WorldWideScience

Sample records for actinium 234

  1. Synthesis and Characterization of the Actinium Aquo Ion

    OpenAIRE

    Maryline G. Ferrier; Benjamin W. Stein; Enrique R. Batista; John M. Berg; Eva R. Birnbaum; Jonathan W. Engle; Kevin D. John; Stosh A. Kozimor; Juan S. Lezama Pacheco; Lindsay N. Redman

    2017-01-01

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H2O) x 3+) is critical for current ef...

  2. Synthesis and Characterization of the Actinium Aquo Ion.

    Science.gov (United States)

    Ferrier, Maryline G; Stein, Benjamin W; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Engle, Jonathan W; John, Kevin D; Kozimor, Stosh A; Lezama Pacheco, Juan S; Redman, Lindsay N

    2017-03-22

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H 2 O) x 3+ ) is critical for current efforts to develop 225 Ac [ t 1/2 = 10.0(1) d] as a targeted anticancer therapeutic agent. However, given the limited amount of actinium available for study and its high radioactivity, many aspects of actinium chemistry remain poorly defined. We overcame these challenges using the longer-lived 227 Ac [ t 1/2 = 21.772(3) y] isotope and report the first characterization of this fundamentally important Ac-aquo coordination complex. Our X-ray absorption fine structure study revealed 10.9 ± 0.5 water molecules directly coordinated to the Ac III cation with an Ac-O H2O distance of 2.63(1) Å. This experimentally determined distance was consistent with molecular dynamics density functional theory results that showed (over the course of 8 ps) that Ac III was coordinated by 9 water molecules with Ac-O H2O distances ranging from 2.61 to 2.76 Å. The data is presented in the context of other actinide(III) and lanthanide(III) aquo ions characterized by XAFS and highlights the uniqueness of the large Ac III coordination numbers and long Ac-O H2O bond distances.

  3. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  4. Comment: 234 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum Dictyostelium discoideum Dictyostelium_discoideum_L.png 234.png Hideko... Urushihara (University of Tsukuba) licensed under CC Attribution2.1 Japan 写真提供:漆原秀子 (筑波大学) Photograph provided by Hideko

  5. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  6. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  8. LaPO4 Nanoparticles Doped with Actinium-225 that Partially Sequester Daughter Radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Woodward, Jonathan [ORNL; Kennel, Steve J [ORNL; Stucnkey, Alan [University of Tennessee, Knoxville (UTK); Osborne, Dustin [University of Tennessee, Knoxville (UTK); Wall, Jonathan [University of Tennessee, Knoxville (UTK); Rondinone, Adam Justin [ORNL; Standaert, Robert F [ORNL; Mirzadeh, Saed [ORNL

    2011-01-01

    Nanoscale materials have been envisioned as carriers for various therapeutic drugs, including radioisotopes. Inorganic nanoparticles (NPs) are particularly appealing vehicles for targeted radiotherapy because they can package several radioactive atoms into a single carrier and can potentially retain daughter radioisotopes produced by in vivo generators such as actinium -225 (225Ac, t1/2=10 d). Decay of this radioisotope to stable bismuth-209 proceeds through a chain of short-lived daughters accompanied by the emission of four -particles that release >27 MeV of energy. The challenge in realizing the enhanced cytotoxic potential of in vivo generators lies in retaining the daughter nuclei at the therapy site. When 225Ac is attached to targeting agents via standard chelate conjugation methods, all of the daughter radionuclides are released after the initial -decay occurs. In this work, 225Ac was incorporated into lanthanum phosphate NPs to determine whether the radioisotope and its daughters would be retained within the dense mineral lattice. Further, the 225Ac-doped NPs were conjugated to the monoclonal antibody mAb 201B, which targets mouse lung endothelium through the vasculature, to ascertain the targeting efficacy and in vivo retention of radioisotopes. Standard biodistribution techniques and microSPECT/CT imaging of 225Ac as well as the daughter radioisotopes showed that the NPs accumulated rapidly in mouse lung after intravenous injection. By showing that excess, competing, uncoupled antibodies or NPs coupled to control mAbs are deposited primarily in the liver and spleen, specific targeting of NP-mAb 201B conjugates was demonstrated. Biodistribution analysis showed that ~30% of the total injected dose of La(225Ac)PO4 NPs accumulated in mouse lungs 1 h post-injection yielding a value of % ID/g >200. Furthermore, after 24 h, 80% of the 213Bi daughter produced from 225Ac decay was retained within the target organ and 213Bi retention increased to ~87% at 120 h. In

  9. 49 CFR 234.259 - Warning time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...

  10. 49 CFR 234.245 - Signs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signs. 234.245 Section 234.245 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... Maintenance Standards § 234.245 Signs. Each sign mounted on a highway-rail grade crossing signal post shall be...

  11. 7 CFR 916.234 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 916.234 Section 916.234 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE NECTARINES GROWN IN CALIFORNIA Assessment Rates § 916.234 Assessment rate....

  12. 7 CFR 966.234 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 966.234 Section 966.234 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE TOMATOES GROWN IN FLORIDA Assessment Rates § 966.234 Assessment rate. On an...

  13. 49 CFR 234.251 - Standby power.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power. 234.251 Section 234.251 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Inspections and Tests § 234.251 Standby power. Standby power shall be tested at least...

  14. 49 CFR 234.233 - Rail joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Rail joints. 234.233 Section 234.233..., Inspection, and Testing Maintenance Standards § 234.233 Rail joints. Each non-insulated rail joint located... than joint bars and the bonds shall be maintained in such condition to ensure electrical conductivity. ...

  15. 49 CFR 234.221 - Lamp voltage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lamp voltage. 234.221 Section 234.221 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Maintenance Standards § 234.221 Lamp voltage. The voltage at each lamp shall be...

  16. 49 CFR 234.223 - Gate arm.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm. 234.223 Section 234.223 Transportation... Maintenance Standards § 234.223 Gate arm. Each gate arm, when in the downward position, shall extend across... clearly viewed by approaching highway users. Each gate arm shall start its downward motion not less than...

  17. 32 CFR 234.16 - Gambling.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Gambling. 234.16 Section 234.16 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.16 Gambling. Gambling in any form, or the operation of gambling devices, is...

  18. 48 CFR 234.004 - Acquisition strategy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition strategy. 234..., DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING MAJOR SYSTEM ACQUISITION 234.004 Acquisition strategy. (1) See 209.570 for policy applicable to acquisition strategies that consider the use of lead system...

  19. 7 CFR 58.234 - Buttermilk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Buttermilk. 58.234 Section 58.234 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE...

  20. 27 CFR 41.234 - Corporate documents.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Corporate documents. 41... Processed Tobacco § 41.234 Corporate documents. Every corporation that files an application for a permit as... the offices the incumbents of which are authorized to sign documents or otherwise act in behalf of the...

  1. 24 CFR 234.256 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 234.256... Substitute mortgagors. (a) Selling mortgagor. The requirements for the selling mortgagor are set forth in... Commissioner's approval of a substitute mortgagor only if the mortgage executed by the original mortgagor met...

  2. 40 CFR 52.234 - Source surveillance.

    Science.gov (United States)

    2010-07-01

    ...) Lake County APCD. (9) Mariposa County APCD. (10) Mendocino County APCD. (11) Nevada County APCD. (12...) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.234 Source surveillance. (a) Except in... emission data by sources. (1) Amador County APCD. (2) Bay Area AQMD. (3) Calaveras County APCD. (4) Del...

  3. The 234mPa Generator: Aspects of Milking the "234th Cow."

    Science.gov (United States)

    Schwankner, Robert J.; And Others

    1985-01-01

    Uses the protactinium (Pa-234m) generator to illustrate the production of isotopes of short half-life for medical analysis. The principle of nuclide generators and suggested experiments (with procedures and typical results) are discussed. (JN)

  4. 8 CFR 234.3 - Aircraft; how considered.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Aircraft; how considered. 234.3 Section 234... PORTS OF ENTRY FOR ALIENS ARRIVING BY CIVIL AIRCRAFT § 234.3 Aircraft; how considered. Except as otherwise specifically provided in the Immigration and Nationality Act and this chapter, aircraft arriving...

  5. 19 CFR 10.234 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certificate of Origin. 10.234 Section 10.234... Partnership Act Non-Textile Articles Under the United States-Caribbean Basin Trade Partnership Act § 10.234 Certificate of Origin. A Certificate of Origin as specified in § 10.236 must be employed to certify that an...

  6. 32 CFR 234.12 - Restriction on animals.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Restriction on animals. 234.12 Section 234.12 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.12 Restriction on animals. Animals, except guide dogs...

  7. 49 CFR 234.215 - Standby power system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power system. 234.215 Section 234.215..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.215 Standby power system. A standby source of power shall...

  8. 17 CFR 256.234 - Accounts payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.234 Section 256.234 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.234 Accounts payable to...

  9. 49 CFR 234.255 - Gate arm and gate mechanism.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm and gate mechanism. 234.255 Section 234... Maintenance, Inspection, and Testing Inspections and Tests § 234.255 Gate arm and gate mechanism. (a) Each gate arm and gate mechanism shall be inspected at least once each month. (b) Gate arm movement shall be...

  10. 49 CFR 234.275 - Processor-based systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Processor-based systems. 234.275 Section 234.275..., Inspection, and Testing Requirements for Processor-Based Systems § 234.275 Processor-based systems. (a... requirements of this subpart, a railroad may elect to qualify an existing processor-based product under part...

  11. 49 CFR 234.217 - Flashing light units.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units. 234.217 Section 234.217..., Inspection, and Testing Maintenance Standards § 234.217 Flashing light units. (a) Each flashing light unit.... (b) Each flashing light unit shall be maintained to prevent dust and moisture from entering the...

  12. Synthesis of uranyl acetylacetonate free of thorium 234

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Rendon, R.; Solache R, M.; Tenorio, D. (Instituto Nacional de Investigaciones Nucleares, Mexico City)

    1983-01-01

    A technique is described for synthesizing uranyl acetylacetonate free of thorium-234, and the method utilized in identifying it. The aim in the preparation of the thorium-234 free compound was to study the chemical effects produced by U-238 decay by means of detection only of the thorium-234 decay product.

  13. 24 CFR 234.65 - Nature of title.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of title. 234.65 Section 234.65 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... OWNERSHIP MORTGAGE INSURANCE Eligibility Requirements-Individually Owned Units § 234.65 Nature of title. A...

  14. 37 CFR 2.34 - Bases for filing.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Bases for filing. 2.34 Section 2.34 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.34 Bases for filing. (a) The...

  15. 49 CFR 234.235 - Insulated rail joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Insulated rail joints. 234.235 Section 234.235 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Maintenance Standards § 234.235 Insulated rail joints. Each insulated rail joint used...

  16. 28 CFR 2.34 - Rescission of parole.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Rescission of parole. 2.34 Section 2.34 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.34 Rescission of parole. (a) When an effective date of...

  17. Neutron induced fission of 234U

    Directory of Open Access Journals (Sweden)

    Pomp S.

    2012-02-01

    Full Text Available The fission fragment properties of 234U(n,f were investigated as a function of incident neutron energy from 0.2 MeV up to 5 MeV. The fission fragment mass, angular distribution and kinetic energy were measured with a double Frisch-grid ionization chamber using both analogue and digital data acquisition techniques. The reaction 234U(n,f is relevant, since it involves the same compound nucleus as formed after neutron evaporation from highly excited 236U*, the so-called second-chance fission of 235U. Experimental data on fission fragment properties like fission fragment mass and total kinetic energy (TKE as a function of incident neutron energy are rather scarce for this reaction. For the theoretical modelling of the reaction cross sections for Uranium isotopes this information is a crucial input parameter. In addition, 234U is also an important isotope in the Thorium-based fuel cycle. The strong anisotropy of the angular distribution around the vibrational resonance at En = 0.77 MeV could be confirmed using the full angular range. Fluctuations in the fragment TKE have been observed in the threshold region around the strong vibrational resonance at En = 0.77 MeV. The present results are in contradiction with corresponding literature values. Changes in the mass yield around the vibrational resonance and at En = 5 MeV relative to En = 2 MeV show a different signature. The drop in mean TKE around 2.5 to 3 MeV points to pair breaking as also observed in 235,238U(n,f. The measured two-dimensional mass yield and TKE distribution have been described in terms of fission modes. The yield of the standard 1 (S1 mode shows fluctuations in the threshold of the fission cross section due to the influence of the resonance and levels off at about 20% yield for higher incident neutron energies. The S2 mode shows the respective opposite behaviour. The mean TKE of both modes decreases with En. The decrease in mean TKE overrules the increase in S1 yield, so the mean

  18. 34 CFR 75.234 - The conditions of the grant.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false The conditions of the grant. 75.234 Section 75.234 Education Office of the Secretary, Department of Education DIRECT GRANT PROGRAMS How Grants Are Made Procedures to Make A Grant § 75.234 The conditions of the grant. (a) The Secretary makes a grant to an applicant only after determining— (1) The approve...

  19. 12 CFR 23.4 - Investment in personal property.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment in personal property. 23.4 Section... Provisions § 23.4 Investment in personal property. (a) General rule. A national bank may acquire specific... business or for entry into the leasing business; and (2) The bank's aggregate investment in property held...

  20. 40 CFR 170.234 - Safe operation of equipment.

    Science.gov (United States)

    2010-07-01

    ... pesticides. (2) Of the potentially harmful effects of exposure to pesticides. (3) Of the correct way to... Section 170.234 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.234 Safe operation of equipment. (a) The...

  1. 48 CFR 252.234-7002 - Earned Value Management System.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Earned Value Management... of Provisions And Clauses 252.234-7002 Earned Value Management System. As prescribed in 234.203(2), use the following clause: Earned Value Management System (APR 2008) (a) In the performance of this...

  2. 32 CFR 234.5 - Compliance with official signs.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Compliance with official signs. 234.5 Section...) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.5 Compliance with official signs. Persons on the Pentagon Reservation shall at all times comply with official signs of a prohibitory, regulatory, or...

  3. 14 CFR 234.6 - Baggage-handling statistics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Baggage-handling statistics. 234.6 Section 234.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION... statistics. Each reporting carrier shall report monthly to the Department on a domestic system basis...

  4. 40 CFR 86.233-94-86.234-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.233-94-86.234-94 Section 86.233-94-86.234-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

  5. 7 CFR 23.4 - State Rural Development Advisory Council.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false State Rural Development Advisory Council. 23.4 Section... Program § 23.4 State Rural Development Advisory Council. (a) The chief administrative officer of the administratively responsible State Land Grant University will appoint a State Rural Development Advisory Council...

  6. Dicty_cDB: VSB234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSB234 (Link to dictyBase) - - - Contig-U16494-1 VSB234E (Link to Original site)...- - - - - - VSB234E 258 Show VSB234 Library VS (Link to library) Clone ID VSB234 (Link to dictyBase)...AL110967 |AL110967.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 52 0...AL114405 |AL114405.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 52 0...AL117142 |AL117142.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 52 0

  7. Gıdalardaki Biyokoruyucu: Nisin (E234

    Directory of Open Access Journals (Sweden)

    Başar Uymaz

    2015-12-01

    Full Text Available Fermantasyon gıdaları bozulma etmeni ve hastalık yapıcı mikroorganizmalara karşı korumak için kullanılan en eski geleneksel yöntemdir. Termal uygulamalar, pH ve su aktivitesinin düşürülmesi ve koruyucu katkı maddelerinin ilavesi yaygın kullanılan diğer gıda muhafaza teknikleridir. Koruyucu katkı maddesi olarak çok sayıda antibiyotik ve kimyasal ajan geliştirilmiş olmasına rağmen, bakterilerin kullanılan antibiyotiklere karşı hızla direnç kazanmaları, kimyasal koruyucuların insan sağlığını tehdit edici boyutlarının bulunması ile çeşitli alerjik reaksiyonlara neden olmaları kullanımlarını sınırlayan faktörlerdir. Son yıllarda tüketicilerde gelişen mikrobiyolojik açıdan güvenli ve minimum işlem görmüş gıdalara karşı oluşan talep doğrultusunda toksik veya herhangi bir olumsuz etkisi bulunmayan, Laktik Asit Bakterileri gibi insan tüketimi için güvenli bakteriler tarafından üretilen bakteriyosinler üzerine yapılan çalışmalar yoğunluk kazanmıştır. Yeni nesil antimikrobiyel ajan olarak kabul edilen bakteriyosinlerin koruyucu olarak kullanılmasının gıdaların raf ömrünün uzatılması, kimyasal koruyucuların kullanımının ve bozulma etmeni mikroorganizmaların neden olduğu ekonomik kayıpların azaltılması gibi önemli etkileri bulunmaktadır. FDA tarafından GRAS (Genel Olarak Güvenli olarak tanımlanan ve E234 koduyla ‘Nisin-koruyucu’ veya ‘doğal koruyucu’ olarak gıda katkı maddeleri listesinde yer alan Nisin, ilk olarak 1988 yılında ABD’de antibiyotiklerin gıdalarda kullanımının yasaklanmasıyla doğal koruyucu olarak kullanılmıştır. Nisinin günümüzde 50’den fazla ülkede süt ve ürünlerinden konserve gıdalara kadar pek çok gıdanın korunmasında başarılı uygulamaları bulunmaktadır.

  8. Influence of glacial meltwater on global seawater δ234U

    Science.gov (United States)

    Arendt, Carli A.; Aciego, Sarah M.; Sims, Kenneth W. W.; Das, Sarah B.; Sheik, Cody; Stevenson, Emily I.

    2018-03-01

    We present the first published uranium-series measurements from modern Greenland Ice Sheet (GrIS) runoff and proximal seawater, and investigate the influence of glacial melt on global seawater δ234U over glacial-interglacial (g-ig) timescales. Climate reconstructions based on closed-system uranium-thorium (U/Th) dating of fossil corals assume U chemistry of seawater has remained stable over time despite notable fluctuations in major elemental compositions, concentrations, and isotopic compositions of global seawater on g-ig timescales. Deglacial processes increase weathering, significantly increasing U-series concentrations and changing the δ234U of glacial meltwater. Analyses of glacial discharge from GrIS outlet glaciers indicate that meltwater runoff has elevated U concentrations and differing 222Rn concentrations and δ234U compositions, likely due to variations in subglacial residence time. Locations with high δ234U have the potential to increase proximal seawater δ234U. To better understand the impact of bulk glacial melt on global seawater δ234U over time, we use a simple box model to scale these processes to periods of extreme deglaciation. We account for U fluxes from the GrIS, Antarctica, and large Northern Hemisphere Continental Ice Sheets, and assess sensitivity by varying melt volumes, duration and U flux input rates based on modern subglacial water U concentrations and compositions. All scenarios support the hypothesis that global seawater δ234U has varied by more than 1‰ through time as a function of predictable perturbations in continental U fluxes during g-ig periods.

