, immune complex depositions are identified in small vessels and glomerular capillary walls, leading to leukocytoclastic vasculitis in the skin and membranoproliferative glomerulonephritis in the kidney. In other EHMs of chronic HCV infection not related to cryoglobulinemia, such as Sjögren syndrome, lichen planus, and autoimmune thyroiditis, autoimmune processes resulting in chronic inflammatory infiltrates are thought to be the underlying mechanism.

  2. Mammalian phospholipase C.

    Science.gov (United States)

    Kadamur, Ganesh; Ross, Elliott M

    2013-01-01

    Phospholipase C (PLC) converts phosphatidylinositol 4,5-bisphosphate (PIP(2)) to inositol 1,4,5-trisphosphate (IP(3)) and diacylglycerol (DAG). DAG and IP(3) each control diverse cellular processes and are also substrates for synthesis of other important signaling molecules. PLC is thus central to many important interlocking regulatory networks. Mammals express six families of PLCs, each with both unique and overlapping controls over expression and subcellular distribution. Each PLC also responds acutely to its own spectrum of activators that includes heterotrimeric G protein subunits, protein tyrosine kinases, small G proteins, Ca(2+), and phospholipids. Mammalian PLCs are autoinhibited by a region in the catalytic TIM barrel domain that is the target of much of their acute regulation. In combination, the PLCs act as a signaling nexus that integrates numerous signaling inputs, critically governs PIP(2) levels, and regulates production of important second messengers to determine cell behavior over the millisecond to hour timescale.

  3. Dicty_cDB: VHA279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-14 4 EC388462 |EC388462.1 C05_C05gm3n9_pDNRf_491526 Myzus persicae, line G006, whole aphid library Myzus... persicae cDNA clone C05_C05gm3n9_pDNRf_491526, mRNA sequence. 58 4e-13 3 EC388376 |EC388376.1 B10_B10gm2a20_pDNRf_490797 Myzus... persicae, line G006, whole aphid library Myzus persicae cDNA clone B10_B10gm2a20_pDNRf_4

  4. Dicty_cDB: SHL861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA clone CeleSEQ14670, mRNA sequence. 60 9e-15 2 EH431847 |EH431847.1 NPE00000861 Neocallimastix patriciar...um ZAP II cDNA library Neocallimastix patriciarum cDNA, mRNA sequence. 48 2e-09 2...a elegans cDNA clone CeleSEQ9917, mRNA sequence. 56 1e-06 2 EH431298 |EH431298.1 NPE00000022 Neocallimastix ...patriciarum ZAP II cDNA library Neocallimastix patriciarum cDNA, mRNA sequence. 4

  5. Dicty_cDB: VSD185 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available and Malpighian tubule cDNA library Ctenocephalides felis cDNA clone 3254-25, mRNA sequence. 48 2e-06 2 BQ476622 |BQ476622.1 curculio...3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio...3e06 3', mRNA sequence. 46 0.46 1 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium cDNA Curc...ulio glandium cDNA clone curculio3e06 5', mRNA sequence. 46 0.46 1 AX345182 |AX345182.1 Sequence 253 from Pa

  6. Dicty_cDB: SSL256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NcEST3a21h12.y1 Nc 1314 Tachyzoite cDNA Neospora caninum cDNA 5' similar to TR:Q9ZNS3 Q9ZNS3 RIBOSOMAL PROT...EIN S27. ;, mRNA sequence. 36 0.27 2 BG235080 |BG235080.1 NcEST3a40b01.y1 Nc 1314 Tachyzoite cDNA Neospora c...9095.1 NcEST3a07a05.y1 Nc 1314 Tachyzoite cDNA Neospora caninum cDNA 5' similar t

  7. Dicty_cDB: AFA547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2264.1 EST263143 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES18L5, mRNA sequence. 74 ...e, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ19K24 5', mRNA sequence. 7...on esculentum cDNA clone cLEI7M10 5', mRNA sequence. 74 2e-09 1 AW626316 |AW626316.1 EST320223 tomato radicl

  8. Dicty_cDB: SFB381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 42 0.14 2 AW279403 |AW279403.1 sf79b03.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS...equence from clone CH211-188I17. 38 0.28 3 BI702238 |BI702238.1 sag44a03.y1 Gm-c1081 Glycine max cDNA clone GENOME SYSTEMS...4 0.30 2 BG156272 |BG156272.1 saa73f04.y1 Gm-c1063 Glycine max cDNA clone GENOME SYSTEMS

  9. Dicty_cDB: SHG549 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 788 |BU494788.1 PfESToab67g03.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA ...9.1 PfESToab48c05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum...U497188.1 PfESToab56a10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to T

  10. Dicty_cDB: VSG678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Toab94h09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_PLAFA P3...2 |BI815642.1 PfESToaa31a10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium ...8e-41 5 BI815554 |BI815554.1 PfESToaa29h11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum c...2295 |BQ452295.1 PfESToaa94h01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodi

  11. Dicty_cDB: VFD577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM158719.1 NXLV_039_C05_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA cl...tical) Pinus taeda cDNA clone NXLV_039_C04 5', mRNA sequence. 46 0.017 2 BM158719 |...p library Pinus taeda cDNA clone ST11A05, mRNA sequence. 46 0.016 2 BM158718 |BM158718.1 NXLV_039_C04_F NXLV (Nsf Xylem Late wood Ver

  12. Dicty_cDB: VHC552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available estuca arundinacea cDNA, mRNA sequence. 58 3e-04 1 CJ845953 |CJ845953.1 Triticum aestivum cDNA clone:whatlal...39n16, 3' end. 58 3e-04 1 CJ787559 |CJ787559.1 Triticum aestivum cDNA clone:whatl18a10, 3' end. 58 3e-04 1 C...J787558 |CJ787558.1 Triticum aestivum cDNA clone:whatl18a09, 3' end. 58 3e-04 1 C

  13. Dicty_cDB: AFA816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744 O657...4653 GDI2. ;, mRNA sequence. 62 4e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...ce. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...ence. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...OCIATION INHIBITOR. ;, mRNA sequence. 44 9e-06 3 BI426472 |BI426472.1 sag03f09.y1 Gm-c1080 Glycine max cDNA clone GENOME SYSTEMS

  14. Dicty_cDB: SFE141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gdi). 38 6e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...equence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:...10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' s...8c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O6574...4 GDP DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 5e-07 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYS

  15. Dicty_cDB: SLI838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-09 4 AW306469 |AW306469.1 se51b09.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-241...8 5', mRNA sequence. 34 4e-04 3 BF008963 |BF008963.1 ss71e08.y1 Gm-c1062 Glycine max cDNA clone GENOME SYSTEMS...899992 |AI899992.1 sb97c10.y1 Gm-c1012 Glycine max cDNA clone GENOME SYSTEMS CLON...E ID: Gm-c1012-619 5', mRNA sequence. 34 7e-04 3 AW394993 |AW394993.1 sh38b07.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS...uence. 34 8e-04 3 AI759854 |AI759854.1 sb65b12.y1 Gm-c1017 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G

  16. Dicty_cDB: SFA175 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : (bits) Value N BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: G...equence. 62 6e-08 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID:...1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O65744 GDP ...DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS...P DISSOCIATION INHIBITOR. ;, mRNA sequence. 62 8e-06 1 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEM

  17. Interstellar detection of c-C3D2

    CERN Document Server

    Spezzano, S; Schilke, P; Caselli, P; Menten, K M; McCarthy, M C; Bizzocchi, L; Trevino-Morales, S P; Aikawa, Y; Schlemmer, S

    2013-01-01

    We report the first interstellar detection of c-C3D2. The doubly deuterated cyclopropenylidene, a carbene, has been detected toward the starless cores TMC- 1C and L1544 using the IRAM 30m telescope. The J(Ka,Kc) = 3(0,3)-2(1,2), 3(1,3)-2(0,2), and 2(2,1)-1(1,0) transitions of this species have been observed at 3 mm in both sources. The expected 1:2 intensity ratio has been found in the 3(0,3)-2(1,2) and 3(1,3)-2(0,2) lines, belonging to the para and ortho species respectively. We also observed lines of the main species, c-C3H2, the singly deuterated c-C3HD, and the species with one 13C off of the principal axis of the molecule, c-H13CC2H. The lines of c-C3D2 have been observed with high signal to noise ratio, better than 7.5 sigma in TMC-1C and 9 sigma in L1544. The abundance of doubly deuterated cyclopropenylidene with respect to the normal species is found to be (0.4 - 0.8)% in TMC-1C and (1.2 - 2.1)% in L1544. The deuteration of this small hydrocarbon ring is analysed with a comprehensive gas-grain model, ...