  9. 32 CFR 234.11 - Alcoholic beverages and controlled substances.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Alcoholic beverages and controlled substances... DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.11 Alcoholic beverages and controlled substances. (a) Alcoholic beverages. The consumption of alcoholic beverages or the possession of...

  10. 27 CFR 24.234 - Other use of spirits.

    Science.gov (United States)

    2010-04-01

    ... on bonded wine premises. The spirits will remain in the original container in the storeroom until..., DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.234 Other use of spirits. The proprietor producing sparkling wine, artificially carbonated wine, formula wine, or essences for which spirits are required may...

  11. Phenotype abnormality: 234 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 234 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u740i decreased speed... in organ named whole plant during process named cell division ... whole plant ... decreased speed ... cell division ...

  12. 48 CFR 352.234-3 - Full earned value management system.

    Science.gov (United States)

    2010-10-01

    ... management system. 352.234-3 Section 352.234-3 Federal Acquisition Regulations System HEALTH AND HUMAN....234-3 Full earned value management system. As prescribed in 334.203-70(c), the Contracting Officer shall insert the following clause: Full Earned Value Management System (October 2008) (a) The Contractor...

  13. 48 CFR 352.234-4 - Partial earned value management system.

    Science.gov (United States)

    2010-10-01

    ... management system. 352.234-4 Section 352.234-4 Federal Acquisition Regulations System HEALTH AND HUMAN....234-4 Partial earned value management system. As prescribed in 334.203-70(d), the Contracting Officer shall insert the following clause: Partial Earned Value Management System (October 2008) (a) The...

  14. 8 CFR 234.4 - International airports for entry of aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false International airports for entry of aliens. 234.4 Section 234.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DESIGNATION OF PORTS OF ENTRY FOR ALIENS ARRIVING BY CIVIL AIRCRAFT § 234.4 International airports for entry...

  15. 20 CFR 234.12 - 1937 Act lump-sum death payment.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false 1937 Act lump-sum death payment. 234.12 Section 234.12 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT LUMP-SUM PAYMENTS Lump-Sum Death Payment § 234.12 1937 Act lump-sum death payment. (a) The 1937 Act...

  16. Standardization of U(X{sub 1}+X{sub 2}): The {sup 234}Th+{sup 234m}Pa+{sup 230}Th mixture

    Energy Technology Data Exchange (ETDEWEB)

    Grau Carles, A. [Direccion de Tecnologia, CIEMAT, Madrid (Spain); Grau Malonda, A. [Instituto de Investigacion Basica, CIEMAT, Madrid (Spain); Gomez Gil, V. [Instituto de Medio Ambiente, CIEMAT, Madrid (Spain)

    1996-02-01

    The not very well known intensities of the diverse beta-decay branches of both {sup 234}Th and {sup 234m}Pa make the calibration of the genetic mixture {sup 234}Th+{sup 234m}Pa difficult. We apply a new standardization method based on Cherenkov counting, which permits a verification of the primary and secondary intensities for {sup 234m}Pa. We obtain 80% intensity for the primary branch, which contradicts the very weak gamma transition intensities observed for {sup 234m}Pa. This disagreement between experimental and theoretical Cherenkov counting efficiencies can only be avoided by considering the {sup 234m}Pa primary beta transition to be first forbidden non-unique. We also study the low-activity mixture {sup 234}Th+{sup 234m}Pa+{sup 230}Th, which has practical interest in sediment studies. We separate this mixture by two different liquid scintillation methods, by alpha/beta discrimination and by pulse-height spectrum unfolding, which we compare experimentally. (orig.).

  17. The clinical outcomes of 234 spiral family implants.

    Science.gov (United States)

    Danza, Matteo; Fromovich, Ophir; Guidi, Riccardo; Carinci, Francesco

    2009-09-01

    Spiral family implants (SFIs) are a new type of implant fixture with a conical internal helix and a variable thread design. The aim of this retrospective study was to evaluate the clinical outcomes of a series of SFIs. A total of 234 SFIs were placed in 86 patients (55 females and 31 males, median age 53 years) during the period between May 2004 and November 2007. The mean follow-up was 13 months. Several host, surgery, and implant-related factors were investigated, and the Kaplan Meier algorithm and the Cox regression were used to detect variables associated with the clinical outcome. Only nine out of 234 implants were lost (i.e., survival rate (SVR) of 96.2%) and no differences were detected among the studied variables. SFIs have a high SVR similar to those reported in previous studies on different implant types. SFIs demonstrated a very high primary stability which offers the potential for use of a specific implant device for immediate loading. However, additional studies are necessary to verify their outcome on the medium/long period.

  18. 20 CFR 234.11 - 1974 Act lump-sum death payment.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false 1974 Act lump-sum death payment. 234.11... LUMP-SUM PAYMENTS Lump-Sum Death Payment § 234.11 1974 Act lump-sum death payment. (a) The total amount... household” as the employee at the time of the employee's death. (Refer to § 234.21 for an explanation of...

  19. 24 CFR 234.259 - Claim procedure-graduated payment mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 234.259 Section 234.259 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES CONDOMINIUM OWNERSHIP MORTGAGE INSURANCE Contract Rights and Obligations-Individually Owned Units...

  20. 24 CFR 234.54 - Eligibility of assigned mortgages and mortgages covering acquired property.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of assigned mortgages and mortgages covering acquired property. 234.54 Section 234.54 Housing and Urban Development...-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE...

  1. 50 CFR 23.4 - What are Appendices I, II, and III?

    Science.gov (United States)

    2010-10-01

    ... WILDLIFE AND PLANTS (CONTINUED) CONVENTION ON INTERNATIONAL TRADE IN ENDANGERED SPECIES OF WILD FAUNA AND... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What are Appendices I, II, and III? 23.4 Section 23.4 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR...

  2. 45 CFR 234.75 - Rent payments to public housing agencies.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Rent payments to public housing agencies. 234.75... FINANCIAL ASSISTANCE TO INDIVIDUALS § 234.75 Rent payments to public housing agencies. At the option of a..., Federal financial participation under such title is available in rent payments made directly to a public...

  3. 45 CFR 234.11 - Assistance in the form of money payments.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Assistance in the form of money payments. 234.11... FINANCIAL ASSISTANCE TO INDIVIDUALS § 234.11 Assistance in the form of money payments. (a) Federal financial participation is available in money payments made under a State plan under title I, IV-A, X, XIV, or XVI of the...

  4. 49 CFR 234.219 - Gate arm lights and light cable.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm lights and light cable. 234.219 Section... Maintenance, Inspection, and Testing Maintenance Standards § 234.219 Gate arm lights and light cable. Each gate arm light shall be maintained in such condition to be properly visible to approaching highway...

  5. Determination of the 234U(nth,f) cross-section and some underlying physics

    Science.gov (United States)

    Wagemans, C.; Wagemans, J.; Geltenbort, P.; Zimmer, O.; Gönnenwein, F.

    1998-10-01

    The 234U(nth,f) cross-section was determined for the first time at the high flux reactor of the ILL in Grenoble, yielding a value of (300±20) mb. This was only possible due to the combination of an highly enriched 234U sample with an excellent neutron beam.

  6. 45 CFR 234.60 - Protective, vendor and two-party payments for dependent children.

    Science.gov (United States)

    2010-10-01

    ... dependent children. 234.60 Section 234.60 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH... amendment of an existing authorization document for each case or by preparation of a separate authorization...

  7. Scavenging Phenomenon Elucidated from 234Th/238U Disequilibrium in Surface Water of the Taiwan Strait

    Directory of Open Access Journals (Sweden)

    Ching-Ling Wei

    2010-01-01

    Full Text Available Concentrations of dissolved (234Thd and particulate (234Thp 234Th in surface water at 38 stations in the Taiwan Strait were determined for samples collected in May 2006. The spatial distribution of 234Th in the Taiwan Strait is controlled by advective input of Kuroshio Branch Water via the Peng-Hu Channel and fast removal due to the high input of riverine particulates from the Cho-Sui River. A scavenging model involving physical transport was applied to the 234Thd and 234Thp data to estimate scavenging and removal rates of 234Th. Estimated scavenging rate ranges from 32 to 703 dpm m-3 d-1 and the removal rate ranges from 24 to 560 dpm m-3 d-1. Using 234Th as a proxy of particulate organic carbon, we estimate that the removal rate of POC from surface water of the Taiwan Strait ranges from 0.3 ± 1.5 mmol-C m-3 d-1 off southwestern Taiwan to 10.2 ± 3.5 mmol-C m-3 d-1 in the central Taiwan Strait.

  8. 49 CFR 234.243 - Wire on pole line and aerial cable.

    Science.gov (United States)

    2010-10-01

    ... Maintenance, Inspection, and Testing Maintenance Standards § 234.243 Wire on pole line and aerial cable. Wire... transmission line operating at voltage of 750 volts or more shall be placed not less than 4 feet above the... 49 Transportation 4 2010-10-01 2010-10-01 false Wire on pole line and aerial cable. 234.243...

  9. 49 CFR 234.253 - Flashing light units and lamp voltage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...

  10. Updated determination of particulate and dissolved thorium-234

    Science.gov (United States)

    Fleer, Alan P.

    The determination of particulate and dissolved 234Th is similar to the procedure of Anderson and Fleer [1982]. Samples are collected using 30 L Niskin bottles with Teflon- or epoxy-coated internal springs. On deck, the sample is pumped with a delrin impeller pump through a 0.45 μm pore size 147-mm diameter Millipore filter and into a pre-rinsed 6 gallon plastic cubitainer held in a plastic milk crate. An in-line plastic water meter records volumes in gallons. The particulate sample filter is folded twice and stored in a polyethylene sample bag. To the ˜20 L filtered sample is added: 30 mL reagent grade 16 N HNO3; 500 mL 230Th tracer of ˜30 dpm mL-l and 5 mL 50 mg mL-l iron carrier previously cleaned by extraction into isopropyl ether from an 8 M HCl solution and back-extracted into 0.1 M HCl. The acidified sample is allowed to equilibrate for from one day to a maximum of several days. The sample is weighed on a Heathkit digital scale and the pH is adjusted to approximately 8 with about 40 mL 10 M NH4OH to precipitate iron hydroxide, which carries the thorium and uranium from the solution. The precipitate is allowed to settle for 12 to 24 hours. The supernate is drawn off, and the precipitate is spun down in a centrifuge tube to about an 8 mL volume. The precipitate is resuspended in distilled water and spun down again, then dissolved in three times its volume with 12 N HCl to make a 9 N HCl solution. A 1.5 cm×12 cm ion exchange column is filled with AG1×8 100-200 mesh resin and conditioned with 9 N HCl. The sample solution is run slowly through.

  11. Evidence of autoinducer-dependent and -independent heterogeneous gene expression in Sinorhizobium fredii NGR234.

    Science.gov (United States)

    Grote, Jessica; Krysciak, Dagmar; Schorn, Andrea; Dahlke, Renate I; Soonvald, Liina; Müller, Johannes; Hense, Burkhard A; Schwarzfischer, Michael; Sauter, Margret; Schmeisser, Christel; Streit, Wolfgang R

    2014-09-01

    Populations of genetically identical Sinorhizobium fredii NGR234 cells differ significantly in their expression profiles of autoinducer (AI)-dependent and AI-independent genes. Promoter fusions of the NGR234 AI synthase genes traI and ngrI showed high levels of phenotypic heterogeneity during growth in TY medium on a single-cell level. However, adding very high concentrations of N-(3-oxooctanoyl-)-l-homoserine lactone resulted in a more homogeneous expression profile. Similarly, the lack of internally synthesized AIs in the background of the NGR234-ΔtraI or the NGR234-ΔngrI mutant resulted in a highly homogenous expression of the corresponding promoter fusions in the population. Expression studies with reporter fusions of the promoter regions of the quorum-quenching genes dlhR and qsdR1 and the type IV pilus gene cluster located on pNGR234b suggested that factors other than AI molecules affect NGR234 phenotypic heterogeneity. Further studies with root exudates and developing Arabidopsis thaliana seedlings provide the first evidence that plant root exudates have strong effects on the heterogeneity of AI synthase and quorum-quenching genes in NGR234. Therefore, plant-released octopine appears to play a key role in modulation of heterogeneous gene expression. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  12. High accuracy 234U(n,f cross section in the resonance energy region

    Directory of Open Access Journals (Sweden)

    Leal-Cidoncha E.

    2017-01-01

    Full Text Available New results are presented of the 234U neutron-induced fission cross section, obtained with high accuracy in the resonance region by means of two methods using the 235U(n,f as reference. The recent evaluation of the 235U(n,f obtained with SAMMY by L. C. Leal et al. (these Proceedings, based on previous n_TOF data [1], has been used to calculate the 234U(n,f cross section through the 234U/235U ratio, being here compared with the results obtained by using the n_TOF neutron flux.

  13. High accuracy 234U(n,f) cross section in the resonance energy region

    Science.gov (United States)

    Leal-Cidoncha, E.; Durán, I.; Paradela, C.; Tassan-Got, L.; Audouin, L.; Leal, L. C.; Naour, C. Le; Noguere, G.; Tarrío, D.; Leong, L. S.; Altstadt, S.; Andrzejewski, J.; Barbagallo, M.; Bécares, V.; Bečvář, F.; Belloni, F.; Berthoumieux, E.; Billowes, J.; Boccone, V.; Bosnar, D.; Brugger, M.; Calviani, M.; Calviño, F.; Cano-Ott, D.; Carrapiço, C.; Cerutti, F.; Chiaveri, E.; Chin, M.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Diakaki, M.; Domingo-Pardo, C.; Dressler, R.; Eleftheriadis, C.; Ferrari, A.; Fraval, K.; Ganesan, S.; García, A. R.; Giubrone, G.; Gómez-Hornillos, M. B.; Gonçalves, I. F.; González-Romero, E.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Gurusamy, P.; Hernández-Prieto, A.; Jenkins, D. G.; Jericha, E.; Kadi, Y.; Käppeler, F.; Karadimos, D.; Kivel, N.; Kokkoris, M.; Krtička, M.; Kroll, J.; Lampoudis, C.; Langer, C.; Lederer, C.; Leeb, H.; Losito, R.; Mallick, A.; Manousos, A.; Marganiec, J.; Martínez, T.; Massimi, C.; Mastinu, P. F.; Mastromarco, M.; Meaze, M.; Mendoza, E.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Mirea, M.; Mondelaers, W.; Pavlik, A.; Perkowski, J.; Plompen, A.; Praena, J.; Quesada, J. M.; Rauscher, T.; Reifarth, R.; Riego, A.; Robles, M. S.; Roman, F.; Rubbia, C.; Sabaté-Gilarte, M.; Sarmento, R.; Saxena, A.; Schillebeeckx, P.; Schmidt, S.; Schumann, D.; Tagliente, G.; Tain, J. L.; Tsinganis, A.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Versaci, R.; Vermeulen, M. J.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Ware, T.; Weigand, M.; Weiß, C.; Wright, T.; Žugec, P.

    2017-09-01

    New results are presented of the 234U neutron-induced fission cross section, obtained with high accuracy in the resonance region by means of two methods using the 235U(n,f) as reference. The recent evaluation of the 235U(n,f) obtained with SAMMY by L. C. Leal et al. (these Proceedings), based on previous n_TOF data [1], has been used to calculate the 234U(n,f) cross section through the 234U/235U ratio, being here compared with the results obtained by using the n_TOF neutron flux.

  14. 29 CFR 779.234 - Establishments whose only regular employees are the owner or members of his immediate family.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Establishments whose only regular employees are the owner or members of his immediate family. 779.234 Section 779.234 Labor Regulations Relating to Labor... Arrangements § 779.234 Establishments whose only regular employees are the owner or members of his immediate...

  15. 48 CFR 352.234-2 - Notice of earned value management system-post-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-post-award Integrated Baseline Review. 352.234-2 Section 352.234-2 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.234...

  16. 48 CFR 352.234-1 - Notice of earned value management system-pre-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-pre-award Integrated Baseline Review. 352.234-1 Section 352.234-1 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.234-...

  17. Residual β activity of particulate 234Th as a novel proxy for tracking sediment resuspension in the ocean

    Science.gov (United States)

    Lin, Wuhui; Chen, Liqi; Zeng, Shi; Li, Tao; Wang, Yinghui; Yu, Kefu

    2016-06-01

    Sediment resuspension occurs in the global ocean, which greatly affects material exchange between the sediment and the overlying seawater. The behaviours of carbon, nutrients, heavy metals, and other pollutants at the sediment-seawater boundary will further link to climate change, eutrophication, and marine pollution. Residual β activity of particulate 234Th (RAP234) is used as a novel proxy to track sediment resuspension in different marine environments, including the western Arctic Ocean, the South China Sea, and the Southern Ocean. Sediment resuspension identified by high activity of RAP234 is supported by different lines of evidence including seawater turbidity, residence time of total 234Th, Goldschmidt’s classification, and ratio of RAP234 to particulate organic carbon. A conceptual model is proposed to elucidate the mechanism for RAP234 with dominant contributions from 234Th-238U and 212Bi-228Th. The ‘slope assumption’ for RAP234 indicated increasing intensity of sediment resuspension from spring to autumn under the influence of the East Asian monsoon system. RAP234 can shed new light on 234Th-based particle dynamics and should benefit the interpretation of historical 234Th-238U database. RAP234 resembles lithophile elements and has broad implications for investigating particle dynamics in the estuary-shelf-slope-ocean continuum and linkage of the atmosphere-ocean-sediment system.

  18. Determination of (234)th in marine samples by liquid scintillation spectrometry.

    Science.gov (United States)

    Pates, J M; Cook, G T; Mackenzie, A B; Anderson, R; Bury, S J

    1996-11-01

    A liquid scintillation spectrometry method for the determination of (234)Th in seawater with (230)Th as the yield tracer has been developed and validated. (234)Th is separated from the dissolved phase by an Fe(OH)(3) precipitation and is then purified using ion exchange chromatography. The counting source is prepared by taking the sample to dryness in a vial, redissolving in acid, and mixing with a scintillation cocktail. The instrument employed has a relatively low background (11 cpm) and the ability to separate α from β activity on the basis of pulse shapes. The (234)Th + (234m)Pa counting efficiency is 50% over the counting window employed. The limit of detection, using the above parameters, a 20 L sample, and a 400 min count is found to be 0.04 dpm L(-)(1). It was also demonstrated that less advanced instruments, without α/β separation, can also be used effectively.

  19. 450,000 years of groundwater (234U/238U)0 variations in SW Nevada, USA

    Science.gov (United States)

    Wendt, Kathleen A.; Moseley, Gina E.; Pythoud, Mathieu; Dublyansky, Yuri; Edwards, R. Lawrence; Spötl, Christoph

    2017-04-01

    Subaqueous speleothems represent a unique archive for geochemical variations in regional groundwater systems. Devils Hole 2 cave, located in SW Nevada, USA, is an open fault zone intersecting the Ash Meadows groundwater flow system. Speleothem layers that coat the submerged walls of Devils Hole 2 cave record the isotopic composition of groundwater uranium at the time of precipitation. Past variations of 234U/238U initial activity ratios in groundwater may provide insight into paleohydrological conditions, such as changes to groundwater flow rates or source inputs. We aim to reconstruct 450 ka of groundwater (234U/238U)0 variations at Devils Hole 2 cave. To do so, an 80 cm-long core was drilled from the cave wall. Over 100 (234U/238U) and U-Th ages were measured in order to calculate initial activity ratios. Despite relatively constant uranium concentrations and growth rates throughout the core, preliminary results show a range in values (2.851 -2.616) deviating from modern day groundwater (234U/238U)0 which we measured to 2.762 (±0.002). (234U/238U)0 variations appear to follow interglacial-glacial cycles from 450 ka to present day, such that maximum (234U/238U)0 ratios identified at roughly 43, 185, 289, 374, and 449 ka correspond to glacial periods, while minimum (234U/238U)0 ratios at roughly 5, 121, 239, 336 and 422 ka correspond to interglacial periods. Focusing on the last 200 ka, we observe increasing (234U/238U)0 ratios coupled with depleted Devils Hole 2 δ18O values and water table high-stands (Moseley et al. 2016, Science 2016). We suggest that (234U/238U)0 variations are positively correlated to precipitation amount, contrary to dripstone speleothem records in the Great Basin region. Mechanisms driving the fluctuation in (234U/238U)0 values are still uncertain, but may be due to increased inputs of additional minor groundwater sources to the Ash Meadows flow system during pluvial periods.

  20. 234Th analysis of marine sediments via extraction chromatography and liquid scintillation counting.

    Science.gov (United States)

    Nour, Svetlana; Burnett, William C; Horwitz, E Philip

    2002-08-01

    234Th is widely used as a natural tracer for study of biological mixing and particle scavenging processes in the ocean. This naturally occurring nuclide serves this purpose due to its convenient half-life (24.1 days), constant rate of production from 238U dissolved in seawater, and its strong tendency to attach to particles in seawater. As a beta/gamma emitter, 234Th may be determined using low-level gas-flow proportional counting, gamma spectrometry, and liquid scintillation counting (LSC). We describe here a technique which combines Cerenkov counting to evaluate 234Th (via 234Pa) with LSC alpha counting of 230Th added to the samples as a yield tracer. Our separation approach is based on a sample preparation procedure for marine sediments using nitric acid leaching in a "hot block", and extraction chromatography (TEVA x Resin) for Th isolation. Samples are counted in plastic LSC vials, using Ultima Gold AB cocktail, in 1 M H3PO4 media. A series of sediment samples spiked with known amounts of 234Th yielded activities within a few percent of the anticipated values.

  1. Oceanic stratified euphotic zone as elucidated by /sup 234/Th:/sup 238/U disequilibria

    Energy Technology Data Exchange (ETDEWEB)

    Coale, K.H.; Bruland, K.W.

    1987-01-01

    Profiles of dissolved and particulate /sup 234/Th were determined at the VERTEX 2 and 3 stations off Manzanillo, Mexico, and at the VERTEX 4 station about 900 km north of Hawaii. By modeling the disequilibria between /sup 234/Th and /sup 238/U in the dissolved and particulate form, estimates of scavenging rates for Th from the dissolved to particulate phases, particle residence times, and the flux of Th via particle removal can be obtained. /sup 234/Th:/sup 238/U activity ratio profiles indicate that the euphotic zone can be separated into two layers: an upper oligotrophic layer characterized by low new production values, low net scavenging, and long dissolved /sup 234/Th residence times; and a subsurface eutrophic layer with higher new production values, more intense scavenging, and shorter dissolved /sup 234/Th residence times. New production, rather than total primary production may determine net scavenging rates of reactive elements from oceanic surface waters. These results contribute to the emerging descriptions of the layered structure of oligotrophic euphotic zones and support the notion that this may be a general and ubiquitous feature of global stratified oligotrophic regimes.

  2. Influence of {sup 231}Th in the activity determination of {sup 234}Th by Cerenkov counting

    Energy Technology Data Exchange (ETDEWEB)

    Blasiyh Nuno, G.A. [Programa Nacional de Gestion de Residuos Radiactivos, Comision Nacional de Energia Atomica, Centro Atomico Ezeiza, Presbitero Juan Gonzalez, y Aragon No. 15, B1802AYA, Partido de Ezeiza, Provincia de Buenos Aires (Argentina)]. E-mail: blasiyh@cae.cnea.gov.ar; Korob, R.O. [Unidad de Actividad Radioquimica y Quimica de las Radiaciones, Comision Nacional de Energia Atomica, Centro Atomico Ezeiza, Presbitero Juan Gonzalez, y Aragon No. 15, B1802AYA, Partido de Ezeiza, Provincia de Buenos Aires (Argentina)

    2007-05-15

    A precise and simple method for the determination of {sup 234}Th activity by Cerenkov counting is described. A calibrated natural uranium solution (having {sup 234m}Pa and {sup 238}U in secular equilibrium) in 0.1 M HNO{sub 3} is used to construct the calibration curve. Because {sup 231}Th (a {beta}-emitting nuclide present in the decay chain of {sup 235}U) contribution to Cerenkov counting is experimentally proved to be negligible only in the case of low enriched uranium samples, simple calculations are needed to accomplish the activity determination.

  3. Perancangan Dan Pembuatan E-commerce Spare Parts Motor Pada Ud. New 234 Motor

    OpenAIRE

    Aribawa, Made Rendy; Dewi, Lily Puspa; Gunawan, Ibnu

    2013-01-01

    UD. New 234 motor is businesses engaged in the sale of spare parts and a variety of motorcycles in the village of Tinga - Tinga. Sales process still using manual system where the customer can only come directly to find out the latest stuff. In order to use the payment system still uses manual that customers make payments directly come to UD. New 234 Motor. With the e-commerce website is expected to provide a change of the system offline sales to online sales systems are computerized over issu...

  4. Microscopic study of positive-parity yrast bands of 224− 234 Th ...

    Indian Academy of Sciences (India)

    The positive-parity bands in 224−234Th are studied using the projected shell model (PSM) approach. The energy levels, deformation systematics, (2) transition probabilities and nuclear -factors are calculated and compared with the experimental data. The calculation reproduces the observed positive-parity yrast bands ...

  5. 45 CFR 234.70 - Protective payments for the aged, blind, or disabled.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Protective payments for the aged, blind, or... SERVICES FINANCIAL ASSISTANCE TO INDIVIDUALS § 234.70 Protective payments for the aged, blind, or disabled... protective services for families or for the disabled or aged group of which the recipient is a member; and...

  6. 14 CFR 234.10 - Voluntary disclosure of on-time performance codes.

    Science.gov (United States)

    2010-01-01

    ... carrier's reportable flights and each of its single plane one-stop or multi-stop flights, or portions... or (2) For each of the carrier's domestic flights. ... of § 234.8 of this part, the on-time performance codes for the flights for which it voluntarily...

  7. Identification of Rad23-4 gene required for pollen development in ...

    African Journals Online (AJOL)

    雨林木风

    2012-05-31

    May 31, 2012 ... Key words: Nucleotide excision repair (NER), rad23-4 gene, anthocyanin, pollen grains, seeds abortion. INTRODUCTION. Plants are ... Rad23 gene in Arabidopsis were purchased from the ABRC. (Arabidopsis Biological ... exposed to enhanced UV-B for 0-6 h daily for one week. After UV-B treatment, the ...

  8. Non- identical thermochemical behavior of 234U-and 238U- isotopes in metamict britholite.

    Science.gov (United States)

    Skriplev, Mikhail I; Bogdanov, Roman V; Schwink, Lawrence R

    2017-01-01

    A radiochemical analysis of the valence state of uranium isotopes in minerals involves isolation of the U(IV) and U(VI) valence forms and determination of the radioactivity of the 234U and 238U isotopes in each fraction. If the nuclear decay of the uranium in the minerals is accompanied by a redox process, the distribution of the 234U isotope in the U(IV) and U(VI) forms will differ from that of the 238U isotope: oxidation leads to enrichment of the U(VI) fraction with the radiogenic 234U isotope; reduction facilitates enrichment of the U(IV) fraction with 234U. If the mineral is heated to 600-700°C before the radiochemical analysis, then an equilibrium activity ratio (AR) for both valences. The question arises: What are the processes that bring this about? The authors of this research studied changes of the AR in the U(IV) and U(VI) fractions after isochronous thermal annealing. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Arabidopsis rad23-4 gene is required for pollen development under ...

    African Journals Online (AJOL)

    Nucleotide excision repair (NER) is a highly conserved DNA repair pathway for correcting DNA lesions that cause distortion of the double helical structure. The protein heterodimer Rad23 is involved in recognition and binding to such lesions. Here, we showed that rad23-4 (AT5g38470) was expressed in the roots, mature ...

  10. 5 CFR 591.234 - Under what circumstances may people recruited locally receive a post differential?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Under what circumstances may people... Post Differential-Nonforeign Areas Post Differentials § 591.234 Under what circumstances may people... in the post differential area for travel or formal study at the time they are hired and have...

  11. 48 CFR 52.234-1 - Industrial Resources Developed Under Defense Production Act Title III.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Industrial Resources... CLAUSES Text of Provisions and Clauses 52.234-1 Industrial Resources Developed Under Defense Production Act Title III. As prescribed at 34.104, insert the following clause: Industrial Resources Developed...

  12. New explanation for extreme u-234 u-238 disequilibria in a dolomitic aquifer

    CSIR Research Space (South Africa)

    Kronfeld, J

    1994-05-01

    Full Text Available High U-234/U-238 activity ratios are found in the shallow groundwater of the phreatic Transvaal Dolomite Aquifer. The aquifer is uranium poor, while the waters are oxygen rich and young. Tritium and C-14 are used to show that the disequilibrium...

  13. 18 CFR 367.2340 - Account 234, Accounts payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 234, Accounts... COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED... POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Current and Accrued Liabilities § 367.2340...

  14. 25 CFR 900.234 - What types of personal conflicts of interest involving tribal officers, employees or...

    Science.gov (United States)

    2010-04-01

    ... tribal officers, employees or subcontractors would have to be regulated by an Indian tribe? 900.234 Section 900.234 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION...

  15. Low-Lying Collective Levels in 224-234 Th Nuclei

    OpenAIRE

    Diab S. M.

    2008-01-01

    The low-lying collective levels in 224 - 234 Th isotopes are investigated in the frame work of the interacting boson approximation model (IBA-1). The contour plot of the poten- tial energy surfaces, V ( ; ) , shows two wells on the prolate and oblate sides which indicate that all thorium nuclei are deformed and have rotational characters. The levels energy, electromagnetic transition rates B(E1) and B(E2) are calculated. Bending at angular momentu...

  16. 234U/238U as a ground-water tracer, SW Nevada-SE California

    Science.gov (United States)

    Ludwig, K. R.; Peterman, Z.E.; Simmons, K.R.; Gutentag, E.D.

    1993-01-01

    The 234U/238U ratio of uranium in oxidizing ground waters is potentially an excellent ground-water tracer because of its high solubility and insensitivity to chemical reactions. Moreover, recent advances in analytical capability have made possible very precise uranium-isotopic analyses on modest (approx.100 ml) amounts of normal ground water. Preliminary results on waters from SW Nevada/Se California indicate two main mixing trends, but in detail indicate significant complexity requiring three or more main components.

  17. The study of structure in 224–234 thorium nuclei within the framework IBM

    Directory of Open Access Journals (Sweden)

    Lee Su Youn

    2017-01-01

    Full Text Available An investigation has been made of the behaviour of nuclear structure as a function of an increase in neutron number from 224Th to 234Th. Thorium of mass number 234 is a typical rotor nucleus that can be explained by the SU(3 limit of the interacting boson model(IBM in the algebraic nuclear model. Furthermore, 224−232Th lie on the path of the symmetry-breaking phase transition. Moreover, the nuclear structure of 224Th can be explained using X(5 symmetry. However, as 226−230Th nuclei are not fully symmetrical nuclei, they can be represented by adding a perturbed term to express symmetry breaking. Through the following three calculation steps, we identified the tendency of change in nuclear structure. Firstly, the structure of 232Th is described using the matrix elements of the Hamiltonian and the electric quadrupole operator between basis states of the SU(3 limit in IBM. Secondly, the low-lying energy levels and E2 transition ratios corresponding to the observable physical values are calculated by adding a perturbed term with the first-order Casimir operator of the U(5 limit to the SU(3 Hamiltonian in IBM. We compared the results with experimental data of 224−234Th. Lastly, the potential of the Bohr Hamiltonian is represented by a harmonic oscillator, as a result of which the structure of 224−234Th could be expressed in closed form by an approximate separation of variables. The results of these theoretical predictions clarify nuclear structure changes in Thorium nuclei over mass numbers of practical significance.

  18. Descriptive study of the even-even actinide nuclei 230 - 234Th isotopes using IBM-1

    Science.gov (United States)

    Al-Dahan, N.

    2017-06-01

    The nuclear structure of the actinide even-even thorium isotopes from A=230-234 have been investigated within the framework of the Interacting Boson Model (IBM-1). Predictions are given for the excited state energies for the ground state, β and γ-bands, the transition probabilities between these states, the rotational moment of inertia, and the energy staggering in the γ-band energies. The results of these calculations are compared with the experimental data on these isotopes.

  19. The study of structure in 224-234 thorium nuclei within the framework IBM

    Science.gov (United States)

    Lee, Su Youn; Lee, Young Jun; Lee, J. H.

    2017-09-01

    An investigation has been made of the behaviour of nuclear structure as a function of an increase in neutron number from 224Th to 234Th. Thorium of mass number 234 is a typical rotor nucleus that can be explained by the SU(3) limit of the interacting boson model(IBM) in the algebraic nuclear model. Furthermore, 224-232Th lie on the path of the symmetry-breaking phase transition. Moreover, the nuclear structure of 224Th can be explained using X(5) symmetry. However, as 226-230Th nuclei are not fully symmetrical nuclei, they can be represented by adding a perturbed term to express symmetry breaking. Through the following three calculation steps, we identified the tendency of change in nuclear structure. Firstly, the structure of 232Th is described using the matrix elements of the Hamiltonian and the electric quadrupole operator between basis states of the SU(3) limit in IBM. Secondly, the low-lying energy levels and E2 transition ratios corresponding to the observable physical values are calculated by adding a perturbed term with the first-order Casimir operator of the U(5) limit to the SU(3) Hamiltonian in IBM. We compared the results with experimental data of 224-234Th. Lastly, the potential of the Bohr Hamiltonian is represented by a harmonic oscillator, as a result of which the structure of 224-234Th could be expressed in closed form by an approximate separation of variables. The results of these theoretical predictions clarify nuclear structure changes in Thorium nuclei over mass numbers of practical significance.

  20. Characterization of Nops, nodulation outer proteins, secreted via the type III secretion system of NGR234.

    Science.gov (United States)

    Marie, Corinne; Deakin, William J; Viprey, Virginie; Kopciñska, Joanna; Golinowski, Wladyslaw; Krishnan, Hari B; Perret, Xavier; Broughton, William J

    2003-09-01

    The nitrogen-fixing symbiotic bacterium Rhizobium species NGR234 secretes, via a type III secretion system (TTSS), proteins called Nops (nodulation outer proteins). Abolition of TTSS-dependent protein secretion has either no effect or leads to a change in the number of nodules on selected plants. More dramatically, Nops impair nodule development on Crotalaria juncea roots, resulting in the formation of nonfixing pseudonodules. A double mutation of nopX and nopL, which code for two previously identified secreted proteins, leads to a phenotype on Pachyrhizus tuberosus differing from that of a mutant in which the TTSS is not functional. Use of antibodies and a modification of the purification protocol revealed that NGR234 secretes additional proteins in a TTSS-dependent manner. One of them was identified as NopA, a small 7-kDa protein. Single mutations in nopX and nopL were also generated to assess the involvement of each Nop in protein secretion and nodule formation. Mutation of nopX had little effect on NopL and NopA secretion but greatly affected the interaction of NGR234 with many plant hosts tested. NopL was not necessary for the secretion of any Nops but was required for efficient nodulation of some plant species. NopL may thus act as an effector protein whose recognition is dependent upon the hosts' genetic background.

  1. Temporal Variations in 234U/238U Activity Ratios in Four Mississippi River Tributaries

    Science.gov (United States)

    Grzymko, T. J.; Marcantonio, F.

    2005-05-01

    In 2004 we sampled the four tributaries that are the major contributors to the Mississippi River in terms of water discharge, i.e., the Arkansas, Missouri, Upper Mississippi, and Ohio rivers. Each river was sampled four times over the course of the year at variable levels of discharge in an attempt to constrain the causes of the temporal variations of 234U/238U activity ratios in the lower Mississippi River at New Orleans. The tributary uranium data support the idea that lower river uranium isotope and elemental systematics are controlled by a simple mass balance of the source tributary discharges. Furthermore, the uranium isotope ratios of the individual tributaries show coherent patterns of variability. Specifically, the data obtained from the four sampling trips yielded similar patterns of temporal variation in the 234U/238U activity ratios of all of the rivers, although the absolute values of these ratios were distinctly different from one river to the next. The pattern was such that the highest 234U/238U activity ratios were observed during the highest flow associated with the spring freshet while the lowest ratios occurred during the summer. For example, in the Missouri River, the 234U/238U activity ratios varied from 1.51 (February 12) to 1.37 (April 14) to 1.34 (July 16) to 1.37 (November 12), while in the Ohio River the same ratios varied from 1.36 (February 12) to 1.29 (April 14) to 1.21 (July 16) to 1.23 (November 12). The apparent seasonal pattern of these ratios in each tributary has led to several ideas as to the causes of the observed trends. The first, and most obvious, is that in each individual drainage basin there are various source tributaries that contribute to the uranium isotope systematics of the main stem of the tributary of interest. It follows that the variations in the uranium activity ratios may be caused by spatial variations in the source rock chemistry of the drainage basin. Other more complex scenarios can also be envisioned and

  2. Study of 234U(n,f) Resonances Measured at the CERN n_TOF Facility

    CERN Document Server

    Leal-Cidoncha, E; Paradela, C; Tarrío, D; Leong, L S; Audouin, L; Tassan-Got, L; Praena, J; Berthier, B; Ferrant, L; Isaev, S; Le Naour, C; Stephan, C; Trubert, D; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Badurek, G; Baumann, P; Bečvář, F; Berthoumieux, E; Calviño, F; Calviani, M; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P.; Chepel, V; Chiaveri, E.; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S.; Dillmann, I; Domingo-Pardo, C; Dridi, W; Eleftheriadis, C; Embid-Segura, M; Ferrari, A.; Ferreira-Marques, R; Fujii, K; Furman, W; Gonçalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A.; Igashira, M; Jericha, E; Kadi, Y.; Käppeler, F; Karadimos, D; Kerveno, M; Koehler, P; Kossionides, E; Krtička, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Oshima, M; Pancin, J; Papadopoulos, C; Pavlik, A; Pavlopoulos, P.; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T.; Reifarth, R; Rubbia, C.; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L.; Savvidis, I; Tagliente, G; Tain, J L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A.; Villamarin, D; Vincente, M C; Vlachoudis, V.; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K

    2014-01-01

    We present the analysis of the resolved resonance region for the U-234(n,f) cross section data measured at the CERN n\\_TOF facility. The resonance parameters in the energy range from 1 eV to 1500 eV have been obtained with the SAMMY code by using as initial parameters for the fit the resonance parameters of the JENDL-3.3 evaluation. In addition, the statistical analysis has been accomplished, partly with the SAMDIST code, in order to study the level spacing and the Mehta-Dyson correlation.