  18. C. Gordon Fullerton

    Science.gov (United States)

    1989-01-01

    C. Gordon Fullerton is a research pilot at NASA's Dryden Flight Research Center, Edwards, California. His assignments include a variety of flight research and support activities piloting NASA's B-52 launch aircraft, the 747 Shuttle Carrier Aircraft (SCA), and other multi-engine and high performance aircraft. Fullerton, who has logged 382 hours in space flight, was a NASA astronaut from September 1969 until November 1986 when he joined the Flight Crew Branch at Dryden. In July 1988, he completed a 30-year career with the U.S. Air Force and retired as a colonel. As the project pilot on the NASA B-52 launch aircraft, Fullerton flew during the first six air launches of the commercially developed Pegasus space vehicle. He was involved in a series of development air launches of the X-38 Crew Recovery Vehicle and in the Pegasus launch of the X-43A Hyper-X advanced propulsion project. Fullerton also flies Dryden's DC-8 Airborne Science aircraft, regularly deployed worldwide to support a variety of research studies, including atmospheric physics, ground mapping and meteorology. In addition to these current activities, Fullerton has been involved in numerous other research programs at Dryden. He was the project pilot on the Propulsion Controlled Aircraft program, during which he successfully landed both a modified F-15 and an MD-11 transport with all control surfaces neutralized, using only engine thrust modulation for control. Assigned to evaluate the flying qualities of the Russian Tu-144 supersonic transport during two flights in 1998, he reached a speed of Mach 2 and became one of only two non-Russian pilots to fly that aircraft. He piloted a Convair 990 modified to test space shuttle landing gear components during many very high-speed landings. Other projects for which he has flown in the past include the C-140 JetStar Laminar Flow Control; F-111 Mission Adaptive Wing; F-14 Variable Sweep Flow Transition; Space Shuttle drag chute and F-111 crew module parachute tests

  19. Metal-Free Oxidative C-C Bond Formation through C-H Bond Functionalization.

    Science.gov (United States)

    Narayan, Rishikesh; Matcha, Kiran; Antonchick, Andrey P

    2015-10-12

    The formation of C-C bonds embodies the core of organic chemistry because of its fundamental application in generation of molecular diversity and complexity. C-C bond-forming reactions are well-known challenges. To achieve this goal through direct functionalization of C-H bonds in both of the coupling partners represents the state-of-the-art in organic synthesis. Oxidative C-C bond formation obviates the need for prefunctionalization of both substrates. This Minireview is dedicated to the field of C-C bond-forming reactions through direct C-H bond functionalization under completely metal-free oxidative conditions. Selected important developments in this area have been summarized with representative examples and discussions on their reaction mechanisms. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Dicty_cDB: SHL244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tlf iwl*krsktk*klfl*frkeii*tpth*mlfqrty*lntiskfksnniqf*ikpkpnspi ynqiinlylvivfvlvsshlqylstifffyf*yi*nk*ink*k...skfksnniqf*ikpkpnspi ynqiinlylvivfvlvsshlqylstifffyf*yi*nk*ink*kksk*llnyflnf Frame C: c*fsiqg*tl*lyl*ylfftrn

  1. Dicty_cDB: VFI753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vqeyiisndfennynvtisriiniryke diik*f**hikaswkilkn*nhqklh*ykfikntf Frame C: fkffqs*k*lysvikwyhkakmm*kyn*myknisyqmilk...*lysvikwyhkakmm*kyn*myknisyqmilkiitm*qfqelltfdikk i**nsfnnt*klhgkf*kiktikncininslkih Homology vs CSM-cDNA Sc

  2. Dicty_cDB: VSJ363 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available slfl*fllyl*vf*c*kfqlq *wkkyqmknf Frame C: *fynhsfiisysstffnffkfnrlyinfimeyifyn*sccrwtkntifr*tre*r*iy*p rimeet...hsfiisysstffnffkfnrlyinfimeyifyn*sccrwtkntifr*tre*r*i y*primeetlsssklfl*nndaldnlf

  3. Hemoglobin C, S-C, and E Diseases

    Science.gov (United States)

    ... Anemia Vitamin Deficiency Anemia Anemia of Chronic Disease Aplastic Anemia Autoimmune Hemolytic Anemia Sickle Cell Disease Hemoglobin C, S- ... Anemia Vitamin Deficiency Anemia Anemia of Chronic Disease Aplastic Anemia Autoimmune Hemolytic Anemia Sickle Cell Disease Hemoglobin C, S- ...

  4. Dicty_cDB: VHG547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: tatnykw*ctkscein*fnythfkiiwciwtfw*****ytiidisnysskw*kytnak** wysfikcrwindysrfirftifkqftictiircfkystlysyt...lium discoideum cDNA clone:dda53e21, 5' ... 1191 0.0 1 ( AC116984 ) Dictyostelium discoideum chromosome 2 ma

  5. Dicty_cDB: SHC315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence ---QFGXRLFNDYQGXXKTXSTARTSXLAFEQLXKXCXXFDLYXKEKYQXAXXXXENLEI LXXFXSEIXSXXQDYXFLSPHIXXXFF...XKXCXXFDLYXKEKYQXAXXXXENLEI LXXFXSEIXSXXQDYXFLSPHIXXXFFXI Frame C: ---nlvxdysmiikvxxkxpqqqepvx*plsnx*nxaxxlt...ytxkksixrqxkxxkiwkf xqxlxqksiqxxkixxsfxhislxxffxs Homology vs CSM-cDNA Score E Sequences producing significa

  6. Dicty_cDB: VFH554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

  7. Dicty_cDB: VFM647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst

  8. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  9. Dicty_cDB: CHQ769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al

  10. Dicty_cDB: SSF506 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kki Frame B: ---iiiiiiiiiiapiliktqanikk*sin*lilfi*ikkkh*ivnysknfkitnlrk* Frame C: ---*********slpf*skprris...ksdqsin*yclyeskknik**iivkilksli*en Homology vs CSM-cDNA Score E Sequences producing

  11. C-SiC Honeycomb for Advanced Flight Structures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed project is to manufacture a C-SiC honeycomb structure to use as a high temperature material in advanced aircraft, spacecraft and industrial...

  12. Dicty_cDB: VSF150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce *c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thfwl lcftrr*lhclwflqrwfr*nckpsrywwnfngiprqylisftt...QGKXLXVX Frame B: *c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thfwl lcftrr*lhclwflqrwfr*nckpsryww

  13. Dicty_cDB: VSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftrr*lhclwf...GXTXNPXEIGGTSXEXQXKXXLVLQQNGNXERLSXFXPDXGPNKKN Frame B: ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftr

  14. Dicty_cDB: SSK118 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAA sequence update 1999. 4.21 Translated Amino Acid sequence fyiitkiyf***nvfsskynlli*c*wyinktkkcnytrnerffsr...fsskynlli*c*wyinktkkcnytrnerffsriknqs*irccwwfr y**d*rtir*kly**iplsic*kwfiif*RSLLATQDIKKFLGEENIKKFINFVLHYIAD

  15. Alkali metal mediated C-C bond coupling reaction.

    Science.gov (United States)

    Tachikawa, Hiroto

    2015-02-14

    Metal catalyzed carbon-carbon (C-C) bond formation is one of the important reactions in pharmacy and in organic chemistry. In the present study, the electron and hole capture dynamics of a lithium-benzene sandwich complex, expressed by Li(Bz)2, have been investigated by means of direct ab-initio molecular dynamics method. Following the electron capture of Li(Bz)2, the structure of [Li(Bz)2](-) was drastically changed: Bz-Bz parallel form was rapidly fluctuated as a function of time, and a new C-C single bond was formed in the C1-C1' position of Bz-Bz interaction system. In the hole capture, the intermolecular vibration between Bz-Bz rings was only enhanced. The mechanism of C-C bond formation in the electron capture was discussed on the basis of theoretical results.

  16. Dicty_cDB: VSA556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 215 |CF423215.1 NcEST3d69b03.y1 Nc-LIV Tachyzoite cDNA Library Neospora caninum c... BF824319 |BF824319.1 NcEST3a21h12.y1 Nc 1314 Tachyzoite cDNA Neospora caninum cD...cEST3a40b01.y1 Nc 1314 Tachyzoite cDNA Neospora caninum cDNA 5' similar to TR:Q9ZNS3 Q9ZNS3 RIBOSOMAL PROTEI...N S27. ;, mRNA sequence. 36 0.080 2 BF249095 |BF249095.1 NcEST3a07a05.y1 Nc 1314 Tachyzoite cDNA Neospora

  17. Dicty_cDB: AFM381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame B: yikl**ndrkscs*nh*ctrcywpiqssnyc*qssfrfwlfry**ryyaihi*n*c*ysn *tcfnkhekhc*scwfingksc*nyhliking*fpsc...wpiqssnyc*qssfrfwlfry**ryyaihi*n*c* ysn*tcfnkhekhc*scwfingksc*nyhliking*fpsc*hclf

  18. Dicty_cDB: VSF418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fry**ryyaihi*n*c*ysn*tcfnk hekhc*scwfingksc*nyhliking*fpsc*hclfyflps*pts*inlccclftkecfs rn*sycnspmnrg*ik*yhq...fkiinnk**vivysiivkkn*niiivfilfpnikkk--- ---ndrkscs*nh*ctrcywpiqssnyc*qssfrfwlfry**ryyaihi*n*c*ysn*tc fnkhekhc*scwfingksc*nyhliking

  19. Dicty_cDB: AFB425 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *c*ys*rfiw*cciirwynyvpryc*sye*rinctctixneny Translated Amino Acid sequence (All Frames) Frame A: iikqlkrf*ly...PHAI--- ---ILKXRMQXXSLIICIRXII*itrwssyxxw**tfplsrstfpxiilgygvcwys*nn l*fnhem*c*ys*rfiw*cciirwynyvpryc*sye*rinctctixneny

  20. Dicty_cDB: AFB770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c fhrfrw*ryqsyv*s*twysfwxc*tiipsiscxftcxlsfxls Translated Amino Acid sequence (All Frames) Frame A: ttlqkdnn...grpfefkdrclwlss*s*kirsl*yhqic fhrfrw*ryqsyv*s*twysfwxc*tiipsiscxftcxlsfxls Frame C: nttkrq*LLIRMVLQFVDDSSCKX

  1. Dicty_cDB: VFF382 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esc...root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clon...i cDNA clone cLPP8K18 5' sequence, mRNA sequence. 92 3e-15 2 BG642411 |BG642411.1 EST355887 tomato flower buds, anthesis, Cornell... flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequence. 92 2e... esculentum cDNA clone cTOE2D11 5' sequence, mRNA sequence. 92 2e-16 3 AW217896 |AW217896.1 EST296610 tomato

  2. Dicty_cDB: SFI706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42 0.036 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER1...NA clone cTOF19D15 5' sequence, mRNA sequence. 38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Corn...lone cTOE14I10 5' sequence, mRNA sequence. 38 0.10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Corn...ell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic acid 4-hydroxyla...ell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38 0.10 2 AE003601 |

  3. Dicty_cDB: CHE157 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1.1 C.elegans cDNA clone yk106c6 : 3' end, single read. 48 3e-08 2 CO004167 |CO004167.1 EST792502 Coccidioides posadas...ii spherule cDNA library, 0.4 to 2.3 kb Coccidioides posadasii cDNA clone CIEAH80 5' end, mRNA seq...uence. 70 1e-07 1 CO003886 |CO003886.1 EST792221 Coccidioides posadasii spherule ...cDNA library, 0.4 to 2.3 kb Coccidioides posadasii cDNA clone CIEAG23 3' end, mRNA sequence. 70 1e-07 1 CO01...1999 |CO011999.1 EST800334 Coccidioides posadasii spherule cDNA library, 0.4 to 2.3 kb Coccidioides posadasi

  4. Dicty_cDB: AFF346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lveslkifkvimknknmlhqkklkmlklh*inklkvllkv ikln*n Frame C: iyqtkyaypscwrnpr*cskpisr...ks*kc*c*r*rr*n*glccrtt*wgsnkrkwrrrrt kn*rrfkssirtkg*kn*ntkeykyfsfr*ywcw*kyiyfxigklfei*iigtsyescqf g*cchhs**s

  5. Dicty_cDB: VHO845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available te 2002.10.25 Translated Amino Acid sequence ntsdfigrkgsglkflhhrmgy*gnrs*sgtsiggrgrvifsc*hclgvlrirstgdeds sh...c*kendlqqt*rrrrrwfr*keglqhskrpnrcln lliynl*lk**ixkkyltff*k* Frame C: ntsdfigrkgsglkflhhrmgy*gnrs*sgtsiggrgrv

  6. Dicty_cDB: AFJ756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N BM094322 |BM094322.1 saj14a08.y1 Gm-c1066 Glycine max cDNA clone GENOME SYSTEMS...lycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-455 5' similar to TR:O04336 O04336 ELICITOR RESPONSE... Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1060-684 5' similar to TR:O0...Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-5007 5' similar to TR:Q9ZUI7 Q9ZUI7 T2K10.11 PROTEI

  7. Dicty_cDB: VSG353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CQQNQYHLNLKKPKIS*ksl r*yhhsc*kqesqg*gsnpypkqslknhhp*ksmw*rykhlgsfrnenpqtchphlihpr frqgnehhlnrswr*c*shhe*krsq...SCQQNQYHLNLKKPKIS*ksl r*yhhsc*kqesqg*gsnpypkqslknhhp*ksmw*rykhlgsfrnenpqtchphlihpr frqgnehhlnrswr*c*shhe*krs

  8. Dicty_cDB: SSL156 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TI RGTDYKAPHGIPLDLLDRLLIINTQPYTERKRYLQNFKDSL*rrgcrysrgcittfn*nw c*nftslcnssnhfffisic*kkry*cfs**y*ksl*lic*cqk...WKEEGKAEIVPGVLFIDEVHMLDIECFSYLNRALEDDMSPILIIATNRGNTTI RGTDYKAPHGIPLDLLDRLLIINTQPYTERKRYLQNFKDSL*rrgcrysrgcittfn*nw c*nftslcnssnhfffis...ic*kkry*cfs**y*ksl*lic*cqkiykifkrlsr*ifi*f strnnsnkn**rt

  9. Demonstration of SiC Pressure Sensors at 750 C

    Science.gov (United States)

    Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender

    2014-01-01

    We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

  10. Dicty_cDB: SHI732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNATTTTNATTTTATTTTAAAAAAAAAAXXXXXXXXX X sequence update 2002.10.25 Translated Amino Acid sequence fsiln*ss**fntnfilfyeni...ame C: fsiln*ss**fntnfilfyenieknnnnynyl*LNLYIFIDKKKXIKKKXKXKXXLXNQI LXFXFXFXFXFYFKKK--- Homology vs CSM-cDNA

  11. Dicty_cDB: VFA553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 |BI815436.1 PfESToaa18f03.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar ...|BQ633402.1 PfESToab41e01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to...Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to T...asmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to TR:O15918 O15918 ADENYLOSUCCIN...ATE LYASE ;, mRNA sequence. 58 2e-04 1 BU496038 |BU496038.1 PfESToac03a07.y1 Plasmodium falciparum 3D7 ase

  12. Dicty_cDB: SLJ890 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 40 1e-04 2 BQ7395...48 |BQ739548.1 PfESToab47d01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA s...278.1 PfESToab95b07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. ...40 2e-04 2 BU498442 |BU498442.1 PfESToab97c07.y1 Plasmodium falciparum 3D7 asexual...70537 |BI670537.1 PfESToaa01b07.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmod

  13. Dicty_cDB: VSK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3139.1 PfESToab38c04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence.... 36 0.024 2 BU496524 |BU496524.1 PfESToab51c12.y1 Plasmodium falciparum 3D7 asexual... cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 36 0.026 2 BU496772 |BU496772.1 PfESToab58f06.y1 Plasmodium falciparum 3D7 asex...ual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 36 0.027 2 AX348891 |AX34889

  14. Dicty_cDB: VSD229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_PLAFA P38545 GTP-B...2.1 PfESToaa31a10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_...29h11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' sim...2295.1 PfESToaa94h01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:R

  15. Dicty_cDB: VSF637 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N BQ633139 |BQ633139.1 PfESToab38c04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparu...6772.1 PfESToab58f06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence....asmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence. 38 0.002 2 BU496772 |BU49...m 3D7 cDNA 5', mRNA sequence. 38 0.002 2 BU496524 |BU496524.1 PfESToab51c12.y1 Pl

  16. Dicty_cDB: AFO346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cted Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clo...eld-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-82_F01 5',

  17. Dicty_cDB: AFN648 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA ... field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-82_F01 5