  3. Quorum sensing in Rhizobium sp. strain NGR234 regulates conjugal transfer (tra) gene expression and influences growth rate.

    Science.gov (United States)

    He, Xuesong; Chang, William; Pierce, Deanne L; Seib, Laura Ort; Wagner, Jennifer; Fuqua, Clay

    2003-02-01

    Rhizobium sp. strain NGR234 forms symbiotic, nitrogen-fixing nodules on a wide range of legumes via functions largely encoded by the plasmid pNGR234a. The pNGR234a sequence revealed a region encoding plasmid replication (rep) and conjugal transfer (tra) functions similar to those encoded by the rep and tra genes from the tumor-inducing (Ti) plasmids of Agrobacterium tumefaciens, including homologues of the Ti plasmid quorum-sensing regulators TraI, TraR, and TraM. In A. tumefaciens, TraI, a LuxI-type protein, catalyzes synthesis of the acylated homoserine lactone (acyl-HSL) N-3-oxo-octanoyl-L-homoserine lactone (3-oxo-C8-HSL). TraR binds 3-oxo-C8-HSL and activates expression of Ti plasmid tra and rep genes, increasing conjugation and copy number at high population densities. TraM prevents this activation under noninducing conditions. Although the pNGR234a TraR, TraI, and TraM appear to function similarly to their A. tumefaciens counterparts, the TraR and TraM orthologues are not cross-functional, and the quorum-sensing systems have differences. NGR234 TraI synthesizes an acyl-HSL likely to be 3-oxo-C8-HSL, but traI mutants and a pNGR234a-cured derivative produce low levels of a similar acyl-HSL and another, more hydrophobic signal molecule. TraR activates expression of several pNGR234a tra operons in response to 3-oxo-C8-HSL and is inhibited by TraM. However, one of the pNGR234a tra operons is not activated by TraR, and conjugal efficiency is not affected by TraR and 3-oxo-C8-HSL. The growth rate of NGR234 is significantly decreased by TraR and 3-oxo-C8-HSL through functions encoded elsewhere in the NGR234 genome.

  4. An Optimization Model for Design of Asphalt Pavements Based on IHAP Code Number 234

    Directory of Open Access Journals (Sweden)

    Ali Reza Ghanizadeh

    2016-01-01

    Full Text Available Pavement construction is one of the most costly parts of transportation infrastructures. Incommensurate design and construction of pavements, in addition to the loss of the initial investment, would impose indirect costs to the road users and reduce road safety. This paper aims to propose an optimization model to determine the optimal configuration as well as the optimum thickness of different pavement layers based on the Iran Highway Asphalt Paving Code Number 234 (IHAP Code 234. After developing the optimization model, the optimum thickness of pavement layers for secondary rural roads, major rural roads, and freeways was determined based on the recommended prices in “Basic Price List for Road, Runway and Railway” of Iran in 2015 and several charts were developed to determine the optimum thickness of pavement layers including asphalt concrete, granular base, and granular subbase with respect to road classification, design traffic, and resilient modulus of subgrade. Design charts confirm that in the current situation (material prices in 2015, application of asphalt treated layer in pavement structure is not cost effective. Also it was shown that, with increasing the strength of subgrade soil, the subbase layer may be removed from the optimum structure of pavement.

  5. Crustal subsidence rate off Hawaii determined from 234U/238U ages of drowned coral reefs

    Science.gov (United States)

    Ludwig, K. R.; Szabo, B. J.; Moore, J.G.; Simmons, K.R.

    1991-01-01

    A series of submerged coral reefs off northwestern Hawaii was formed during (largely glacial) intervals when the rate of local sea-level rise was less than the maximum upward growth rate of the reefs. Mass-spectrometric 234U/238U ages for samples from six such reefs range from 17 to 475 ka and indicate that this part of the Hawaiian Ridge has been subsiding at a roughly uniform rate of 2.6 mm/yr for the past 475 ka. The 234U/238U ages are in general agreement with model ages of reef drowning (based on estimates of paleo-sea-level stands derived from oxygen-isotope ratios of deep-sea sediments), but there are disagreements in detail. The high attainable precision (??10 ka or better on samples younger than ~800 ka), large applicable age range, relative robustness against open-system behavior, and ease of analysis for this technique hold great promise for future applications of dating of 50-1000 ka coral. -Authors

  6. The {sup 234}U neutron capture cross section measurement at the n TOF facility

    Energy Technology Data Exchange (ETDEWEB)

    Lampoudis, C.; Abbondanno, U.; Aerts, G.; A lvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, O.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    The neutron capture cross-section of {sup 234}U has been measured for energies from thermal up to the keV region in the neutron time-of-flight facility n-TOF, based on a spallation source located at CERN. A 4{pi} BaF{sub 2} array composed of 40 crystals, placed at a distance of 184.9 m from the neutron source, was employed as a total absorption calorimeter (TAC) for detection of the prompt {gamma}-ray cascade from capture events in the sample. This text describes the experimental setup, all necessary steps followed during the data analysis procedure. Results are presented in the form of R-matrix resonance parameters from fits with the SAMMY code and compared to the evaluated data of Endf in the relevant energy region, indicating the good performance of the n-TOF facility and the TAC. (authors)

  7. Assessment of uranium exposure from total activity and 234U:238U activity ratios in urine.

    Science.gov (United States)

    Nicholas, T; Bingham, D

    2011-03-01

    Radiation workers at Atomic Weapons Establishment (AWE) are monitored for uranium exposure by routine bioassay sampling (primarily urine sampling). However, the interpretation of uranium in urine and faecal results in terms of occupational intakes is difficult because of the presence of uranium due to intakes from environmental (dietary) sources. For uranium in urine data obtained using current analytical techniques at AWE, the mean, median and standard deviation of excreted uranium concentrations were 0.006, 0.002 and 0.012 μg per g creatinine, respectively. These values are consistent with what might be expected from local dietary intakes and the knowledge that occupational exposures at AWE are likely to be very low. However, some samples do exceed derived investigation levels (DILs), which have been set up taking account of the likely contribution from environmental sources. We investigate how the activity and isotopic composition of uranium in the diet affects the sensitivity of uranium in urine monitoring for occupational exposures. We conclude that DILs based on both total uranium in urine activity and also (234)U:(238)U ratios are useful given the likely variation in dietary contribution for AWE workers. Assuming a background excretion rate and that the enrichment of the likely exposure is known, it is possible to assess exposures using (234)U:(238)U ratios and/or total uranium activity. The health implications of internalised uranium, enriched to 235)U, centre on its nephrotoxicity; the DILs for bioassay samples at AWE are an order of magnitude below the conservative recommendations made by the literature.

  8. A time-series study of particulate matter export in the North Pacific Subtropical Gyre based on 234Th : 238U disequilibrium

    Science.gov (United States)

    Benitez-Nelson, Claudia; Buesseler, Ken O.; Karl, David M.; Andrews, John

    2001-12-01

    Depth profiles of total 234Th (dissolved+particulate) were collected at Station ALOHA (22°45N, 158°00W) in the North Pacific Subtropical Gyre during 9 cruises from April 1999 to March 2000. Samples were collected and processed by a new 2 L technique that enables more detailed depth resolution then previous 234Th studies. Significant zones of particle export ( 234Th deficiency) and particle remineralization ( 234Th excess) were measured both temporally and with depth. 234Th derived particulate carbon (PC) and nitrogen (PN) fluxes were determined with steady-state and non-steady-state models and PC/ 234Th and PN/ 234Th ratios measured with both in situ pumps and free-drifting particle interceptor traps deployed at 150 m. 234Th based export estimates of 4.0±2.3 mmol C m -2 d -1 and 0.53±0.19 mmol N m -2 d -1, were approximately 60% higher than those measured in PIT style sediment traps from the same time period, 2.4±0.2 mmol C m -2 d -1 and 0.32±0.08 mmol N m -2 d -1. Most of this difference is attributable to two large export events that occurred during October and December 1999, when traps undercollected for 234Th by a factor of 2 to 4. 234Th export ( ThE) ratios based on 234Th derived PC flux/ 14C based primary production ranged from 4% to 22% (average=8.8%). Our results confirm the recent estimates of C export by Emerson et al. (Nature 389 (1997) 951) and Sonnerup et al. (Deep-Sea Research I 46 (1999) 777) and indicate that C export from the oligotrophic ocean must be considered when discussing C sequestration in global climate change.

  9. 76 FR 60733 - Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton...

    Science.gov (United States)

    2011-09-30

    .... Basis and Purpose The Captain of the Port New Orleans has implemented a safety zone from mile marker 230... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton Rouge, LA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule...

  10. @u234@@Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.

    allows us to compute the vertical export flux of particulate @u234@@Th. The flux data for the upper 100 m show spatial variations with enhanced export fluxes centered around 22~'N 67~'E, a region characterized by higher rates of column primary...

  11. sup(234) Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.

    (238) U allows us to compute the vertical export flux of particulate sup(234) Th. The flux data for the upper 100 m show spatial variations with enhanced export fluxes centered around 22 degrees N 67 degrees E, a region characterized by higher rates...

  12. IUPAC-IUGS status report on the half-lives of 238U, 235U and 234U

    Science.gov (United States)

    Villa, I. M.; Bonardi, M. L.; De Bièvre, P.; Holden, N. E.; Renne, P. R.

    2016-01-01

    The current state of knowledge on the half-lives of the long-lived U radionuclides has been reviewed by the IUPAC-IUGS joint Task Group ;Isotopes in Geosciences;. 238U is assigned a half-life of (4.4683 ± 0.0096) Ga, i.e. a decay constant λ238 = (0.155125 ± 0.000333) Ga-1. The coverage factor is k = 2 for this and all other estimates presented here. The 238U half-life can be used as a reference for the half-lives/decay constants of all other isotopic geochronometers. A revision of the half-life of 235U based on intercomparison of natural geological samples is premature. The improved repeatability of mass spectrometric measurements has revealed Type B uncertainties that had been dismissed as subordinate in the past. The combined uncertainty of these as yet incompletely charted and quantified sources of Type B uncertainty may be no smaller than the currently accepted uncertainty of the α counting experiments. A provisional value for the 234U half-life can be calculated with the assumption of secular equilibrium in the analyzed natural samples. This assumption has not yet been verified independently and its metrological traceability appears sub-optimum. A Type B evaluation suggests that the ca. 0.17% offset between the N(234U)/N(238U) number-ratios of the natural samples used to estimate the 235U half-life and those of the four samples used to estimate the 234U half-life should be compounded into the standard measurement uncertainty of the latter. The resulting provisional uncertainty interval (k = 2) for the 234U half-life is (244.55-247.77) ka, corresponding to λ234 = (2.8203-2.8344) Ma-1.

  13. 230Th-234U Age-Dating Uranium by Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Williams, R W; Gaffney, A M

    2012-04-18

    This is the standard operating procedure used by the Isotope Ratio Mass Spectrometry Group of the Chemical Sciences Division at LLNL for the preparation of a sample of uranium oxide or uranium metal for {sup 230}Th-{sup 234}U age-dating. The method described here includes the dissolution of a sample of uranium oxide or uranium metal, preparation of a secondary dilution, spiking of separate aliquots for uranium and thorium isotope dilution measurements, and purification of uranium and thorium aliquots for mass spectrometry. This SOP may be applied to uranium samples of unknown purity as in a nuclear forensic investigation, and also to well-characterized samples such as, for example, U{sub 3}O{sub 8} and U-metal certified reference materials. The sample of uranium is transferred to a quartz or PFA vial, concentrated nitric acid is added and the sample is heated on a hotplate at approximately 100 C for several hours until it dissolves. The sample solution is diluted with water to make the solution approximately 4 M HNO{sub 3} and hydrofluoric acid is added to make it 0.05 M HF. A secondary dilution of the primary uranium solution is prepared. Separate aliquots for uranium and thorium isotope dilution measurements are taken and spiked with {sup 233}U and {sup 229}Th, respectively. The spiked aliquot for uranium isotope dilution analysis is purified using EiChrom UTEVA resin. The spiked aliquot for thorium isotope dilution analysis is purified by, first, a 1.8 mL AG1x8 resin bed in 9 M HCl on which U adsorbs and Th passes through; second, adsorbing Th on a 1 mL AG1x8 resin bed in 8 M HNO{sub 3} and then eluting it with 9 M HCl followed by 0.1 M HCl + 0.005 M HF; and third, by passing the Th through a final 1.0 mL AG1x8 resin bed in 9 M HCl. The mass spectrometry is performed using the procedure 'Th and U Mass Spectrometry for {sup 230}Th-{sup 234}U Age Dating'.

  14. 33 CFR 2.34 - Waters subject to tidal influence; waters subject to the ebb and flow of the tide; mean high water.

    Science.gov (United States)

    2010-07-01

    ...; waters subject to the ebb and flow of the tide; mean high water. 2.34 Section 2.34 Navigation and....34 Waters subject to tidal influence; waters subject to the ebb and flow of the tide; mean high water. (a) Waters subject to tidal influence and waters subject to the ebb and flow of the tide are waters...

  15. 20 CFR 234.21 - Definitions of “living with” and “living in the same household.”

    Science.gov (United States)

    2010-04-01

    ... the same household.â 234.21 Section 234.21 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS... “living with” and “living in the same household.” (a) Living with. A widow(er) is considered “living with... employee and spouse were members of the same household; (2) The spouse was receiving regular contributions...

  16. 234U/238U evidence for local recharge and patterns of groundwater flow in the vicinity of Yucca Mountain, Nevada, USA

    Science.gov (United States)

    Paces, J.B.; Ludwig, K. R.; Peterman, Z.E.; Neymark, L.A.

    2002-01-01

    Uranium concentrations and 234U/238U ratios in saturated-zone and perched ground water were used to investigate hydrologic flow and downgradient dilution and dispersion in the vicinity of Yucca Mountain, a potential high-level radioactive waste disposal site. The U data were obtained by thermal ionization mass spectrometry on more than 280 samples from the Death Valley regional flow system. Large variations in both U concentrations (commonly 0.6-10 ??g 1-1) and 234U/238U activity ratios (commonly 1.5-6) are present on both local and regional scales; however, ground water with 234U/238U activity ratios from 7 up to 8.06 is restricted largely to samples from Yucca Mountain. Data from ground water in the Tertiary volcanic and Quaternary alluvial aquifers at and adjacent to Yucca Mountain plot in 3 distinct fields of reciprocal U concentration versus 234U/238U activity ratio correlated to different geographic areas. Ground water to the west of Yucca Mountain has large U concentrations and moderate 234U/238U whereas ground water to the east in the Fortymile flow system has similar 234U/238U, but distinctly smaller U concentrations. Ground water beneath the central part of Yucca Mountain has intermediate U concentrations but distinctive 234U/238U activity ratios of about 7-8. Perched water from the lower part of the unsaturated zone at Yucca Mountain has similarly large values of 234U/238U. These U data imply that the Tertiary volcanic aquifer beneath the central part of Yucca Mountain is isolated from north-south regional flow. The similarity of 234U/238U in both saturated- and unsaturated-zone ground water at Yucca Mountain further indicates that saturated-zone ground water beneath Yucca Mountain is dominated by local recharge rather than regional flow. The distinctive 234U/238U signatures also provide a natural tracer of downgradient flow. Elevated 234U/238U in ground water from two water-supply wells east of Yucca Mountain are interpreted as the result of induced

  17. Structure of the Cellulose Synthase Complex of Gluconacetobacter hansenii at 23.4 Å Resolution.

    Directory of Open Access Journals (Sweden)

    Juan Du

    Full Text Available Bacterial crystalline cellulose is used in biomedical and industrial applications, but the molecular mechanisms of synthesis are unclear. Unlike most bacteria, which make non-crystalline cellulose, Gluconacetobacter hansenii extrudes profuse amounts of crystalline cellulose. Its cellulose synthase (AcsA exists as a complex with accessory protein AcsB, forming a 'terminal complex' (TC that has been visualized by freeze-fracture TEM at the base of ribbons of crystalline cellulose. The catalytic AcsAB complex is embedded in the cytoplasmic membrane. The C-terminal portion of AcsC is predicted to form a translocation channel in the outer membrane, with the rest of AcsC possibly interacting with AcsD in the periplasm. It is thus believed that synthesis from an organized array of TCs coordinated with extrusion by AcsC and AcsD enable this bacterium to make crystalline cellulose. The only structural data that exist for this system are the above mentioned freeze-fracture TEM images, fluorescence microscopy images revealing that TCs align in a row, a crystal structure of AcsD bound to cellopentaose, and a crystal structure of PilZ domain of AcsA. Here we advance our understanding of the structural basis for crystalline cellulose production by bacterial cellulose synthase by determining a negative stain structure resolved to 23.4 Å for highly purified AcsAB complex that catalyzed incorporation of UDP-glucose into β-1,4-glucan chains, and responded to the presence of allosteric activator cyclic diguanylate. Although the AcsAB complex was functional in vitro, the synthesized cellulose was not visible in TEM. The negative stain structure revealed that AcsAB is very similar to that of the BcsAB synthase of Rhodobacter sphaeroides, a non-crystalline cellulose producing bacterium. The results indicate that the crystalline cellulose producing and non-crystalline cellulose producing bacteria share conserved catalytic and membrane translocation components, and

  18. Corrective Action Investigation Plan for Corrective Action Unit 234: Mud Pits, Cellars, and Mud Spills, Nevada Test Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Grant Evenson

    2007-08-01

    Corrective Action Unit 234, Mud Pits, Cellars, and Mud Spills, consists of 12 inactive sites located in the north and northeast section of the NTS. The 12 CAU 234 sites consist of mud pits, mud spills, mud sumps, and an open post-test cellar. The CAU 234 sites were all used to support nuclear testing conducted in the Yucca Flat and Rainier Mesa areas during the 1950s through the 1970s. The CASs in CAU 234 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting appropriate corrective action alternatives.