  18. Dicty_cDB: VFH415 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ekyas*isfr*sik*f*kcieirsnqyisdgynrrdxsre--- Frame B: KNMHREYHFDKALSSFENALKLDPINTLVMDTIGEXLV...EN--- Frame C: kicivniisikh*vvlkmh*n*iqsih**wiqserx**rm--- Homology vs CSM-cDNA S

  19. Dicty_cDB: SSC635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKKKKXEKKKGKKXKKKKKEKKKFF GFFLFSPKLN*l--- Frame C: hrhhk*kkkkptitttttttttsttttttttk*l*ykr*fl**ingdgryewc*ct*...sik kknnkkkklkkegiirm*ssikh*nlmikkkkkkkkrkkkxkkkkekxekkkkrkkknsl vfsffpqn*in*--- Homology vs CSM-cDNA Score

  20. Dicty_cDB: SSB838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iarum ZAP II cDN... 48 7e-12 4 ( EH431537 ) NPE00000865 Neocallimastix patriciarum ...ctyostelium discoideum slug cDNA, clone SSB838. 476 e-130 1 ( EH431785 ) NPE00000438 Neocallimastix patric

  1. Dicty_cDB: CFE676 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence update 2001. 6. 1 Translated Amino Acid sequence SIWVCCMHIIIGCFFYYIKYNNK**k*hsthrnnkqanikik*nkif*ekkkkf...k-- - Frame C: SIWVCCMHIIIGCFFYYIKYNNK**k*hsthrnnkqanikik*nkif*ekkkkfgxk--- Homology vs CSM-cDNA Score E Seq

  2. Dicty_cDB: SHF860 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAT sequence update 2002.10.25 Translated Amino Acid sequence flvllls*c*gvslplcfalls...sitflcnslkcissl*qk kifkkk--- ---LFGASVKIMIRCLXPPLLCITLLKLR*srapltmllkypqg*sitflcnslkcissl *qkk Frame B: flvllls*c*gvslplcfalls...sssdnlelh*rcsssilrvnpshsyatlsnv*AVFNKK KYLKKK--- ---flvlllr***gvxxplcfalls

  3. Dicty_cDB: VSA585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2000. 2.21 Translated Amino Acid sequence ---kllklsfyflvllls*c*gvslplcfallssssdnl... Acid sequence (All Frames) Frame A: ---kllklsfyflvllls*c*gvslplcfallssssdnlelh*rcsssilrvnpshsyat lsnv*AVFNQ

  4. Dicty_cDB: SSM844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycw*icl*n*kaydqs*c*kshlfvc**yyptnccfnfsnl*tl*g*rwifihylqw *kyfw**fityynp*mysctlrerrppnvyrskq**fak*METLISFSYD...e A: s*yycw*icl*n*kaydqs*c*kshlfvc**yyptnccfnfsnl*tl*g*rwifihylqw *kyfw**fityynp*

  5. Dicty_cDB: CHQ621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LELVSNYLNVSSPPTNFHSYLNSISLKAESSPR*nfnskstifftnlkn Translated Amino Acid sequence ...QGVFDLLDRLNPNHFAVSVGKKKSYTKYFVNNQ NQVLSMLELVSNYLNVSSPPTNFHSYLNSISLKAESSPR*nfnskstifftnlkn Homology vs CSM-cD

  6. Dicty_cDB: VSE856 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LRTKNKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVFN QTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFA VKA*ici*milk...KNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFA VKA*ici*milknkiy*kk Frame C: klkllnsepktrlnylntsrn

  7. Dicty_cDB: VSC875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVF NQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milk...YSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy* Frame C: kklkllnsepktrlnylntsrnselssqv*

  8. Dicty_cDB: VSG886 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TKAFELRTKNKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLT VFNQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQR VFAVKA*ici*milk...NQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQR VFAVKA*ici*milkn--- Frame C: wpkklkllnsepktrlnyln

  9. Dicty_cDB: CHR344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 576.1 NF031C11ST1F1000 Developing stem Medicago truncatula cDNA clone NF031C11ST 5', mRNA sequence. 42 4.0 1... GR__Ea21F12.f GR__Ea Gossypium raimondii cDNA clone GR__Ea21F12 5', mRNA sequence. 42 4.0 1 AW690576 |AW690

  10. Dicty_cDB: VHM688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GSSGSGGSIVGDLPPELQGDKLQQGIQRPQFKRQPSRSDINDESN LDQQQQTDGRFNRGGQQQIPPQQPQPQQQQQQPQPQQYQTNYQRDRIYNQDYRGSGRTYS TTNQYEDDSNNNNNGSGSGGGXIEEE...PQQYQTNYQRDRIYNQDYRGSGRTYS TTNQYEDDSNNNNNGSGSGGGXIEEEIKFIIIIKRDSIGXKRKKKKIKK* Homology vs CSM-cDNA Score E S

  11. Dicty_cDB: VFN350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2001.11.22 Translated Amino Acid sequence iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaick... C: iilhpitnkmsfnsrietisrhlstgpilesnptsgsvksgddivivapfrtaickakrg afketapddllapvikhiikvtkldpn*LEMLLWEQYYQDHHK

  12. Singlet H-cCNC-C:A Potential Interstellar Molecule

    Institute of Scientific and Technical Information of China (English)

    Hai Tao YU; Ming Xia LI; Hong Gang FU; Bai Fu XING; Jia Zhong SUN

    2004-01-01

    A new planar isomer of HNC3 system, H-cCNC-C, is theoretically predicted by means of B3LYP and CCSD(T) methods. The suggested species can isomerize into other five kinetically more stable isomers, which have been experimentally identified, with relatively higher reaction barriers. In view of its higher kinetic stability, we can reasonably believe that the obtained species H-cCNC-C can be experimentally observed in future studies.

  13. Dicty_cDB: VSI673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IYKDKKAQLVTLPGAKGIFGVAKNHVPRIAELKPGVIQINHENGDLEKFFISGGFAFVN PDASCYINTIEAVPIDQLDAEGS*kwfklvtlnstmmlkrenakaval...FISGGFAFVN PDASCYINTIEAVPIDQLDAEGS*kwfklvtlnstmmlkrenakavaligletyqqmgic lwc Frame C: slfnsykktsnnke*sdqllnqa

  14. Dicty_cDB: VHD237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PENAIGGIYSVLNRRRGIVIGEERRIGSPLFSVKAHLPVLESFGFTADLRSHTAGQAFPQ CVFDHWASIGVVNKDKKATEVALATRKRKGLAPEIPDLDKFHEKL*ti*vahxfsnies...VLESFGFTADLRSHTAGQAFPQ CVFDHWASIGVVNKDKKATEVALATRKRKGLAPEIPDLDKFHEKL*ti*vahxfsniesn lk Frame C: vqkk*stkwlis

  15. Dicty_cDB: VSB133 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 12191 |BQ512191.1 EST619606 Generation of a set of potato cDNA clones for microarray analyses mixed potato t...0 |BQ512190.1 EST619605 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissu...8865.1 EST556401 potato roots Solanum tuberosum cDNA clone cPRO2F7 5' end, mRNA sequence. 52 2e-14 4 BQ51219

  16. Dicty_cDB: CFF880 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2191 |BQ512191.1 EST619606 Generation of a set of potato cDNA clones for microarray analyses mixed potato ti... |BQ512190.1 EST619605 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissue...8865.1 EST556401 potato roots Solanum tuberosum cDNA clone cPRO2F7 5' end,mRNA sequence. 52 9e-14 4 BQ512190

  17. Dicty_cDB: CFJ554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: ---LFPHCSENXLXXXQREXTTXPXRNXPRXGHXSALXXXXRXXXXRPSCTN Frame B: ---sfltvpktxxxxprexxqhxpxexnqdxdtxahxxxxxxxxxx...ghlvq Frame C: ---lsslfrkxaxxxperxxntpx*kxtkxwtlxrtxxxxsxxxxxailyk Hom

  18. Dicty_cDB: CFH318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ence (All Frames) Frame A: ---VXQXXLXXGIFXSXXVXKPGIFXIXXXGTGAXPGACWKLKKXAKXKXXXX Frame B: ---xxxxxxxxgfsfpxxxknpgflxlxxx...glgpxxghvgn*kxxxkxxsix Frame C: ---xxxxxxxxdfxfxxsxktrdf*xxlxxdwgpsxgmleiekxxxx