  19. Comparison of 210Po, 234Th and Sediment-Trap Based Export Fluxes in the Northern Gulf of Mexico

    Science.gov (United States)

    Maiti, K.; Bosu, S.; D'Sa, E. J.; Sutor, M.; Adhikari, P. L.

    2016-02-01

    The northern Gulf of Mexico (NGOM) is one of the well-studied areas of global ocean, especially after the Deepwater Horizon oil spill in 2010 and yet direct estimates of upper ocean POC fluxes from this region is practically nonexistent. In oligotrophic waters of the open Gulf of Mexico, particulate carbon is the main source of particles and POC flux is the key mechanism for the removal of metals and other particle reactive contaminants like polycyclic aromatic hydrocarbons from the upper ocean. Disequilibria between natural radioisotope pairs 238U-234Th and 210Pb-210Po as well as sediment traps have been widely used to measure particle export fluxes from the upper ocean on time scale of few days to months. The present work measured the vertical profiles of total and particle size-fractionated 210Pb, 210Po and 234Th activities, together with particulate carbon concentrations in the Gulf of Mexico during April 2012 and 2013. In spite of the difference in time scale both 210Po and 234Th based estimates are in reasonably agreement with sinking POC fluxes, caught in sediment traps, and each tracer provides unique information about the magnitude and efficiency of the ocean's biological pump. POC flux estimates ranged between 22-41 mgCm-2day-1 at 150m to 9-29 mgCm-2day-1 at 350m. POC export efficiencies ranged between 0.04- 0.10 at 150m which is similar to export efficiencies of 0.11-0.15 calculated from satellite based export production models.

  20. Study of the $^{234}$U(n,f) fission fragment angular distribution at the CERN n_TOF facility

    CERN Document Server

    Cidoncha-Leal, E; Paradela, C; Tarrío, D; Leong, L S; Audouin, L; Tassan-Got, L; Altstadt, S; Andrzejewski, J; Barbagallo, M; Bécares, V; Becvár, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Guerrero, C; Gunsing, F; Gurusamy, P; Hernández-Prieto, A; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Krticka, M; Kroll, J; Lampoudis, C; Langer, C; Lederer, C; Leeb, H; Losito, R; Mallick, A; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P F; Mastromarco, M; Meaze, M; Mendoza, E; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Robles, M S; Roman, F; Rubbia, C; Sabaté-Gilarte, M; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T; Zugec, P

    2014-01-01

    The angular distribution of the f ssion fragments (FFAD) produced in neutron- induced reactions of actinides have been measured with a f ssion detection setup based on parallel-plate avalanche counters (PPACs) at the Neutron Time- Of-Flight (n_TOF) facility at CERN. The main features of the setup and pre- liminary results are reported here forthe 234 U(n,f)reaction measurement show- ing a high concordance with previous data, while providing new results up to 100 MeV.

  1. Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-05-10

    'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'

  2. Neutron Capture Cross Sections and Gamma Emission Spectra from Neutron Capture on 234,236,238U Measured with DANCE

    Science.gov (United States)

    Ullmann, J. L.; Mosby, S.; Bredeweg, T. A.; Couture, A. J.; Haight, R. C.; Jandel, M.; Kawano, T.; O'Donnell, J. M.; Rundberg, R. S.; Vieira, D. J.; Wilhelmy, J. B.; Wu, C.-Y.; Becker, J. A.; Chyzh, A.; Baramsai, B.; Mitchell, G. E.; Krticka, M.

    2014-05-01

    A new measurement of the 238U(n, γ) cross section using a thin 48 mg/cm2 target was made using the DANCE detector at LANSCE over the energy range from 10 eV to 500 keV. The results confirm earlier measurements. Measurements of the gamma-ray emission spectra were also made for 238U(n, γ) as well as 234,236U(n, γ). These measurements help to constrain the radiative strength function used in the cross-section calculations.

  3. Measurements of /sup 234/U, /sup 238/U and /sup 230/Th in excreta of uranium-mill crushermen

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.; Jackson, P.O.; Brodacynski, G.G.; Scherpelz, R.I.

    1982-07-01

    Uranium and thorium levels in excreta of uranium mill crushermen who are routinely exposed to airborne uranium ore dust were measured. The purpose was to determine whether /sup 230/Th was preferentially retained over either /sup 234/U or /sup 238/U in the body. Urine and fecal samples were obtained from fourteen active crushermen with long histories of exposure to uranium ore dust, plus four retired crushermen and three control individuals for comparison. Radiochemical procedures were used to separate out the uranium and thorium fractions, which were then electroplated on stainless steel discs and assayed by alpha spectrometry. Significantly greater activity levels of /sup 234/U and /sup 238/U were measured in both urine and fecal samples obtained from uranium mill crushermen, indicating that uranium in the inhaled ore dust was cleared from the body with a shorter biological half-time than the daughter product /sup 230/Th. The measurements also indicated that uranium and thorium separate in vivo and have distinctly different metabolic pathways and transfer rates in the body. The appropriateness of current ICRP retention and clearance parameters for /sup 230/Th in ore dust is questioned.

  4. 234 nm and 246 nm AlN-Delta-GaN quantum well deep ultraviolet light-emitting diodes

    Science.gov (United States)

    Liu, Cheng; Ooi, Yu Kee; Islam, S. M.; Xing, Huili Grace; Jena, Debdeep; Zhang, Jing

    2018-01-01

    Deep ultraviolet (DUV) AlN-delta-GaN quantum well (QW) light-emitting diodes (LEDs) with emission wavelengths of 234 nm and 246 nm are proposed and demonstrated in this work. Our results reveal that the use of AlN-delta-GaN QW with ˜1-3 monolayer GaN delta-layer can achieve a large transverse electric (TE)-polarized spontaneous emission rate instead of transverse magnetic-polarized emission, contrary to what is observed in conventional AlGaN QW in the 230-250 nm wavelength regime. The switching of light polarization in the proposed AlN-delta-GaN QW active region is attributed to the rearrangement of the valence subbands near the Γ-point. The light radiation patterns obtained from angle-dependent electroluminescence measurements for the Molecular Beam Epitaxy (MBE)-grown 234 nm and 246 nm AlN-delta-GaN QW LEDs show that the photons are mainly emitted towards the surface rather than the edge, consistent with the simulated patterns achieved by the finite-difference time-domain modeling. The results demonstrate that the proposed AlN-delta-GaN QWs would potentially lead to high-efficiency TE-polarized surface-emitting DUV LEDs.

  5. The estuarine chemistry and isotope systematics of 234,238U in the Amazon and Fly Rivers

    Science.gov (United States)

    Swarzenski, P.; Campbell, P.; Porcelli, D.; McKee, B.

    2004-01-01

    Natural concentrations of 238U and ??234U values were determined in estuarine surface waters and pore waters of the Amazon and Fly (Papua New Guinea) Rivers to investigate U transport phenomena across river-dominated land-sea margins. Discharge from large, tropical rivers is a major source of dissolved and solid materials transported to the oceans, and are important in defining not only oceanic mass budgets, but also terrestrial weathering rates. On the Amazon shelf, salinity-property plots of dissolved organic carbon, pH and total suspended matter revealed two vastly contrasting water masses that were energetically mixed. In this mixing zone, the distribution of uranium was highly non-conservative and exhibited extensive removal from the water column. Uranium removal was most pronounced within a salinity range of 0-16.6, and likely the result of scavenging and flocculation reactions with inorganic (i.e., Fe/Mn oxides) and organic colloids/particles. Removal of uranium may also be closely coupled to exchange and resuspension processes at the sediment/water interface. An inner-shelf pore water profile indicated the following diagenetic processes: extensive (???1 m) zones of Fe(III) - and, to a lesser degree, Mn(IV) - reduction in the absence of significant S(II) concentrations appeared to facilitate the formation of various authigenic minerals (e.g., siderite, rhodocrosite and uraninite). The pore water dissolved 238U profile co-varied closely with Mn(II). Isotopic variations as evidenced in ??234U pore waters values from this site revealed information on the origin and history of particulate uranium. Only after a depth of about 1 m did the ??234U value approach unity (secular equilibrium), denoting a residual lattice bound uranium complex that is likely an upper-drainage basin weathering product. This suggests that the enriched ??234U values represent a riverine surface complexation product that is actively involved in Mn-Fe diagenetic cycles and surface

  6. Internal tides and sediment dynamics in the deep sea-Evidence from radioactive Th-234/U-238 disequilibria

    Energy Technology Data Exchange (ETDEWEB)

    Turnewitsch, R. [Scottish Assoc Marine Sci, Dunstaffnage Marine Lab, Oban PA37 1QA, Argyll (United Kingdom); Turnewitsch, R.; Waniek, J.J. [Balt Sea Res Inst Warnemunde, D-18119 Rostock (Germany); Reyss, J.L. [Lab Sci Climat and Environm, F-91198 Gif Sur Yvette (France); Nycander, J. [Stockholm Univ, Dept Meteorol, S-10691 Stockholm (Sweden); Lampitt, R.S. [Natl Oceanog Ctr, Southampton SO14 3ZH, Hants (United Kingdom)

    2008-07-01

    Residual flow, baro-tropic tides and internal (baro-clinic) tides interact in a number of ways with kilometer-scale sea floor topography such as abyssal hills and sea mounts. Because of their likely impact on vertical mixing such interactions are potentially important for ocean circulation and the mechanisms and the geometry of these interactions are a matter of ongoing studies. In addition, very little is known about how these interactions are reflected in the sedimentary record. This multi-year study investigates if flow/topography interactions are reflected in distributional patterns of the natural short-lived (half-life: 24.1 d) particulate-matter tracer {sup 234}Th relative to its conservative (non-particle-reactive) and very long-lived parent nuclide {sup 238}U. The sampling sites were downstream of, or surrounded by, fields of short sea mounts and, therefore, very likely to be influenced by nearby flow/topography interactions. At the sampling sites between about 200 and 1000 m above the sea floor recurrent 'fossil' disequilibria were detected. 'Fossil' disequilibria are defined by clearly detectable {sup 234}Th/{sup 238}U disequilibria (total {sup 234}Th radioactivity {<=}{sup 238}U radioactivity, indicating a history of intense particulate {sup 234}Th scavenging and particulate-matter settling from the sampled parcel of water) and conspicuously low particle-associated {sup 234}Th activities. 'Fossil' disequilibria were centered at levels in the water column that correspond to the average height of the short sea mounts near the sampling sites. This suggests the 'fossil' disequilibria are formed on the sea mount slopes. Moreover, the magnitude of the 'fossil' disequilibria suggests that the slopes of the short sea mounts in the study region are characterized by particularly vigorous fluid dynamics. Since 'fossil' disequilibria already occurred at {approx} O (1-10 km) away from the sea mount slopes it

  7. Seasonal variations of total {sup 234}Th and dissolved {sup 238}U concentration activities in surface water of Bransfield Strait, Antarctica, from March to October 2011

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R., E-mail: fvlapa@ipen.br, E-mail: jolivei@ipen.br, E-mail: lice_mrc@hotmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), Sao Paulo, SP (Brazil). Laboratorio de Radiometria Ambiental; Braga, Elisabete S., E-mail: edsbraga@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Inst. Oceanografico. Lab. de Nutrientes, Micronutrientes e Tracos nos Oceanos

    2013-07-01

    In this study the naturally occurring radionuclides {sup 234}Th and {sup 238}U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO{sub 2} via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total {sup 234}Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L{sup -1} (station EB 011) during March/11 campaign, while in October/11 total {sup 234}Th activity concentrations varied from 1.4 to 2.9 dpm L{sup -1}. Highest total {sup 234}Th activities were found late in the austral summer season. Activity concentrations of dissolved {sup 238}U in surface seawater varied from 2.1 to 2.4 dpm L{sup -1}. Taking into account all sampling stations established in March and October/11 the relative variability of total {sup 234}Th distribution was 22%. (author)

  8. NopP, a phosphorylated effector of Rhizobium sp. strain NGR234, is a major determinant of nodulation of the tropical legumes Flemingia congesta and Tephrosia vogelii.

    Science.gov (United States)

    Skorpil, Peter; Saad, Maged M; Boukli, Nawal M; Kobayashi, Hajime; Ares-Orpel, Florencia; Broughton, William J; Deakin, William J

    2005-09-01

    Rhizobium sp. NGR234 nodulates many plants, some of which react to proteins secreted via a type three secretion system (T3SS) in a positive- (Flemingia congesta, Tephrosia vogelii) or negative- (Crotalaria juncea, Pachyrhizus tuberosus) manner. T3SSs are devices that Gram-negative bacteria use to inject effector proteins into the cytoplasm of eukaryotic cells. The only two rhizobial T3SS effector proteins characterized to date are NopL and NopP of NGR234. NopL can be phosphorylated by plant kinases and we show this to be true for NopP as well. Mutation of nopP leads to a dramatic reduction in nodule numbers on F. congesta and T. vogelii. Concomitant mutation of nopL and nopP further diminishes nodulation capacity to levels that, on T. vogelii, are lower than those produced by the T3SS null mutant NGR(Omega)rhcN. We also show that the T3SS of NGR234 secretes at least one additional effector, which remains to be identified. In other words, NGR234 secretes a cocktail of effectors, some of which have positive effects on nodulation of certain plants while others are perceived negatively and block nodulation. NopL and NopP are two components of this mix that extend the ability of NGR234 to nodulate certain legumes.

  9. Particle-reactive radionuclides (234Th, 210Pb, 210 as tracers for the estimation of export production in the South China Sea

    Directory of Open Access Journals (Sweden)

    P. H. Santschi

    2011-12-01

    Full Text Available The time-series station, SEATS (18° N, 116° E in the South China Sea was visited six times during October 2006–December 2008 to carry out seawater sampling and floating trap deployments for the determination of distributions and fluxes of POC, PIC, PN, 234Th, 210Pb, and 210Po in the upper 200 m of the water column. Radionuclide deficiencies resulted in removal fluxes from the euphotic layer of 1.1×103–1.8×103 dpm m−2d−1 and 7.1–40.2 dpm m−2d−1 for 234Th and 210Po, respectively. Due to atmospheric input, an excess of 210Pb relative to 226Ra is commonly observed in the upper water column. Sinking fluxes of total mass, POC, PIC, PN, 234Th, 210Pb, and 210Po measured at the euphotic depth were low in summer-fall and high in winter-spring, reflecting the seasonal variability of biological pumping. Excluding the suspiciously low primary productivity data point in July 2007, a relatively high e-ratio of 0.28–0.69 was estimated by the ratio of the POC flux at the euphotic depth and the integrated primary productivity. The ratios of 234Th, 210Pb, and 210Po to organic carbon, inorganic carbon, and nitrogen in the sinking particles were combined with the disequilibria of 234Th–238U, 210Pb–226Ra, and 210Po–210Pb to estimate export fluxes of POC, PIC, and PN from the euphotic layer. Compared with measured fluxes by the sediment trap and estimated fluxes by other approaches, it is concluded that the export production in the South China Sea, ranging from 1.8 to 21.3 mmol-C m−2d−1, can be reasonably estimated using 234Th, 210Pb, and 210Po as carbon proxies.

  10. Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions

    CERN Multimedia

    We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV

  11. Dynamic dipole polarizabilities and C 6 dispersion coefficients for small clusters of beryllium Be n ( n=2,3,4)

    Science.gov (United States)

    Bégué, D.; Mérawa, M.; Rérat, M.; Pouchan, C.

    1999-02-01

    Dipole polarizabilities ( α), first ( β) and second ( γ) hyperpolarizabilities are obtained for small clusters of beryllium Be n ( n=2,3,4) in a systematic study of basis set effects from CPHF calculations. In all cases, our static results are new and serve as a benchmark for future calculations. Electron correlation obtained at the MRDCI, MP4SDQ(T) and CCSD(T) levels reduces significantly the magnitude of the mean dipole polarizability of both clusters. Dynamic dipole polarizabilities calculated using TDGI method are given for a range of real ( ω=0-0.2 a.u.) and imaginary frequencies ( ω=0-4 a.u.). Corresponding isotropic and anisotropic dispersion coefficients between these clusters are also reported.

  12. Particle export from the euphotic zone: Estimates using a novel drifting sediment trap, 234Th and new production

    Science.gov (United States)

    Lampitt, R. S.; Boorman, B.; Brown, L.; Lucas, M.; Salter, I.; Sanders, R.; Saw, K.; Seeyave, S.; Thomalla, S. J.; Turnewitsch, R.

    2008-11-01

    We describe the first results obtained using a novel free-drifting neutrally buoyant sediment trap called PELAGRA (Particle Export measurement using a LAGRAngian trap). The trap uses an APEX float (Autonomous Profiling EXplorer) to maintain its location at a predetermined depth or density horizon and is designed to be deployed in the depth range 100-600 m for periods of up to a week. PELAGRA was deployed into a well characterised region of the Northeast (NE) Atlantic over the Porcupine Abyssal Plain (PAP) during the summers of 2003, 2004, 2005 and 2006 in post-bloom conditions. In parallel, measurements were made of total and new primary production and estimates of particle export based on 234Th deficits in the upper water column. Samples of sinking material from PELAGRA were recovered almost uncontaminated by "swimmers". The material collected differed from that obtained using water bottles and an in situ filtration system and this indicated selective export of centric diatoms. Fluxes of 234Th into the traps were less than that calculated from the deficit of this isotope in the upper water column. It is concluded that this reflects export events that had occurred prior to these deployments. Fluxes of organic carbon into the PELAGRA traps were similar to those expected from measurements of new production in the upper mixed layer. During 2006, simultaneous PELAGRA deployments at depths of 150 and 250 m provided a direct measurement of the decrease in flux with depth. This decrease was substantially more than that predicted by the often-used "Martin equation" and yielded a " b value" of 1.7. Using this value in the NE Atlantic about 14% of the total production reaches a depth of 150 m during the post-bloom period under nutrient limitation.

  13. CREATING THE KULTUK POLYGON FOR EARTHQUAKE PREDICTION: VARIATIONS OF (234U/238U) AND 87SR/86SR IN GROUNDWATER FROM ACTIVE FAULTS AT THE WESTERN SHORE OF LAKE BAIKAL

    OpenAIRE

    S. V. Rasskazov; E. P. Chebykin; A. M. Ilyasova; E. N. Vodneva; I. S. Chuvashova; S. A. Bornyakov; A. K. Seminsky; S. V. Snopkov; V. V. Chechel'nitsky; N. A. Gileva

    2015-01-01

    Introduction. Determinations of (234U/238U) in groundwater samples are used for monitoring current deformations in active faults (parentheses denote activity ratio units). The cyclic equilibrium of activity ratio 234U/238U≈≈(234U/238U)≈γ≈1 corresponds to the atomic ratio ≈5.47×10–5. This parameter may vary due to higher contents of 234U nuclide in groundwater as a result of rock deformation. This effect discovered by P.I. Chalov and V.V. Cherdyntsev was described in [Cherdyntsev, 1969, 1973; ...

  14. X-ray diffraction and infrared studies of FexMn2.34-xNi0.66O4 (0

    NARCIS (Netherlands)

    Wang, Zhichun; Wang, Zhongbing; Zhao, Chunhua; Yang, Pinghua; Winnubst, Aloysius J.A.; Chen, Chusheng

    2006-01-01

    Series of FexMn2.34−xNi0.66O4 (0 < x < 1) NTC ceramics were prepared by the Pechini method. Resistivity, thermal constant (B) and aging values were measured. It was found that the resistivity increased with increasing iron content x. The B value however first decreased with increasing x in the range

  15. Symbiosis-Promoting and Deleterious Effects of NopT, a Novel Type 3 Effector of Rhizobium sp. Strain NGR234

    Science.gov (United States)

    Dai, Wei-Jun; Zeng, Yong; Xie, Zhi-Ping; Staehelin, Christian

    2008-01-01

    Establishment of symbiosis between certain host plants and nitrogen-fixing bacteria (“rhizobia”) depends on type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS). Here, we report that the open reading frame y4zC of strain NGR234 encodes a novel rhizobial type 3 effector, termed NopT (for nodulation outer protein T). Analysis of secreted proteins from NGR234 and T3SS mutants revealed that NopT is secreted via the T3SS. NopT possessed autoproteolytic activity when expressed in Escherichia coli or human HEK 293T cells. The processed NopT exposed a glycine (G50) to the N terminus, which is predicted to be myristoylated in eukaryotic cells. NopT with a point mutation at position C93, H205, or D220 (catalytic triad) showed strongly reduced autoproteolytic activity, indicating that NopT is a functional protease of the YopT-AvrPphB effector family. When transiently expressed in tobacco plants, proteolytically active NopT elicited a rapid hypersensitive reaction. Arabidopsis plants transformed with nopT showed chlorotic and necrotic symptoms, indicating a cytotoxic effect. Inoculation experiments with mutant derivatives of NGR234 indicated that NopT affected nodulation either positively (Phaseolus vulgaris cv. Yudou No. 1; Tephrosia vogelii) or negatively (Crotalaria juncea). We suggest that NopT-related polymorphism may be involved in evolutionary adaptation of NGR234 to particular host legumes. PMID:18487326

  16. Symbiosis-promoting and deleterious effects of NopT, a novel type 3 effector of Rhizobium sp. strain NGR234.

    Science.gov (United States)

    Dai, Wei-Jun; Zeng, Yong; Xie, Zhi-Ping; Staehelin, Christian

    2008-07-01

    Establishment of symbiosis between certain host plants and nitrogen-fixing bacteria ("rhizobia") depends on type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS). Here, we report that the open reading frame y4zC of strain NGR234 encodes a novel rhizobial type 3 effector, termed NopT (for nodulation outer protein T). Analysis of secreted proteins from NGR234 and T3SS mutants revealed that NopT is secreted via the T3SS. NopT possessed autoproteolytic activity when expressed in Escherichia coli or human HEK 293T cells. The processed NopT exposed a glycine (G50) to the N terminus, which is predicted to be myristoylated in eukaryotic cells. NopT with a point mutation at position C93, H205, or D220 (catalytic triad) showed strongly reduced autoproteolytic activity, indicating that NopT is a functional protease of the YopT-AvrPphB effector family. When transiently expressed in tobacco plants, proteolytically active NopT elicited a rapid hypersensitive reaction. Arabidopsis plants transformed with nopT showed chlorotic and necrotic symptoms, indicating a cytotoxic effect. Inoculation experiments with mutant derivatives of NGR234 indicated that NopT affected nodulation either positively (Phaseolus vulgaris cv. Yudou No. 1; Tephrosia vogelii) or negatively (Crotalaria juncea). We suggest that NopT-related polymorphism may be involved in evolutionary adaptation of NGR234 to particular host legumes.

  17. Testing the FOODBANCS hypothesis: Seasonal variations in near-bottom particle flux, bioturbation intensity, and deposit feeding based on 234Th measurements

    Science.gov (United States)

    McClintic, Mark A.; DeMaster, David J.; Thomas, Carrie J.; Smith, Craig R.

    2008-11-01

    Naturally occurring 234Th (24-d half-life) was used on the West Antarctic continental shelf to evaluate temporal variations in the flux of particulate material reaching the seabed, bioturbation intensity, the seasonal continuity of feeding by benthic fauna, and trends in particle selection during ingestion for six common detritivores (four surface deposit feeders and two subsurface deposit feeders). These measurements were made at three stations during the five FOODBANCS cruises (December 1999, March, June, and October 2000, and March 2001) to assess the nature of pelagic-benthic coupling on the shelf and to evaluate the seabed as a potential food bank for deposit feeders when surface primary production is minimal. Two summer regimes were sampled (March 2000 and March 2001) with the latter exhibiting a distinct 1-2-cm-thick phytodetritus layer in nearly all sediment core samples. At site B, the 234Th fluxes into the near-bottom (150/170 mab) sediment traps were indistinguishable for the December-March 2000, March-June 2000, and June-October 2000 sampling intervals (fluxes ranging from 170 to 280 dpm m -2 d -1). However, the sediment-trap 234Th flux measured for the October 2000-March 2001 interval (1000 dpm m -2 d -1) was ˜5-fold greater than during the other three sampling periods, consistent with the deposition of a phytodetritus layer. The steady-state 234Th fluxes derived from seabed inventories at site B were 2.4-2.7 times greater than the sediment-trap 234Th fluxes, indicating substantial scavenging of this particle-reactive radiotracer in the bottom 150 m of the water column and/or lateral transport near the seabed. The seabed 234Th inventories at the three stations showed no variation during the first four cruises, but were significantly greater during cruise FB-V (March 2001), when the phytodetritus layer occurred. Based on 234Th distributions in the seabed, bioturbation intensities (quantified using the diffusive mixing coefficient, Db) varied from 0

  18. POC export from ocean surface waters by means of 234Th/ 238U and 210Po/ 210Pb disequilibria: A review of the use of two radiotracer pairs

    Science.gov (United States)

    Verdeny, Elisabet; Masqué, Pere; Garcia-Orellana, Jordi; Hanfland, Claudia; Kirk Cochran, J.; Stewart, Gillian M.

    2009-08-01

    234Th ( T1/2=24.1 d) and 210Po ( T1/2=138.4 d) are particle reactive radioisotopes that are used as tracers for particle cycling in the upper ocean. Particulate organic carbon (POC) export has frequently been estimated using 234Th/ 238U disequilibrium. Recent evidence suggests that 210Po/ 210Pb disequilibrium may be used as an additional tool to examine particle export, given the direct biological uptake of 210Po into cellular material. Differences in these two radioisotope pairs with regard to their half-lives, particle reactivity and scavenging affinity in seawater should provide complementary information to be obtained on the processes occurring in the water column. Here, we review eight different studies that have simultaneously used both approaches to estimate POC export fluxes from the surface ocean. Our aim is to provide a complete "dataset" of all the existing POC flux data derived from the coupled use of both 234Th and 210Po and to evaluate the advantages and limitations of each tracer pair. Our analysis suggests that the simultaneous use of both radiotracers provides more useful comparative data than can be derived from the use of a single tracer alone. The difference in half-lives of 234Th and 210Po enables the study of export production rates over different time scales. In addition, their different biogeochemical behaviour and preferred affinity for specific types of particles leads to the conclusion that 234Th is a better tracer of total mass flux, whereas 210Po tracks POC export more specifically. The synthesis presented here is also intended to provide a basis for planning future sampling strategies and promoting further work in this field to help reveal the more specific application of each tracer under specific water column biogeochemistries.

  19. Accidental nuclear excursion Recuplex operation 234-5 facility. Final report: Date of incident: April 7, 1962

    Energy Technology Data Exchange (ETDEWEB)

    1962-08-01

    On Saturday morning, April 7, 1962, at about 1059 Armed Forces time, an accidental nuclear excursion occurred in the plutonium waste recovery facility (Recuplex) of the 234-5 Building. This excursion did not result in any mechanical damage or spread of contamination. Three employees of the General Electric Company received overexposures to gamma and neutron radiation. None were fatally exposed; in each case the overexposure was recognized promptly, and following medical observation and testing the men were released to return to work. In compliance with AEC Manual Chapter 0703, an AEC-HAPO committee composed of two AEC employees and five General Electric employees was appointed by the Manger, HOO, with the concurrence of the General Manager, HAPO, to conduct an investigation of the incident. The committee`s purpose was to determine the cause, nature, and extent of the incident, and recommend action to be taken by others to minimize or preclude future incidents of this magnitude. A study of operating practices and operating conditions that appeared to exist prior to, during, and subsequent to the accident was made by the committee. The committee believes that this report provides sufficient information to answer questions which may arise as a result of the criticality incident except those relating to its cause.

  20. Gamma-Ray Emission Spectra as a Constraint on Calculations of 234 , 236 , 238U Neutron-Capture Cross Sections

    Science.gov (United States)

    Ullmann, J. L.; Krticka, M.; Kawano, T.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Haight, R. C.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Rundberg, R. S.; Vieira, D. J.; Wilhelmy, J. B.; Becker, J. A.; Wu, C. Y.; Chyzh, A.

    2015-10-01

    Calculations of the neutron-capture cross section at low neutron energies (10 eV through 100's of keV) are very sensitive to the nuclear level density and radiative strength function. These quantities are often poorly known, especially for radioactive targets, and actual measurements of the capture cross section are usually required. An additional constraint on the calculation of the capture cross section is provided by measurements of the cascade gamma spectrum following neutron capture. Recent measurements of 234 , 236 , 238U(n, γ) emission spectra made using the DANCE 4 π BaF2 array at the Los Alamos Neutron Science Center will be presented. Calculations of gamma-ray spectra made using the DICEBOX code and of the capture cross section made using the CoH3 code will also be presented. These techniques may be also useful for calculations of more unstable nuclides. This work was performed with the support of the U.S. Department of Energy, National Nuclear Security Administration by Los Alamos National Security, LLC (Contract DE-AC52-06NA25396) and Lawrence Livermore National Security, LLC (Contract DE-AC52-07NA2734).

  1. Particle-reactive radionuclides ({sup 234}Th, {sup 210}Pb, {sup 210}Po) as tracers for the estimation of export production in the South China Sea

    Energy Technology Data Exchange (ETDEWEB)

    Wei, C.L.; Lin, S.Y.; Yi, M.C.; Wen, L.S. [National Taiwan Univ., Taipei (China). Inst. of Oceanography; Sheu, D.D.D. [National Sun Yat-sen Univ., Kaohsiung, Taiwan (China). Inst. of Marine Geology and Chemistry; Chou, W.C. [National Taiwan Ocean Univ., Keelung (China). Inst. of Marine Environmental Chemistry and Ecology; Santschi, P.H. [Texas A and M Univ., Galveston, TX (United States). Dept. of Oceanography and Marine Sciences

    2011-07-01

    The time-series station, SEATS (18 N, 116 E) in the South China Sea was visited six times during October 2006-December 2008 to carry out seawater sampling and floating trap deployments for the determination of distributions and fluxes of POC, PIC, PN, {sup 234}Th, {sup 210}Pb, and {sup 210}Po in the upper 200 m of the water column. Radionuclide deficiencies resulted in removal fluxes from the euphotic layer of 1.1 x 10{sup 3}-1.8 x 10{sup 3} dpm m{sup -2}d{sup -1} and 7.1-40.2 dpm m{sup -2}d{sup -1} for {sup 234}Th and {sup 210}Po, respectively. Due to atmospheric input, an excess of {sup 210}Pb relative to {sup 226}Ra is commonly observed in the upper water column. Sinking fluxes of total mass, POC, PIC, PN, {sup 234}Th, {sup 210}Pb, and {sup 210}Po measured at the euphotic depth were low in summer-fall and high in winter-spring, reflecting the seasonal variability of biological pumping. Excluding the suspiciously low primary productivity data point in July 2007, a relatively high e-ratio of 0.28-0.69 was estimated by the ratio of the POC flux at the euphotic depth and the integrated primary productivity. The ratios of {sup 234}Th, {sup 210}Pb, and {sup 210}Po to organic carbon, inorganic carbon, and nitrogen in the sinking particles were combined with the disequilibria of {sup 234}Th-{sup 238}U, {sup 210}Pb-{sup 226}Ra, and {sup 210}Po-{sup 210}Pb to estimate export fluxes of POC, PIC, and PN from the euphotic layer. Compared with measured fluxes by the sediment trap and estimated fluxes by other approaches, it is concluded that the export production in the South China Sea, ranging from 1.8 to 21.3 mmol-C m{sup -2}d{sup -1}, can be reasonably estimated using {sup 234}Th, {sup 210}Pb, and {sup 210}Po as carbon proxies.

  2. 234U/238U Disequilibria along sedimentary discontinuities in a deep formation: late diagenetic U-relocation processes vs. large scale fluid circulation evidence ?

    Science.gov (United States)

    Deschamps, P.; Hillaire-Marcel, C.; Michelot, J.-L.; Doucelance, R.; Ghaleb, B.

    2003-04-01

    This work is part of geological investigations undertaken by the French Agency for Nuclear Waste Management (ANDRA) in order to study the safety of radioactive waste repository in deep geological clay layers. The target formation, from Mesozoic sedimentary rocks of the eastern Paris basin (France), is a thick (130--145 m), 400--500 m deep, Callovo-Oxfordian argilite unit, that is over- and underlain by Oxfordian and Bathonian limestones, respectively. Borehole core samples have been analysed for their uranium content and 234U/238U isotopic composition in order to examine the state of radioactive equilibrium existing between these two radionuclides naturally occurring in the rock. Any observations of disequilibrium should allow i) to document the mobility of these actinides in such deposits, and ii) to constrain the time scale of the geological phenomena responsible for it. Highly precise and accurate (234U/238U) analyses were obtained using Multiple Collector Inductively Coupled Plasma Mass Spectrometry. The overall reproducibility, including both chemical separation and spectrometric measurement, is about 0.15% (2σ). Most samples of the target formation and its bounding rocks display secular equilibrium. However, in the Bathonian formation near the interface with the argilite layer, significant (234U/238U) disequilibria are observed along sub-horizontal sedimentary discontinuities, identified as styloliths, indicating that the process involved has been active during the last Ma. Isotopic and elemental compositions of uranium have been determined along a transect, perpendicular to a major discontinuity. The transect exhibits a symmetric pattern relative to this discontinuity with: (1) an increase of the U-concentration towards the stylolitic joint and (2) a sharp transition between significant (234U/238U) < 1 disequilibria in the stylolith to an excess of 234U ((234U/238U) = 1.05) in the vicinity of the joint, followed by a smooth decrease of the activity ratio

  3. 'Destined for the downfall and rise of many in Israel': Luke 2:34b in patristic (and modern exegesis

    Directory of Open Access Journals (Sweden)

    J. H. Barkhuizen

    1995-01-01

    Full Text Available A close reading of both patristic and modem exegetes points towards the existence of two main schools of thought, and the aim of this short paper is to introduce the main proponents of each school, stating both the basic notion of each and the biblical evidence serving as the basis for their subsequent argumentation. The paper concludes with some suggestions for further discussion What did Simeon mean when he referred to the child Jesus in Luke 2:34b, as the downfall and rise of many in Israel? A close reading of both patristic and modem exegetes points towards the existence of two main schools of thought 1. The prophecy of Simeon 'has usually been interpreted as the fall of some and the rising of others, that is a process of self-judgement in which men determine the verdict to be passed on their lives, by tile response they make to the coming of the Messiah' (Caird 1979:64. One very typical commentary within this school of thought is for example the following by Fritz Rienecker (1977:69: Es zeugt von einem tiefen Blick des alten Simeon, dass er die Verheis-sung des Jesaja (Kap  8,13-15 in  Christus sich erftillen sieht. Alle mussen in Israel an Ihm vorbei und keiner kann Ihn unbeachtet lassen. Israel ist 'Wie ein Strom, der sich an Christus, dem Felsen, brechen und zwiegeteilt weiterstromen wird. Dem einen zum Fall, dem andem zum Reil.

  4. Catalytic and kinetic spectrophotometric method for determination of vanadium(V by 2,3,4-trihydroxyacetophenonephenylhydrazone

    Directory of Open Access Journals (Sweden)

    P.V. Chalapathi

    2014-12-01

    Full Text Available A new catalytic and kinetic spectrophotometric method for the determination of vanadium(V was studied using 2,3,4-trihydroxyacetophenonephenylhydrazone (THAPPH as an analytical reagent. The present method was developed on the catalytic effect of vanadium on oxidation of THAPPH by hydrogen peroxide in hydrochloric acid–potassium chloride buffer (pH = 2.8 at the 20th minute. The metal ion has formed 1:2 (M:L complex with THAPPH. Beer’s law was obeyed in the range 20–120 ng/mL of V(V at λmax 390 nm. The sensitivity of the method was calculated in terms of molar absorptivity (1.999 × 105 L mol−1cm−1 and Sandell’s sensitivity (0.000254 μg cm−2, shows that this method is more sensitive. The standard deviation (0.0022, relative standard deviation (0.56%, confidence limit (±0.0015 and standard error (0.0007 revealed that the developed method has more precision and accuracy. The stability constant was calculated with the help of Asmu’s (9.411 × 10−11 and Edmond’s & Birnbaum’s (9.504 × 10−11 methods at room temperature. The interfering effect of various cations and anions was also studied. The present method was successfully applied for the determination of vanadium(V in environmental and alloy samples. The method’s validity was checked by comparing the results obtained with atomic-absorption spectrophotometry and also by evaluation of results using F-test.