  19. Dicty_cDB: CHA554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIQILNSYFIFLYIVTFHKKKKKKKNLKXXXFXKKK--- ---xxxxxxxxxxxxxxxxxxxxvxxxmsxxxxxcxg*xwxxlcxxxxrxixr*fixrxi rwssr F...GXS GGHP Frame C: ihfyytnikfifyfsiycnis*kkkkkkkfkxxxfxkkk--- ---xxxxxxxxxxxsxxxxxxscxxxyvxlxxxvxrivmxxx

  20. Dicty_cDB: CHA864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ---XXXXXXXXXXXXXXXXXXXXXXMXXXIEXXXAAXESXXHGSXXFXYIMRDGXLERXX Frame B: ---xxxxxxxxxxxlxxxxxxxxxxcxvx*rxxx...qqxspxxmdxpfsxil*emvnwkexx Frame C: ---xxxxxxxxxvxxxxxxxxxxxxaxxyre

  1. Dicty_cDB: SFH756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PVSDNQ CQCSVGFSGDDCRQCDNGMVLWASDNGIPMCSPLNSLGKPKTCYAAY Frame B: ---xxxxxxxxxxxxxxxxxxkxxxxx*xxivnwhxxqvlvgsl...vhh*ihwvnqkpvmll Frame C: ---xxxxxxxxkxxxxxxxaxxxxxxxsxx*xigxxxkc*wvrfxk*lyvlxv*w

  2. Dicty_cDB: SSL266 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NXGDRXNVYXDFSYFFFFFKKKKQTKQVYFHFFFFKKKAIL S*minkeiffqfinpikl*iiniffiqkkkkkkk Translated Amino Acid sequence ...FSYFFFFFKKKKQTKQVYFHFFFFKKKAIL S*minkeiffqfinpikl*iiniffiqkkkkkkk Frame C: qiinth

  3. Dicty_cDB: VHO714 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ated Amino Acid sequence kccstinptfmink*KRREKKMNVKEMDFNDLSNKSNQIINRISSFSSPIGLSSFNIERN LQEIGDTSKQLNDLTSSKTPFS...sxkhtltsllnxxxx*xtltx Frame C: kccstinptfmink*KRREKKMNVKEMDFNDLSNKSNQIINRISSFSSPIGLSSFNIERN LQEIGDTSKQLNDLTS

  4. Dicty_cDB: SSF826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LGGSMVKQPFAIGGSGSTYIYGYCDSKFKPKMTKDECIEFVQNSLALAMFRDGSSGGV IRLCIIDKNGVERKMIPGNNLPRFWEG*fsni*imiginhayniivkk*... IRLCIIDKNGVERKMIPGNNLPRFWEG*fsni*imiginhayniivkk*lkkn Frame C: ---li*vlllwq*nmmvvllwvqiqelplvhisqielqtklpqf

  5. Dicty_cDB: VFH144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA sequence. 42 8e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c...A sequence. 56 0.001 1 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER-resi...dent chaperone calreticulin, mRNA sequence. 56 0.001 1 C

  6. Dicty_cDB: SHL834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hoI) Cunninghamella elegans cDNA clone CeleSEQ14670, mRNA sequence. 56 1e-13 2 EH431847 |EH431847.1 NPE00000861 Neocallimas...tix patriciarum ZAP II cDNA library Neocallimastix patriciarum cDN...ein (Gph1) mRNA, complete cds. 68 3e-07 1 EH431298 |EH431298.1 NPE00000022 Neocallimastix patriciarum ZAP II cDNA library Neocallimas

  7. Dicty_cDB: VHA861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence. 80 2e-18 3 EH431344 |EH431344.1 NPE00000880 Neocallimastix patriciarum ZAP II cDNA library Neocallimas... Arachis stenosperma cDNA 5', mRNA sequence. 92 3e-14 1 EH431853 |EH431853.1 NPE00000476 Neocallimastix patr...iciarum ZAP II cDNA library Neocallimastix patriciarum cDNA, mRNA sequence. 74 4e-14 2 AL116011 |AL116011.1

  8. Dicty_cDB: VFA149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence lpiyxlniggishrfqixdktstsytlqfhgskipvtvlspeedllcqympvkktvdssn slispmpgtilslav...VEAMKMQNVLRAPKDC*iksinvkpvk sflx*vxxf Frame C: lpiyxlniggishrfqixdktstsytlqfhgskipvtvlspeed

  9. Dicty_cDB: SFD878 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ftinefnsmwwwlwk writrwswwsrwwsscwywcncwfcftrsrfhfnwrfkqlwl*lklknykyilnklkink v*lf...vnvkkk--- ---ytkqnknktkqnk*ndnlrfnlfnw*c*infkik*fiiiikfiifftinefnsmwww lwkwritrwswwsrwwsscwywcncwfcftrsrfhfn

  10. Dicty_cDB: SSF313 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nts: (bits) Value N BF298113 |BF298113.1 060PbD12 Pb cDNA #17, Tommaso Pace, Marta...D05 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequence. 52...BF295739 |BF295739.1 027PbF11 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei

  11. Dicty_cDB: VHJ628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lasmodium falciparum MAL3P7. 38 0.058 3 BF298113 |BF298113.1 060PbD12 Pb cDNA #17, Tommaso Pace, Marta Ponzi...cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5..., and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequence. 38 0.071 2 BF298182 |BF298182.1 061PbD05 Pb

  12. Dicty_cDB: SHH587 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fpivntksyhsfisk nqrrtwimvisitskske--- Frame C: STPTQTRHHSVLSRNPSYTSLKSSGGFSKPSPSSSTSTPPSTFASPLSIAQTSSTTTTTT ...y yhhhhyifffntttikskqfniinsikfkyry*tk*ycn*r*fnrintrfimefkyremv csfrgyalfiqe*iietigsirdysfgesnlct*nqrnfhnsrf*

  13. Dicty_cDB: SHK532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mtmmlgrkyqrnh*lihqrnyvilhshlminq *tfgf*wvivkrmnwlhwvklkplhqvpslnihsfqplklvpliihst...scvmvi*vvmlk lmfqlisliihvhynfnhyhvfnnnlyhhkeklvmlqmmiatmmklqtknqmiqfnknnn nnkqlsknnnk Frame C: ---rcrw**n*rl

  14. Dicty_cDB: CFE781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence NGDEAMSNGAAFYAASLTHYFKVKEIKLKDILLNSVDVEINNNIINSGGAGETLLEETE- -- ---ELDKTSAWLSDALDNDNTETEEXRKQLKDIKKKA...*iqis*lfkrftn Frame C: mvmkqcqmvlhfmqqv*hiilklkklnlkify*iqlmlkliii*livavlvkly*kklk- -- ---ELDKTSAWLSDALDNDNTETEEX

  15. Dicty_cDB: SLA466 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mmsrtfwqi*sswlklvkpmnns sdfskmpsyslaispmimslrsswktgrpplsrwqrvqrdvvsfvpppkl*lilkvvnly sdsfqrqvnsfk**fwiktlnll...C: qmspi*sylnvitivwke*wklvslerkpmtkpkrlsmmsrtfwqi*sswlklvkpmnns sdfskmpsyslaispmims

  16. Dicty_cDB: CHS164 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2_A029 Roots minus micronutrients Pinus taeda cDNA clone RTMNUT1_37_B06_A029 5', mRNA sequence. 54 2e-11 4 C...icon esculentum cDNA clone cLEG49G24 5' end, mRNA sequence. 58 7e-12 2 DR181209 |DR181209.1 RTMNUT1_37_B06.g

  17. Dicty_cDB: SFD419 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VKILGTEXFYAYLDKYGIXVDXXILSIXGGTSXXTMVKXYYQRK PTSCSTRGH*lfgkiitl*psrkinykrsygtpil*tiislnnyiiiikiittdinfptr n*...kinykrsygtpil*tiislnnyiiiikiittdinfptr n*nqksksksipipipksksksksksksksklklkqkqkqkqkqkxkqnq Frame C: flfiiyllc

  18. Dicty_cDB: SSJ321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ish DNA sequence from clone DKEY-5P1 in linkage group 20. 46 0.59 1 BQ476622 |BQ476622.1 curculio...3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06 3', mRNA sequence. 4...0.59 1 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06

  19. Dicty_cDB: VSI829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lio4h01.g Curculio glandium cDNA Curculio glandium cDNA clone curculio4h01 3', mRNA... sequence. 54 2e-08 3 BQ476431 |BQ476431.1 curculio4h01.b Curculio glandium cDNA Curculio glandium cDNA clone curculio...ideum chromosome 2 map 6163571-6199719 strain AX4, complete sequence. 846 0.0 5 BQ476680 |BQ476680.1 curcu