  5. Efecto de la adición del absorbedor UV (Tinuvin 234 sobre la calidad del aceite de soja en envases de polietileno tereftalato (PET

    Directory of Open Access Journals (Sweden)

    Mara Block, Jane

    2005-12-01

    Full Text Available In this work, the effect of the addition of the UV absorber Tinuvin 234 on the quality of soybean oil packaged in PET bottles stored at ambient temperature for 6 months under fluorescent light (634 lux. Along this period determinations were made of: peroxide value (PV, free fatty acids (FFA, specific extinction at 232 and 270 nm (EE and sensorial evaluation (SE. The analysis of variance and resistance between the linear coefficients of each treatment indicates that significant difference does not exist (pEn este trabajo, se investigó el efecto de la adición del absorbedor de UV Tinuvin 234 sobre la calidad de aceite de soja envasado en PET y almacenado bajo luz fluorescente (634 lux y temperatura ambiente (25 °C durante 6 meses. La evaluación del aceite se realizó mediante las determinaciones del: Índice de peróxido (IP, Ácidos grasos libres (AGL, Coeficiente de extinción específica a 232 y 270 nm (EE y evaluación sensorial (AS. El análisis de varianza y de contraste entre los coeficientes lineales de cada tratamiento indica que no existe diferencia significativa (p<0,0001 durante el almacenamiento en relación a todos las determinaciones (IP, AGL, EE y AS. Los resultados indican que la adición del Tinuvin 234 en las botellas PET en las concentraciones de 0,12 % y 0,22 % no fue eficiente en retardar el deterioro del aceite expuesto a la luz fluorescente, cuando se compara con aceite de soja envasado en PET sin adición de Tinuvin 234.

  6. In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation.

    Science.gov (United States)

    Albers-Wolthers, C H J; de Gier, J; Walen, M; van Kooten, P J S; Lambalk, C B; Leegwater, P A J; Roelen, B A J; Schaefers-Okkens, A C; Rutten, V P M G; Millar, R P M; Kooistra, H S

    2017-01-01

    Kisspeptins (KPs) and their receptor (GPR54 or KiSS1R) play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.

  7. In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation.

    Directory of Open Access Journals (Sweden)

    C H J Albers-Wolthers

    Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.

  8. Uranium ((234)U, (235)U and (238)U) contamination of the environment surrounding phosphogypsum waste heap in Wiślinka (northern Poland).

    Science.gov (United States)

    Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan

    2015-08-01

    The aim of this work was to determine the uranium concentration ((234)U, (235)U and (238)U) and values of the activity ratio (234)U/(238)U in soil samples collected near phosphogypsum waste heap in Wiślinka (northern Poland). On the basis of the studies it was found that the values of the (234)U/(238)U activity ratio in the analyzed soils collected in the vicinity of phosphogypsum dump in Wiślinka are in most cases close to one and indicate the phosphogypsum origin of the analyzed nuclides. The obtained results of uranium concentrations are however much lower than in previous years before closing of the phosphogypsum stockpile. After this process and covering the phosphogypsum stockpile in Wiślinka with sewage sludge, phosphogypsum particles are successfully immobilized. In the light of the results the use of phosphate fertilizers seems to be a major problem. Prolonged and heavy rains can cause leaching accumulated uranium isotopes in the phosphogypsum stockpile, which will be washed into the Martwa Wisła and on the fields in the immediate vicinity of this storage. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN234 in the South Pacific Ocean from 2009-05-05 to 2009-05-13 (NODC Accession 0104351)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104351 includes physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN234 in the South Pacific Ocean from 2009-05-05 to...

  10. Bioaccumulation of polonium ({sup 210}Po) and uranium ({sup 234}U, {sup 238}U) in plants around phosphogypsum waste heap in Wislinka (northern Poland)

    Energy Technology Data Exchange (ETDEWEB)

    Borylo, A.; Skwarzec, B. [Gdansk Univ. (Poland). Faculty of Chemistry

    2011-07-01

    In the study the activities of polonium {sup 210}Po and uranium {sup 234}U, {sup 238}U in plants, collected near phosphogypsum waste heap in Wis'linka (northern Poland), were determined by using the alpha spectrometry. The obtained results revealed that the concentrations of {sup 210}Po, {sup 234}U, and {sup 238}U in the analyzed plants were differentiated. In the analyzed flora organisms the highest amounts of polonium and uranium were found in ruderal plant samples as well as willow samples (Salix viminalis) from protection zone of phosphogypsum waste heap. The concentrations of {sup 210}Po, {sup 234}U and {sup 238}U in the analyzed plants were higher in roots than in green parts of plants. The higher concentrations of {sup 210}Po and {sup 238}U radionuclides were estimated for hydrophyte (common sedge Carex nigra Reichard), the favourite habitat of which is particularly wet meadow and for plants collected in the vicinity of phosphogypsum waste heap. The major source of polonium and uranium in analyzed plants is root system. The values of {sup 234}U/ {sup 238}U activity ratio in all analyzed plants are closed to one, what indicated that source of uranium in analyzed plants is phosphogypsum. The highest uranium and polonium concentrations were characterized for plants, which are covered with tomentose. The comparability polonium and uranium contents were confirmed in edible plants, but higher accumulation was determined in ripe species than immature species of vegetables. The higher polonium and uranium concentrations were noticed in green parts of plant, the lower in roots. Polonium concentration in cultivated plants samples was not species diverse. Therefore, the significant source of polonium and uranium in analyzed plants is wet and dry atmospheric falls gathering the soil and air dust from phosphogypsum waste dump. The maximum {sup 210}Po and {sup 238}U radionuclides concentrations were found in green parts of red beet (Beta vulgaris esculenta), the

  11. (Acetylacetonato-κ2O,O′bis{5-fluoro-2-[3-(4-fluorophenylpyrazin-2-yl]phenyl-κ2N1,C1}iridium(III

    Directory of Open Access Journals (Sweden)

    Guo-Ping Ge

    2012-08-01

    Full Text Available In the title complex, [Ir(C16H9F2N22(C5H7O2], the IrIII atom, lying on a twofold rotation axis, is hexacoordinated in a distorted octahedral geometry by two C,N-bidentate 5-fluoro-2-[3-(4-fluorophenylpyrazin-2-yl]phenyl ligands and one O,O′-bidentate acetylacetonate ligand. The dihedral angles between the benzene rings and the pyrazine ring are 14.66 (8 and 49.76 (12°.

  12. Accurate measurements of fission-fragment yields in 234,235,236,238U(γ,f with the SOFIA set-up

    Directory of Open Access Journals (Sweden)

    Chatillon A.

    2016-01-01

    Full Text Available SOFIA (Studies On Fission with Aladin is a new experimental set-up dedicated to accurate measurement of fission-fragments isotopic yields. It is located at GSI, the only place to use inverse kinematics at relativistic energies in order to study the (γ,f electromagnetic-induced fission. The SOFIA set-up is a large-acceptance magnetic spectrometer, which allows to fully identify both fission fragments in coincidence on the whole fission-fragment range. This paper will report on fission yields obtained in 234,235,236,238U(γ,f reactions.

  13. Accurate measurements of fission-fragment yields in 234,235,236,238U(γ,f) with the SOFIA set-up

    Science.gov (United States)

    Chatillon, A.; Taïeb, J.; Martin, J.-F.; Pellereau, E.; Boutoux, G.; Gorbinet, T.; Grente, L.; Bélier, G.; Laurent, B.; Alvarez-Pol, H.; Ayyad, Y.; Benlliure, J.; Caamaño, M.; Audouin, L.; Casarejos, E.; Cortina-Gil, D.; Farget, F.; Fernández-Domínguez, B.; Heinz, A.; Jurado, B.; Kelić-Heil, A.; Kurz, N.; Lindberg, S.; Löher, B.; Nociforo, C.; Paradela, C.; Pietri, S.; Ramos, D.; Rodriguez-Sanchez, J.-L.; Rodrìguez-Tajes, C.; Rossi, D.; Schmidt, K.-H.; Simon, H.; Tassan-Got, L.; Törnqvist, H.; Vargas, J.; Voss, B.; Weick, H.; Yan, Y.

    2016-03-01

    SOFIA (Studies On Fission with Aladin) is a new experimental set-up dedicated to accurate measurement of fission-fragments isotopic yields. It is located at GSI, the only place to use inverse kinematics at relativistic energies in order to study the (γ,f) electromagnetic-induced fission. The SOFIA set-up is a large-acceptance magnetic spectrometer, which allows to fully identify both fission fragments in coincidence on the whole fission-fragment range. This paper will report on fission yields obtained in 234,235,236,238U(γ,f) reactions.

  14. Installation Restoration Program. Preliminary Assessment: 216th Engineering Installation Squadron and 234th Combat Communications Squadron, Hayward Air National Guard Station, California Air National Guard, Hayward, California

    Science.gov (United States)

    1991-01-01

    foot to O𔃿 oill’y clsay r Ich, in orgsenc mstrsly wilth sait aste r. Yiel d: a I Ilsy _.j s .ssh as 120 -st.,Wt. hon- lense , of s it ane quantity im...Report 205J. Figure 111.3 U Generalized Stratigraphic Column of the Area I 111-5 ’UD Of CONTCT -00fA~m~eIYloctedCORRELATION OF MAP UNITS HAYWARD FAULT...separators. Two of these are connected to the storm sewer. The oil/water separator for the 234th EIS is connected to the sanitary sewer. o A monitoring well

  15. Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.

    Science.gov (United States)

    Zhu, Xiaoyu; Chen, Junyi; Xie, Zuokun; Gao, Jiong; Ren, Guodong; Gao, Shan; Zhou, Xin; Kuai, Benke

    2015-11-01

    Degreening caused by rapid chlorophyll (Chl) degradation is a characteristic event during green organ senescence or maturation. Pheophorbide a oxygenase gene (PAO) encodes a key enzyme of Chl degradation, yet its transcriptional regulation remains largely unknown. Using yeast one-hybrid screening, coupled with in vitro and in vivo assays, we revealed that Arabidopsis MYC2/3/4 basic helix-loop-helix proteins directly bind to PAO promoter. Overexpression of the MYCs significantly enhanced the transcriptional activity of PAO promoter in Arabidopsis protoplasts, and methyl jasmonate (MeJA) treatment greatly induced PAO expression in wild-type Arabidopsis plants, but the induction was abolished in myc2 myc3 myc4. In addition, MYC2/3/4 proteins could promote the expression of another Chl catabolic enzyme gene, NYC1, as well as a key regulatory gene of Chl degradation, NYE1/SGR1, by directly binding to their promoters. More importantly, the myc2 myc3 myc4 triple mutant showed a severe stay-green phenotype, whereas the lines overexpressing the MYCs showed accelerated leaf yellowing upon MeJA treatment. These results suggest that MYC2/3/4 proteins may mediate jasmonic acid (JA)-induced Chl degradation by directly activating these Chl catabolic genes (CCGs). Three NAC family proteins, ANAC019/055/072, downstream from MYC2/3/4 proteins, could also directly promote the expression of a similar set of CCGs (NYE1/SGR1, NYE2/SGR2 and NYC1) during Chl degradation. In particular, anac019 anac055 anac072 triple mutant displayed a severe stay-green phenotype after MeJA treatment. Finally, we revealed that MYC2 and ANAC019 may interact with each other and synergistically enhance NYE1 expression. Together, our study reveals a hierarchical and coordinated regulatory network of JA-induced Chl degradation. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

  16. High-resolution transcriptomic analyses of Sinorhizobium sp. NGR234 bacteroids in determinate nodules of Vigna unguiculata and indeterminate nodules of Leucaena leucocephala.

    Directory of Open Access Journals (Sweden)

    Yan Li

    Full Text Available The rhizobium-legume symbiosis is a model system for studying mutualistic interactions between bacteria and eukaryotes. Sinorhizobium sp. NGR234 is distinguished by its ability to form either indeterminate nodules or determinate nodules with diverse legumes. Here, we presented a high-resolution RNA-seq transcriptomic analysis of NGR234 bacteroids in indeterminate nodules of Leucaena leucocephala and determinate nodules of Vigna unguiculata. In contrast to exponentially growing free-living bacteria, non-growing bacteroids from both legumes recruited several common cellular functions such as cbb3 oxidase, thiamine biosynthesis, nitrate reduction pathway (NO-producing, succinate metabolism, PHB (poly-3-hydroxybutyrate biosynthesis and phosphate/phosphonate transporters. However, different transcription profiles between bacteroids from two legumes were also uncovered for genes involved in the biosynthesis of exopolysaccharides, lipopolysaccharides, T3SS (type three secretion system and effector proteins, cytochrome bd ubiquinol oxidase, PQQ (pyrroloquinoline quinone, cytochrome c550, pseudoazurin, biotin, phasins and glycolate oxidase, and in the metabolism of glutamate and phenylalanine. Noteworthy were the distinct expression patterns of genes encoding phasins, which are thought to be involved in regulating the surface/volume ratio of PHB granules. These patterns are in good agreement with the observed granule size difference between bacteroids from L. leucocephala and V. unguiculata.

  17. Potential human health risk by 234,238U and 210Po due to consumption of fish from the "Luis L. Leon" reservoir (Northern Mexico)

    Science.gov (United States)

    Luna-Porres, M. Y.; Rodríguez-Villa, M. A.; Herrera-Peraza, E.; Cabral-Lares, M.; Renteria-Villalobos, M.; Montero-Cabrera, M. E.

    2014-07-01

    The Conchos River is one of the most important in northern Mexico and the main surface waterway in the arid state of Chihuahua. The Luis L. Leon dam produces the Luis L. Leon Reservoir, which is the last major reservoir before the Conchos River enters the Rio Grande at the Texas-Chihuahua border. Activity concentrations (AC) of 234,238U and 210Po in fillet and liver of three stocked fish species (Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus), as well as in water from the Luis L. Leon reservoir were determined. 238U and 234U ACs in fillet samples showed values of 0.007-0.014 and 0.01-0.02 Bq kg-1 wet weight (ww), respectively. Liver samples for Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus species, present 210Po AC of 1.16-3.26 0.70-1.13 and 0.93-1.37 Bqṡkg-1 ww. The elemental Bioaccumulation Factor (BAF) for fish tissues respect to their concentrations in water was determined. Lepomis cyanellus species showed the highest BAF for total uranium in fillet, with value 1.5. The annual effective dose for uranium in adults by fish consumption in this work ranged from 4.46×10-3 to 3.68×10-2 μSvṡyear-1. The difference in concentrations of uranium in fillet among the studied species is likely primarily due to their differences in diet and habitat.

  18. Regioselective synthesis of 2,3,4- or 2,3,5-trisubstituted pyrroles via [3,3] or [1,3] rearrangements of O-vinyl oximes.

    Science.gov (United States)

    Wang, Heng-Yen; Mueller, Daniel S; Sachwani, Rachna M; Kapadia, Rachel; Londino, Hannah N; Anderson, Laura L

    2011-05-06

    The regioselective synthesis of 2,3,4- or 2,3,5-trisubstituted pyrroles has been achieved via [3,3] and [1,3] sigmatropic rearrangements of O-vinyl oximes, respectively. Iridium-catalyzed isomerization of easily prepared O-allyl oximes enables rapid access to O-vinyl oximes. The regioselectivity of pyrrole formation can be controlled by either the identity of the α-substituent or through the addition of an amine base. When enolization is favored, a [3,3] rearrangement followed by a Paal-Knorr cyclization provides a 2,3,4-trisubstituted pyrrole; when enolization is disfavored, a [1,3] rearrangement occurs prior to enolization to produce a 2,3,5-trisubstituted pyrrole after cyclization. Optimization and scope of the O-allyl oxime isomerization and subsequent pyrrole formation are discussed and mechanistic pathways are proposed. Conditions are provided for selecting either the [3,3] rearrangement or the [1,3] rearrangement product with β-ester O-allyl oxime substrates. © 2011 American Chemical Society

  19. Reliability of using 238U/235U and 234U/238U ratios from alpha spectrometry as qualitative indicators of enriched uranium contamination.

    Science.gov (United States)

    Minteer, Mark; Winkler, Paul; Wyatt, Bill; Moreland, Scott; Johnson, Jamie; Winters, Tim

    2007-05-01

    Alpha spectrometry is a commonly used technique for the measurement of uranium isotopes in environmental samples because it is widely available at a relatively low cost. For natural uranium the (234)U to (238)U activity ratio should be 1 and the (238)U to (235)U activity ratio should be 21.7. However, a lower (238)U to (235)U ratio is usually observed in alpha spectrometric analysis of environmental soil samples. This observation has led to the conclusion that soils from nuclear weapons facilities were contaminated with highly enriched uranium. This study was undertaken to test the reliability of using activity ratios from alpha spectrometry to infer the presence of highly enriched uranium in soil samples. The results of these experiments indicate that the (238)U to (235)U activity ratio is not a reliable indicator, but that the (234)U to (238)U activity ratio can be used to qualitatively indicate the presence of highly enriched uranium at concentrations near 10 ng g(-1) and above.

  20. 234U/238U Disequilibrium along stylolitic discontinuities in deep Mesozoic limestone formations of the Eastern Paris basin: evidence for discrete uranium mobility over the last 1–2 million years

    Directory of Open Access Journals (Sweden)

    P. Deschamps

    2004-01-01

    Full Text Available The (234U/238 equilibrium state of borehole core samples from the deep, low-permeability limestone formations surrounding the target argilite layer of the Meuse/Haute-Marne experimental site of the French agency for nuclear waste management -ANDRA- (Agence nationale pour la gestion des déchets radioactifs was examined to improve understanding of naturally occurring radionuclide behaviour in such geological settings. Highly precise, accurate MC-ICP-MS measurements of the (234U/238U activity ratio show that limestone samples characterised by pressure dissolution structures (stylolites or dissolution seams display systematic (234U/238U disequilibria, while the pristine carbonate samples remain in the secular equilibrium state. The systematic feature is observed throughout the zones marked by pressure dissolution structures: (i the material within the seams shows a deficit of 234U over 238U ((234U/238U down to 0.80 and (ii the surrounding carbonate matrix is characterised by an activity ratio greater than unity (up to 1.05. These results highlight a centimetric-scale uranium remobilisation in the limestone formations along these sub-horizontal seams. Although their nature and modalities are not fully understood, the driving processes responsible for these disequilibria were active during the last 1–2 Ma. Keywords: uranium isotopes, multiple-collector ICP-MS, waste management, remobilisation, migration

  1. A new measurement of the gamma-ray intensities of sup 234m Pa accompanying the decay of sup 238 U

    Energy Technology Data Exchange (ETDEWEB)

    Siemon, K.; Esterlund, R.A.; Aarle, J. van; Knaack, M.; Patzelt, P. (Marburg Univ. (Germany). Inst. fuer Kernchemie); Westmeier, W. (Gesellschaft fuer Kernspektrometrie mbH, Ebsdorfergrund-Moelln (Germany))

    1992-07-01

    Gamma-ray lines following the decay of {sup 234m}Pa were assayed via high-purity germanium-crystal (HPGe) spectrometry of analytical-grade foils of depleted uranium metal. Absolute intensities were determined for the strongest lines (I{sub {gamma}} {>=} 0.002%), with special emphasis on the 1001 keV line, which is often used for either assay or normalization purposes. The I{sub {gamma}} value derived for this latter line was independently confirmed in two further measurements, in which its intensity relative to the 185.7 keV gamma line which accompanies the decay of {sup 235}U was compared. Our new value for the absolute intensity of this line I{sub {gamma}} (1001 keV) is (0.845 {+-} 0.021)%, which is over 1.4 times greater than the currently-accepted value. (author).