  20. Dicty_cDB: SSJ346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.097 4 BQ476381 |BQ476381.1 curculio4b06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio..., WORKING DRAFT SEQUENCE, 8 ordered pieces. 36 0.19 6 BQ476658 |BQ476658.1 curculio4b06.g Curculio glandium ...cDNA Curculio glandium cDNA clone curculio4b06 3', mRNA sequence. 38 0.21 2 AF462

  1. Dicty_cDB: VSE575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rchaeoglobus fulgidus section 5 of 172 of the complete genome. 46 0.26 1 BQ476340 |BQ476340.1 curculio...3e06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06 5', mRNA sequen...ce. 46 0.26 1 BQ476622 |BQ476622.1 curculio3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio

  2. Dicty_cDB: SHF401 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 52.1 WOUND1_15_C04.b1_A002 Wounded leaves Sorghum bicolor cDNA clone WOUND1_15_C04_A002 3', mRNA sequence. 5...2 0.034 1 CN142951 |CN142951.1 WOUND1_13_G01.b1_A002 Wounded leaves Sorghum bicolor cDNA clone WOUND1_13_G01

  3. Dicty_cDB: SHH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YLFEAYKAMIEVLTRQNTKFEH TKFDHSKFDSTLLKISTQALNYC--- ---pqkkmevvxvvxvvxvxxppxnxxxxvxvxvxxkmxppqnvxxvvxvxvxvx...mxpqk ktxvxvvvlvkikexkxxktxxgxxxtkxxktkx Homology vs CSM-cDNA Score E Sequences prod

  4. Dicty_cDB: CHH628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CEXVXFDPKPFICKTAAVVSVGVAVGVAVGGAXALGVF XFXGXKGYXXWKASQGVTMAXSNANPLXES Frame B: ---mvxvklvfvxmqlqxxkvlvsxlxsiqnhsfvkllllfqlvlllvlllvx...qxxlvxl xlxvxkvmxxgkqvkvlqwphqmpixfxka Frame C: ---wxmsswyl*xcncxxxryl*vc*xrsktihl*n

  5. Dicty_cDB: CFC791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YFTNKTLFGNVNNEKRKSKQPKYKYLSHHLLTSNTKLSSNKSENWFGIDNGSD YKRFFARTVAEKDMWVQHIQPCIDKATEIKTLKDNKK*virifirn...YLSHHLLTSNTKLSSNKSENWFGIDNGSD YKRFFARTVAEKDMWVQHIQPCIDKATEIKTLKDNKK*virifirnityylxi* Homology vs CSM-cDNA Sc

  6. Dicty_cDB: CHK456 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rssfpicrhrcpsrsl*sllg wfirryqfmchpr*tcyyhakryslsqty Frame C: fyytyrlsif*kmartkqtarkstgakvprkhigskqahkqtpvsss...aihakrvtimpkdihlarrirgers*rvyfyfltkkk--- ---fyytyrlsif*kmartkqtarkstgakvprkhigskqahkqtpvssssggvkkvhrf rpgtva

  7. Dicty_cDB: VFA603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LNLLKLAPGGHLGRFIIWTKSAFEQLDSTFGTFAKSSAQKKGYTLPRPMIANADIVRLVN SDEIQAAVRASKVVVKRPTAPVRRSNPLKNLRAXLN*tqppsqpvv...KNLRAXLN*tqppsqpvvlklnh*nqkvskla krin*elnscxhfqpiilnr Homology vs CSM-cDNA Score

  8. Dicty_cDB: SSD382 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: ---qlmsllmnlqdhfhserklvvtlvvfhtiviesmnpigkliqtiskpfhif*ilqal kvvlqpiladqd*rvsmlviiiklvspi*smmmkistfspimn...hvlvklftvvthfk*ip tfkvlmeltllstintllsvlmlfiqcfgvsissqplknklislpkpiklipsvmpsllf *lllvvsyl*flvvslylik*sickkkn*

  9. Dicty_cDB: AFA885 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GB10C06.yg.ab1 QG_ABCDI lettuce salinas Lactuca sativa cDNA clone QGB10C06, mRNA sequence. 40 5.4 1 BG227500....4 1 BQ846375 |BQ846375.1 QGA19D24.yg.ab1 QG_ABCDI lettuce salinas Lactuca sativa cDNA clone QGA19D24, mRNA

  10. Dicty_cDB: AFK872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ACR23H21, complete sequence. 42 0.051 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersico...12 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar... AI773934 |AI773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA s

  11. Dicty_cDB: CFG834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one BACR23H21, complete sequence. 42 0.038 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycope...38 0.10 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 si....10 2 AI773934 |AI773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, m

  12. Dicty_cDB: CHD312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mplete sequence. 42 0.056 6 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersicon esculentum...6 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 similar to cinnamic...I773934.1 EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1, mRNA sequence. 38

  13. Dicty_cDB: AHB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX14G21 5...i aconitase mRNA, partial cds. 58 6e-11 3 AI775579 |AI775579.1 EST256679 tomato resistant, Cornell...1 EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX10

  14. Dicty_cDB: CHA214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2D11 5' sequence, mRNA sequence. 92 6e-16 3 AW217896 |AW217896.1 EST296610 tomato flower buds, anthesis, Cornell...-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycopersicon esculentum cDNA clone cLES3N17...root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA sequence. 9

  15. Dicty_cDB: AFL147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ' sequence, mRNA sequence. 42 0.16 2 BE471638 |BE471638.1 EST416491 potato stolon, Cornell University Solanu...ST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA sequence. 42 0.17 2 ...m tuberosum cDNA clone cSTA29J22, mRNA sequence. 42 0.16 2 BE343505 |BE343505.1 E

  16. Dicty_cDB: VFI438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available S12 Capsicum annuum cDNA, mRNA sequence. 54 0.004 1 BF187220 |BF187220.1 EST443507 potato stolon, Cornell Un...uds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone c...se. 54 0.004 1 BE473010 |BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone

  17. Dicty_cDB: AFF758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC Library) complete sequence. 42 0.070 5 AI484136 |AI484136.1 EST248943 tomato resistant, Cornell Lycopersi... 0.074 2 AI490786 |AI490786.1 EST241494 tomato shoot, Cornell Lycopersicon esculentum cDNA clone cLEB3H9 sim... EST255034 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER8N1,

  18. Dicty_cDB: SHA843 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- ---MDFPRGCKSFGGSFCIPGEYSAWSSVYFESQPWISDLTMDGEDMIISIRDRGGDLDR DVGTYDMLRACFDGDQLILENSGIC...SIRDRGGDLDR DVGTYDMLRACFDGDQLILENSGICGGVPGAHLLPSGYFGTPDGINSGEYYNDNFYYPTD NDG Homology vs CSM-cDNA Score E Se

  19. Dicty_cDB: VFI183 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTI STTMRDFRMYTCEDASCYQNLDWQSIDIEISPENNYFYTMEKPAAGWTGFFYQVEFETGS YYST*vsivpdilpfpkcpmsvcasgipayknktleienn*li...FETGS YYST*vsivpdilpfpkcpmsvcasgipayknktleienn*likkkinlxifk Frame C: KMKLSIVTFIVTVVVLSVIYIYNSSTLLESRVLKDYVEK

  20. Dicty_cDB: CHC160 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kgfxgvikrwgvrklprkthkglrkvacigawhpsrvsttvpragqlgyhhr vernkkiyrigqaqpedgkqistgktefdltektinpmggfahygmvkheflmlkgcvag prkraltlrksittqtgra...alekitlkfidtsskfghglhqtaedktkyfgvkksr Frame C: kqq*qyess*i*sstsr*srfqtkkesrqtsr*sqv

  1. Dicty_cDB: CHO116 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fslvksnvvihswlslvlvlg*v plllyfylwnpfllxctlldfig*nskinsxlvmvldsfxtvplv Translated ...ilplifvyglfhwltxsyllyfgnvfslvksnvvihswlslvlvlg*v plllyfylwnpfllxctlldfig*nskinsxlvmvldsfxtvplv Frame C: lkkn

  2. Dicty_cDB: SHH353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qrqdglmvlqf**qlyw*lvlhh*misrikldlen*v trvtirklkvfvvvnnvkyqysmsrlvilshwtlvipfvpmvf...DPFLISGSMVIEGFGTMLVTAVGVNSFNGKTMMGLRVASEDTPLQMK LSVLASRIGYFGMGAAILMLLIAI--- Frame C: *yf**wqq*cqlywvqliihqii

  3. Dicty_cDB: VHN217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 ) Dictyostelium discoideum cDNA clone:ddv50l04, 3' ... 1094 0.0 3 ( BJ442653 )... Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 1076 0.0 4 ( BJ445359 ) Dictyostelium discoideum cDNA ...clone:ddv59a09, 3' ... 1007 0.0 3 ( BJ442499 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 999 0.0

  4. Dicty_cDB: VHI341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iscoideum cDNA clone:ddv51k15, 3' ... 1447 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50...m24, 3' ... 1447 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ...... 1447 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1447 0.0 1 ( BJ442218 ) Dict

  5. Dicty_cDB: VHO672 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ictyostelium discoideum cDNA clone:ddv51k15, 3' ... 1465 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50...m24, 3' ... 1465 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1465 0.0 1... ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1465 0.0 1 ( B

  6. Dicty_cDB: VHK894 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iscoideum cDNA clone:ddv51k15, 3' ... 1467 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50m24, ...3' ... 1467 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1467 0.0 1 ( BJ442731 ) ...Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1467 0.0 1 ( BJ442218 ) Dict

  7. Dicty_cDB: VHJ523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N ( BJ442531 ) Dictyostelium discoideum cDNA clone:ddv50m05, 3' ... 1772 0.0 1 ( BJ443457 ) Dictyos...v31j09, 3' ... 1655 0.0 2 ( BJ442583 ) Dictyostelium discoideum cDNA clone:ddv50g...7 ) Dictyostelium discoideum cDNA clone:ddv50o17, 3' ... 1628 0.0 2 ( BJ442656 ) Dictyostelium discoideum cDNA clone:ddv50

  8. Dicty_cDB: VHN889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , 3' ... 1463 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50m24, 3'... ... 1463 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50l21, 3' ... 1463 0.0 1 ( BJ442731 ) Di...ctyostelium discoideum cDNA clone:ddv50e24, 3' ... 1463 0.0 1 ( BJ442218 ) Dictyostelium discoideum cDNA clo

  9. Dicty_cDB: VHJ736 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N ( BJ442585 ) Dictyostelium discoideum cDNA clone:ddv50h...Dictyostelium discoideum cDNA clone:ddv17m03, 3' ... 1162 0.0 1 ( BJ423840 ) Dictyostelium discoideum cDNA clone:ddv50...g16, 5' ... 105 3e-18 1 ( BJ423768 ) Dictyostelium discoideum cDNA clone:ddv50h09, 5' ... 105 3e-1

  10. Dicty_cDB: VHJ530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BJ443368 ) Dictyostelium discoideum cDNA clone:ddv52o18, 3' ... 1451 0.0 1 ( BJ442687 ) Dictyostelium discoideum cDNA clone:ddv50...m18, 3' ... 1451 0.0 1 ( BJ442596 ) Dictyostelium discoideum cDNA clone:ddv50...451 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50a11, 3' ... 1445 0.0 1 ( BJ438342 ) Dictyost

  11. Dicty_cDB: VHJ654 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 674 ) Dictyostelium discoideum cDNA clone:ddv50k14, 3' ... 1457 0.0 1 ( BJ442828 ) Dictyostelium discoideum ...8 0.0 1 ( BJ442759 ) Dictyostelium discoideum cDNA clone:ddv50k20, 3' ... 1392 0....discoideum cDNA clone:ddv57b24, 3' ... 1390 0.0 1 ( BJ442507 ) Dictyostelium discoideum cDNA clone:ddv50h05,

  12. Dicty_cDB: VHH260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ideum cDNA clone:ddv54o16, 5' ... 1090 0.0 1 ( BJ423883 ) Dictyostelium discoideum cDNA clone:ddv50...o17, 5' ... 1090 0.0 1 ( BJ423839 ) Dictyostelium discoideum cDNA clone:ddv50g15, 5' ... 1...090 0.0 1 ( BJ423765 ) Dictyostelium discoideum cDNA clone:ddv50g12, 5' ... 1090 0.0 1 ( BJ423178 ) Dictyost

  13. Dicty_cDB: VHJ539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Dictyostelium discoideum cDNA clone:ddv50m09, 3' ... 1366 0.0 1 ( BJ442759 ) D...ictyostelium discoideum cDNA clone:ddv50k20, 3' ... 1358 0.0 1 ( BJ441455 ) Dictyostelium discoideum cDNA cl... 1336 0.0 1 ( BJ442696 ) Dictyostelium discoideum cDNA clone:ddv50o16, 3' ... 1336 0.0 1 ( BJ437729 ) Dictyo

  14. Dicty_cDB: VHK322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Dictyostelium discoideum cDNA clone:ddv51l05, 3' ... 1441 0.0 1 ( BJ442780 ) Dictyostelium discoideum cDNA clone:ddv50...o20, 3' ... 1441 0.0 1 ( BJ442687 ) Dictyostelium discoideum cDNA clone:ddv50...m18, 3' ... 1441 0.0 1 ( BJ442548 ) Dictyostelium discoideum cDNA clone:ddv50a11, 3' ... 1441 0.0 1

  15. Dicty_cDB: VHJ814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available J442525 ) Dictyostelium discoideum cDNA clone:ddv50l04, 3' ... 1501 0.0 1 ( BJ437...847 ) Dictyostelium discoideum cDNA clone:ddv35f17, 3' ... 1320 0.0 2 ( BJ442499 ) Dictyostelium discoideum cDNA clone:ddv50...g01, 3' ... 1310 0.0 2 ( BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 129

  16. Dicty_cDB: VHK888 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 1348 0.0 1 ( BJ442780 ) Dictyostelium discoideum cDNA clone:ddv50o20, 3' ... ...1348 0.0 1 ( BJ442687 ) Dictyostelium discoideum cDNA clone:ddv50m18, 3' ... 1348 0.0 1 ( BJ442548 ) Dictyos...telium discoideum cDNA clone:ddv50a11, 3' ... 1348 0.0 1 ( BJ441725 ) Dictyostelium discoideum cDNA clone:dd

  17. Dicty_cDB: VHP357 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ctyostelium discoideum cDNA clone:ddv51k15, 3' ... 1467 0.0 1 ( BJ442773 ) Dictyostelium discoideum cDNA clone:ddv50...m24, 3' ... 1467 0.0 1 ( BJ442764 ) Dictyostelium discoideum cDNA clone:ddv50...l21, 3' ... 1467 0.0 1 ( BJ442731 ) Dictyostelium discoideum cDNA clone:ddv50e24, 3' ... 1467 0.0 1 ( BJ

  18. Dicty_cDB: SLA476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone SLA476. 1154 0.0 1 ( BJ442525 ) Dictyostelium discoideum cDNA clone:ddv50l...9 ) Dictyostelium discoideum cDNA clone:ddv50g01, 3' ... 1104 0.0 2 ( BJ438430 ) Dictyostelium discoideum cD... BJ442653 ) Dictyostelium discoideum cDNA clone:ddv50f18, 3' ... 1011 0.0 3 ( BJ385501 ) Dictyostelium disco

  19. Dicty_cDB: VHE614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ated Amino Acid sequence FLVHPISKMPSNKTLKIKKILGKKQKQNRPVPQWIRLRTDNTIRYNNKRRHWRRTKLGI* tpqckligtyrslyiliklifw...QKQNRPVPQWIRLRTDNTIRYNNKRRHWRRTKLGI* tpqckligtyrslyiliklifwtfnkkk--- Frame C: f*stlfpkchpikh*klkrf*aksksktdq

  20. Dicty_cDB: VSK190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LCQCDNLEDMKMHFISTDYGDFPQVNHHQFIQPPLQ RKQQVN**vnsttleikqsnhfqllwisfhmvi*litvvllitgtlherdiselvdkchp --- Transl...tleikqsnhfqllwisfhmvi*litvvllitgtlherdiselvdkchp --- Frame C: lkriilyiy*nctllll*kekkainnfnsykqkqqhiyinikrwvy

  1. Dicty_cDB: VSJ119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kr Frame C: fsksqi*lkkkmttigpieneikelltkelnpinleiinesymhnvpkgseshfkvkivs ekfetlsmieqhrlvneil...kelnpinleiinesymhnvpkgsesh fkvkivsekfetlsmieqhrlvneilknfigngkihalsitsrtptqgkkiikqksmlmm inhhlvkevw*ikke Homo

  2. Dicty_cDB: SSC489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---LLDPQDPIFGKIHPXGTFQGTLRKXYMFMNRISELLDX*nqqdvpnsnhskxkkpny lkkvf*yktklfxpnwfylqvklkkfplhklniifmf...rame C: ---LLDPQDPIFGKIHPXGTFQGTLRKXYMFMNRISELLDX*nqqdvpnsnhskxkkpny lkkvf*yktklfxpnwfylqvklkkfplhklniifmfiy

  3. Dicty_cDB: CHD302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QKKGKIIRSICILXGPXPXXXXKFESLQIIIPQKQVXR QXDMYVGVXSSAHXVXPXGXXXAIVSAXV*tnxpxkxlapayaxlgpixxkfxyisdfxx pxxdgtad...VGVXSSAHXVXPXGXXXAIVSAXV*tnxpxkxlapayaxlgpixxkfxyisdfxx pxxdgtadnvfixksxextxpxxmlp Frame C: ---kl*hviklfvihh

  4. Dicty_cDB: VHA442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AFT SEQUENCE, 21 unordered pieces. 42 3e-04 2 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssow...ii Tamarix androssowii cDNA, mRNA sequence. 58 4e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssow...ii leaf Tamarix androssowii cDNA, mRNA sequence. 58 4e-04 1 AC146990 |AC1469

  5. Dicty_cDB: CHR188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , complete sequence. 50 2e-04 2 CV792687 |CV792687.1 c-030112-2w_E01.abd cDNA library of Tamarix androssow...ii Tamarix androssowii cDNA, mRNA sequence. 58 2e-04 1 CF199667 |CF199667.1 EST1268 Tamarix androssow...ii leaf Tamarix androssowii cDNA, mRNA sequence. 58 2e-04 1 AC146990 |AC146990.2 Lytechinu

  6. Dicty_cDB: SSA615 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stage Eimeria tenella cDNA 5', mRNA sequence. 32 3.3 2 BG516652 |BG516652.1 EtESTed59d07.y1 Eimeria tenella S5-2 cDNA Neg Selected... |BG516015.1 EtESTed47h06.y1 Eimeria tenella S5-2 cDNA Neg Selected Eimeria tenella cDNA 5', mRNA sequence.

  7. Dicty_cDB: AFA889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TIIRSHEVKEKGYQIDDDGSLI TVFSAPNYCDQSGNLGSFINITEDKIKITTFEAVNIRIYHQ Translated Amino Acid sequence (All Frames)...IIRSHEVKEKGYQIDDDGSLI TVFSAPNYCDQSGNLGSFINITEDKIKITTFEAVNIRIYHQ Frame C: ---smatl

  8. Dicty_cDB: SFB110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DPKDNELVQCLLWSDPQSNPGIAPS SRGVGVYFGPDVTRRFLKENNLSTIIRSHEVKEKGYQIDDDGSLITVFSAPNYCDQSGNL GSFINITEDKIKITTLKLXTS...FGPDVTRRFLKENNLSTIIRSHEVKEKGYQIDDDGSLITVFSAPNYCDQSGNL GSFINITEDKIKITTLKLXTSEYTT Homology vs CSM-cDNA Score E

  9. Dicty_cDB: VFI734 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CLLWSDPQSNPGIAPSSRGVGVYFGPDVTRRFLKEN NLSTIIRSHEVKEKGYQIDDDGSLITVFSAPNYCDQSGNLGSFINITE...VYFGPDVTRRFLKEN NLSTIIRSHEVKEKGYQIDDDGSLITVFSAPNYCDQSGNLGSFINITEDKIKITTLKL*t seyttnalakk Homology vs CSM-cDN

  10. Dicty_cDB: SLA328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hhrplllhhh hqfhqrkdgfqyqdlrscssnintpiatsspstctvpnsihhddyqdqpkkrikatva*k nniki Fra...me C: ---k*nhynqswiy*wgesshlhiifiikfftlcisstfitn*iiytiffiivrffciti inftkekmafnikicdlvrqi*ihqlqpphlqlvqyqiqfi

  11. Dicty_cDB: AFH387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QLDGFEST KNIKVLMCTNRIDILDPALLRPGRIDRKIEFPNPGDAGRLDILKIXSTXMX Translated Amino Acid sequence (All Frames) Fra...ST KNIKVLMCTNRIDILDPALLRPGRIDRKIEFPNPGDAGRLDILKIXSTXMX Frame C: kknflkkhthll*YILY

  12. Dicty_cDB: SSK552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AEDKKRWELEKKNYDEKLK TQSQAESSSDSSDESD*tfnlihsiichhyyhhhhhnhhnqfihqsinssimsttncvtl sfslylcclfikpkpinistttnqtnk...iichhyyhhhhhnhhnqfihqsinssimsttncvtl sfslylcclfikpkpinistttnqtnk***kkkkktklfln*krknk*kkkkiiiiikkk Frame C: -

  13. Dicty_cDB: SHA139 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- ---IDSKLFNSLRENYKNNITFLPTLERIKKXXSYQLMKTISEX*kttfxiliii Frame C: *iqnclilcvki...tkti*lfyqhlkdqkmisyqlmkqfqklknsfkiliiisni*yliypl kkk--- ---*iqnclilcvkitkti*lfyqhlkeskkxxhin**kqfqkxkklllxf*

  14. Dicty_cDB: CFH854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Lab Zea mays cDNA, mRNA sequence. 42 6e-12 4 BI674812 |BI674812.1 949067E10.y2 949 - Juvenile leaf and shoot cDNA from Steve...BI478599.1 949067E10.x1 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence. 42

  15. Dicty_cDB: AFH152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 80 4e-19 2 CF211274 |CF211274.1 CAB20007_IVa_Ra_C07 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera c...DNA clone CAB20007_IVa_Ra_C07 3', mRNA sequence. 78 4e-18 3 CF211191 |CF211191.1 CAB20007_IVa_Fa_C07 Cabernet Sauvignon Flower bloom

  16. Dicty_cDB: VSK166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2001. 3.22 Translated Amino Acid sequence scirlfnqnisgnitrsisnfkkhsprskltrcilsngatirywtslpmsetwrce... C: scirlfnqnisgnitrsisnfkkhsprskltrcilsngatirywtslpmsetwrcetdif nnppeyvmdniqkike

  17. Hepatitis C virus proteins

    Institute of Scientific and Technical Information of China (English)

    Jean Dubuisson

    2007-01-01

    Hepatitis C virus (HCV) encodes a single polyprotein,which is processed by cellular and viral proteases to generate 10 polypeptides. The HCV genome also contains an overlapping +1 reading frame that may lead to the synthesis of an additional protein. Until recently,studies of HCV have been hampered by the lack of a productive cell culture system. Since the identification of HCV genome approximately 17 years ago, structural,biochemical and biological information on HCV proteins has mainly been obtained with proteins produced by heterologous expression systems. In addition, some functional studies have also been confirmed with replicon systems or with retroviral particles pseudotyped with HCV envelope glycoproteins. The data that have accumulated on HCV proteins begin to provide a framework for understanding the molecular mechanisms involved in the major steps of HCV life cycle. Moreover,the knowledge accumulated on HCV proteins is also leading to the development of antiviral drugs among which some are showing promising results in early-phase clinical trials. This review summarizes the current knowledge on the functions and biochemical features of HCV proteins.

  18. The Parallel C Preprocessor

    Directory of Open Access Journals (Sweden)

    Eugene D. Brooks III

    1992-01-01

    Full Text Available We describe a parallel extension of the C programming language designed for multiprocessors that provide a facility for sharing memory between processors. The programming model was initially developed on conventional shared memory machines with small processor counts such as the Sequent Balance and Alliant FX/8, but has more recently been used on a scalable massively parallel machine, the BBN TC2000. The programming model is split-join rather than fork-join. Concurrency is exploited to use a fixed number of processors more efficiently rather than to exploit more processors as in the fork-join model. Team splitting, a mechanism to split the team of processors executing a code into subteams to handle parallel subtasks, is used to provide an efficient mechanism to exploit nested concurrency. We have found the split-join programming model to have an inherent implementation advantage, compared to the fork-join model, when the number of processors in a machine becomes large.

  19. Dicty_cDB: SHH868 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 87 |DR779687.1 BAAC-PNP1260K12.g1 C.remanei EST SB146 Caenorhabditis remanei cDNA 5, mRNA sequence. 48 0.24 ...1 DR777907 |DR777907.1 BAAC-PNP1255I09.g1 C.remanei EST SB146 Caenorhabditis remane

  20. Dicty_cDB: SHE701 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 BAAC-PNP1253G19.g1 C.remanei EST SB146 Caenorhabditis remanei cDNA 5, mRNA seq...ial bentgrass EST Agrostis capillaris cDNA clone COL380T_D11 3', mRNA sequence. 46 0.16 1 DR777140 |DR777140