  2. Ground water contamination with (238)U, (234)U, (235)U, (226)Ra and (210)Pb from past uranium mining: cove wash, Arizona.

    Science.gov (United States)

    Dias da Cunha, Kenya Moore; Henderson, Helenes; Thomson, Bruce M; Hecht, Adam A

    2014-06-01

    The objectives of the study are to present a critical review of the (238)U, (234)U, (235)U, (226)Ra and (210)Pb levels in water samples from the EPA studies (U.S. EPA in Abandoned uranium mines and the Navajo Nation: Red Valley chapter screening assessment report. Region 9 Superfund Program, San Francisco, 2004, Abandoned uranium mines and the Navajo Nation: Northern aum region screening assessment report. Region 9 Superfund Program, San Francisco, 2006, Health and environmental impacts of uranium contamination, 5-year plan. Region 9 Superfund Program, San Franciso, 2008) and the dose assessment for the population due to ingestion of water containing (238)U and (234)U. The water quality data were taken from Sect. "Data analysis" of the published report, titled Abandoned Uranium Mines Project Arizona, New Mexico, Utah-Navajo Lands 1994-2000, Project Atlas. Total uranium concentration was above the maximum concentration level for drinking water (7.410-1 Bq/L) in 19 % of the water samples, while (238)U and (234)U concentrations were above in 14 and 17 % of the water samples, respectively. (226)Ra and (210)Pb concentrations in water samples were in the range of 3.7 × 10(-1) to 5.55 × 102 Bq/L and 1.11 to 4.33 × 102 Bq/L, respectively. For only two samples, the (226)Ra concentrations exceeded the MCL for total Ra for drinking water (0.185 Bq/L). However, the (210)Pb/(226)Ra ratios varied from 0.11 to 47.00, and ratios above 1.00 were observed in 71 % of the samples. Secular equilibrium of the natural uranium series was not observed in the data record for most of the water samples. Moreover, the (235)U/(total)U mass ratios ranged from 0.06 to 5.9 %, and the natural mass ratio of (235)U to (total)U (0.72 %) was observed in only 16 % of the water samples, ratios above or below the natural ratio could not be explained based on data reported by U.S. EPA. In addition, statistical evaluations showed no correlations among the distribution of the radionuclide concentrations

  3. Boiled coffee consumption and the risk of prostate cancer: follow-up of 224,234 Norwegian men 20-69 years.

    Science.gov (United States)

    Tverdal, A

    2015-02-03

    There is insufficient epidemiological evidence on the relationship between type of coffee and the risk of prostate cancer. The risk of prostate cancer by use of boiled vs not boiled coffee were assessed in a prospective study of 224,234 men 20-69 years. 5740 incident prostate cancers were identified. With no coffee as reference group the hazard ratios of coffee only were 0.84 (0.73-0.96), 0.80 (0.70-0.92) and 0.66 (0.55-0.80), P-trend=0.00. The corresponding figures for not boiled coffee were 0.89 (0.80-0.99), 0.91 (0.81-1.02) and 0.86 (0.74-1.00), P-trend=0.22. An inverse relationship between number of cups per day and the risk of prostate cancer was present only for the boiled coffee type.

  4. Synthesis and Spectroscopic Studies of some Divalent Metall Ion Complexes of 3-(4-hydroxyphenyl-2-(3-(4-nitrobenzoyl thioureido propanoic acid

    Directory of Open Access Journals (Sweden)

    Basima M. Sarhan

    2017-09-01

    Full Text Available 3-(4-hydroxyphenyl-2-(3-(4-nitrobenzoyl thioureido propanoic acid (HNP a new ligand was synthesized by reaction of Tyrosine with (4-Nitrobenzoyl isothiocyanate by using acetone as a solvent. The prepared ligand (HNP has been characterized by elemental analysis (CHNS, infrared (FT-IR, electronic spectral (Ultraviolet visible and(1H,13C-Nuclear Magnetic Resonance spectra. Some Divalent metal ion complexes of (HNP were prepared and spectroscopic studies by Fourier transform infrared (FTIR, electronic spectral(UV-Vis, molar conductance, magnetic susceptibility and atomic absorption. The results measured showed the formula of six prepared complexes were [M (HNP2] (M+2 = Manganese, Cobalt, Nickel, Znic, Cadmium and Mercury,from the obtained data tetrahedral structure suggested for all complexes, except Copper complex has a square planer geometry

  5. Marked disequilibrium between {sup 234}Th and {sup 230}Th of the {sup 238}U natural radioactive decay chain in IAEA reference materials n. 312, 313 and 314

    Energy Technology Data Exchange (ETDEWEB)

    Colaianni, A. [Dipartimento di Geologia e Geofisica dell' Universita di Bari, Via Orabona, 4 - 70125 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); D' Erasmo, G. [Dipartimento Interateneo di Fisica dell' Universita di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); Pantaleo, A., E-mail: pantaleo@ba.infn.i [I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); Schiavulli, L. [Dipartimento Interateneo di Fisica dell' Universita di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy)

    2011-02-15

    A new laboratory for the spectroscopy of natural radioactivity with a good energy resolution is presented. It consists of two distinct parts equipped, respectively, the first one with a HpGe {gamma}-ray detector, whose setup has been already completed, and the second one with large area Silicon {alpha}-ray detectors and a radiochemical section for thin {alpha}-samples preparation, whose setup is yet in progress and will be the argument of a separate work. The {gamma}-ray spectrometer was calibrated by means of IAEA Reference Materials n. 312, 313, 314 and 375. A large difference from the predictions of secular equilibrium emerged between the activities of {sup 234}Th and {sup 230}Th in Materials n. 312, 313 and 314.

  6. A very young, compact bipolar H2O maser outflow in the intermediate-mass star-forming LkHα 234 region

    Science.gov (United States)

    Torrelles, J. M.; Curiel, S.; Estalella, R.; Anglada, G.; Gómez, J. F.; Cantó, J.; Patel, N. A.; Trinidad, M. A.; Girart, J. M.; Carrasco-González, C.; Rodríguez, L. F.

    2014-07-01

    We report multi-epoch Very Long Baseline Interferometry (VLBI) H2O maser observations towards the compact cluster of young stellar objects (YSOs) close to the Herbig Be star LkHα 234. This cluster includes LkHα 234 and at least nine more YSOs that are formed within projected distances of ˜10 arcsec (˜9000 au). We detect H2O maser emission towards four of these YSOs. In particular, our VLBI observations (including proper motion measurements) reveal a remarkable very compact (˜0.2 arcsec = ˜180 au), bipolar H2O maser outflow emerging from the embedded YSO Very Large Array (VLA) 2. We estimate a kinematic age of ˜40 yr for this bipolar outflow, with expanding velocities of ˜20 km s-1 and momentum rate Ṁw Vw ≃ 10-4-10-3 M⊙ yr-1 km s-1 × (Ω/4π), powered by a YSO of a few solar masses. We propose that the outflow is produced by recurrent episodic jet ejections associated with the formation of this YSO. Short-lived episodic ejection events have previously been found towards high-mass YSOs. We show now that this behaviour is also present in intermediate-mass YSOs. These short-lived episodic ejections are probably related to episodic increases in the accretion rate, as observed in low-mass YSOs. We predict the presence of an accretion disc associated with VLA 2. If detected, this would represent one of the few known examples of intermediate-mass stars with a disc-YSO-jet system at scales of a few hundred astronomical units.

  7. Influenza A H5N1 clade 2.3.4 virus with a different antiviral susceptibility profile replaced clade 1 virus in humans in northern Vietnam.

    Directory of Open Access Journals (Sweden)

    Mai T Q Le

    2008-10-01

    Full Text Available Prior to 2007, highly pathogenic avian influenza (HPAI H5N1 viruses isolated from poultry and humans in Vietnam were consistently reported to be clade 1 viruses, susceptible to oseltamivir but resistant to amantadine. Here we describe the re-emergence of human HPAI H5N1 virus infections in Vietnam in 2007 and the characteristics of the isolated viruses.Respiratory specimens from patients suspected to be infected with avian influenza in 2007 were screened by influenza and H5 subtype specific polymerase chain reaction. Isolated H5N1 strains were further characterized by genome sequencing and drug susceptibility testing. Eleven poultry outbreak isolates from 2007 were included in the sequence analysis. Eight patients, all of them from northern Vietnam, were diagnosed with H5N1 in 2007 and five of them died. Phylogenetic analysis of H5N1 viruses isolated from humans and poultry in 2007 showed that clade 2.3.4 H5N1 viruses replaced clade 1 viruses in northern Vietnam. Four human H5N1 strains had eight-fold reduced in-vitro susceptibility to oseltamivir as compared to clade 1 viruses. In two poultry isolates the I117V mutation was found in the neuraminidase gene, which is associated with reduced susceptibility to oseltamivir. No mutations in the M2 gene conferring amantadine resistance were found.In 2007, H5N1 clade 2.3.4 viruses replaced clade 1 viruses in northern Vietnam and were susceptible to amantadine but showed reduced susceptibility to oseltamivir. Combination antiviral therapy with oseltamivir and amantadine for human cases in Vietnam is recommended.

  8. Functional analysis of NopM, a novel E3 ubiquitin ligase (NEL domain effector of Rhizobium sp. strain NGR234.

    Directory of Open Access Journals (Sweden)

    Da-Wei Xin

    Full Text Available Type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS are not only virulence factors of pathogenic bacteria, but also influence symbiotic interactions between nitrogen-fixing nodule bacteria (rhizobia and leguminous host plants. In this study, we characterized NopM (nodulation outer protein M of Rhizobium sp. strain NGR234, which shows sequence similarities with novel E3 ubiquitin ligase (NEL domain effectors from the human pathogens Shigella flexneri and Salomonella enterica. NopM expressed in Escherichia coli, but not the non-functional mutant protein NopM-C338A, showed E3 ubiquitin ligase activity in vitro. In vivo, NopM, but not inactive NopM-C338A, promoted nodulation of the host plant Lablab purpureus by NGR234. When NopM was expressed in yeast, it inhibited mating pheromone signaling, a mitogen-activated protein (MAP kinase pathway. When expressed in the plant Nicotiana benthamiana, NopM inhibited one part of the plant's defense response, as shown by a reduced production of reactive oxygen species (ROS in response to the flagellin peptide flg22, whereas it stimulated another part, namely the induction of defense genes. In summary, our data indicate the potential for NopM as a functional NEL domain E3 ubiquitin ligase. Our findings that NopM dampened the flg22-induced ROS burst in N. benthamiana but promoted defense gene induction are consistent with the concept that pattern-triggered immunity is split in two separate signaling branches, one leading to ROS production and the other to defense gene induction.

  9. Determination of the isotopic ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U in uranium commercial reagents by alpha spectroscopy; Determinacion de la relacion isotopica {sup 234} U/{sup 238} U y {sup 235} U/{sup 238} U en reactivos comerciales de uranio por espectrometria alfa

    Energy Technology Data Exchange (ETDEWEB)

    Iturbe G, J.L

    1990-02-15

    In this work the determination of the isotope ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO{sub 2} (*) nuclear purity, UO{sub 3} (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one {sup 234} U/{sup 238} U, since the obtained value went near to the unit. In the case of the isotope ratio {sup 235} U/{sup 238} U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of {sup 235} U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the {sup 234} U/{sup 238} U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities {sup 235} U/{sup 238} U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the {sup 236} U as impurity. The isotope of {sup 236} U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)

  10. Tetrakis[μ-2-(3,4-dimethoxyphenylacetato]-κ4O:O′;κ3O,O′:O;κ3O:O,O′-bis{[2-(3,4-dimethoxyphenylacetato-κ2O,O′](1,10-phenanthroline-κ2N,N′samarium(III}

    Directory of Open Access Journals (Sweden)

    Jia-Lu Liu

    2010-11-01

    Full Text Available In the centrosymmetric dinuclear title complex, [Sm2(C10H11O46(C12H8N22], the SmIII ion is nine-coordinated by seven O atoms of five 2-(3,4-dimethoxyphenylacetate (DMPA ligands and two N atoms of one bis-chelating 1,10-phenanthroline (phen ligand, forming a distorted tricapped trigonal-prismatic environment. The DMPA ligands coordinate in bis-chelate, bridging and bridging tridentate modes. An intramolecular C—H...O hydrogen bond occurs. Intermolecular C—H...O interactions are also present in the crystal.

  11. Measurement of the neutron capture cross section of U{sup 234} in n-TOF at CERN for Generation IV nuclear reactors; Mesure de la section efficace de capture neutronique de l'{sup 234}U a n-TOF au CERN pour les reacteurs nucleaires de generation 4

    Energy Technology Data Exchange (ETDEWEB)

    Dridi, W

    2006-11-15

    Accurate and reliable neutron capture cross sections are needed in many research areas, including stellar nucleosynthesis, advanced nuclear fuel cycles, waste transmutation, and other applied programs. In particular, the accurate knowledge of U{sup 234}(n,{gamma}) reaction cross section is required for the design and realization of nuclear power plants based on the thorium fuel cycle. We have measured the neutron capture cross section of U{sup 234}, with a 4{pi} BaF{sub 2} Total Absorption Calorimeter, at the recently constructed neutron time-of-flight facility n-TOF at CERN in the energy range from 0.03 eV to 1 MeV. Monte-Carlo simulations with GEANT4 and MCNPX of the detector response have been performed. After the background subtraction and correction with dead time and pile-up, the capture yield from 0.03 eV up to 1.5 keV was derived. The analysis of the capture yield in terms of R-matrix resonance parameters is discussed. We have identified 123 resonances and measured the resonance parameters in the energy range from 0.03 eV to 1.5 keV. The mean radiative width <{gamma}{sub {gamma}}> is found to be (38.2 {+-} 1.5) meV and the mean spacing parameter is (11.0 {+-} 0.2) eV, both values agree well with recommended values.

  12. Origin and geochemical behavior of uranium in marine sediments. Utilization of the {sup 234}U/{sup 238}U ratio in marine geochemistry; Origine et comportement geochimique de l`uranium dans les sediments marins. Utilisation du rapport ({sup 234}U/{sup 238}U) en geochimie marine

    Energy Technology Data Exchange (ETDEWEB)

    Organo, Catherine [Paris-11 Univ., 91 - Orsay (France)

    1997-01-20

    The first part of this thesis presents the current situation of knowledge of uranium in marine environment. The second part describes the methods of analysis as well as the material support of the study, i.e., the sediments and marine deposits investigated. The third part is dedicated to the study of uranium mobility in marine sediments characterized by detrital terrigenous composition (pelagic clays). This approach allowed quantifying the entering and leaving flux of uranium after the sediment settling and, to discuss, on this basis, the consequences on the uranium oceanic balance. In the third part the origin and behavior of uranium in zones of high surface productivity is studied. The uranium enrichments observed in the hemi-pelagic sediments of the EUMELI (J.G.O.F.S.-France) programme will constitute a material of study adequate for measuring the variations in the {sup 234}U/2{sup 38U} ratio in solid phase, in response to the oxido-reducing characteristics of the sediment. Thus establishing the origin of the trapped uranium has been possible. Also, the nature of the sedimentary phases related to uranium in bio-genetic sediments in the Austral Ocean was determined. Thus a relationship between the variations in the {sup 234}U/{sup 238} and the diagenetic transformations was possible to establish. Finally in the fifth part a study of the behavior of uranium in a polymetallic shell characteristic for deposits of hydrogenized origin 146 refs., 57 figs., 23 tabs.

  13. Spectroscopy of actinium-215 and (p,t) studies of the stable palladium isotopes

    Science.gov (United States)

    Winkler, Ryan

    2009-12-01

    The study of both the microscopic and macroscopic structural evolution of the atomic nucleus is presented in this work. The excited states of the N = 126 isotone 215Ac were investigated at WNSL using the gas-filled recoil separator SASSYER. Recoil-decay tagging of the gamma rays corresponding to the decay of 215Ac after production via a fusion-evaporation reaction was made possible by using the redesigned SASSYER focal plane apparatus, including the addition of a pair of DSSDs and the multi-wire avalanche counter MACY. A number of transitions feeding the 29/2+ isomeric state corresponding to the ( ph49/2 )⊗(pii13/2) configuration were observed and tentatively assigned as decays from the high-spin 35/2 +, 39/2+, and 41/2+ states. Additionally, the decay from the low-lying 13/2+ state, corresponding to a pii13/2 quasiparticle excitation, was observed at 859 keV. This excitation energy is consistent with the systematics of the lighter N = 126 isotones suggesting a decrease in the energy gap between the pih9/2 and pi i13/2 orbitals. High-resolution (p,t) spectroscopy of the stable, even-even Palladium isotopes was performed in the search for signatures of quantum phase transitional behavior. A total of 54 previously unidentified 0+, 2 +, and 4+ states below an excitation energy of 3.5 MeV were discovered in this experiment. No enhancement of the 0+ level density, a signature of first-order phase transitions in nuclei, was observed in the studied isotopes. A theoretical description of the population strengths of excited 0+ states in two-nucleon transfer reactions was investigated within the framework of the IBM. These studies reveal that an enhanced population strength is not exclusive to regions of shape-coexistence but rather is a measure of the magnitude of the "change of structure" from the initial to residual nucleus.

  14. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. Simultaneous Separation of Actinium and Radium Isotopes from a Proton Irradiated Thorium Matrix.

    Science.gov (United States)

    Mastren, Tara; Radchenko, Valery; Owens, Allison; Copping, Roy; Boll, Rose; Griswold, Justin R; Mirzadeh, Saed; Wyant, Lance E; Brugh, Mark; Engle, Jonathan W; Nortier, Francois M; Birnbaum, Eva R; John, Kevin D; Fassbender, Michael E

    2017-08-15

    A new method has been developed for the isolation of (223,224,225)Ra, in high yield and purity, from a proton irradiated (232)Th matrix. Herein we report an all-aqueous process using multiple solid-supported adsorption steps including a citrate chelation method developed to remove >99.9% of the barium contaminants by activity from the final radium product. A procedure involving the use of three columns in succession was developed, and the separation of (223,224,225)Ra from the thorium matrix was obtained with an overall recovery yield of 91 ± 3%, average radiochemical purity of 99.9%, and production yields that correspond to physical yields based on previously measured excitation functions.

  16. The release of dissolved actinium to the ocean: A global comparison of different end-members

    Science.gov (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.

    2008-01-01

    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry]. Another potential mechanism of producing deviations in 227Ac/228Ra and daughter isotope ratios from the expected production value of lithogenic material is observed at reducing environments, where enrichment in uranium may occur. The presented data here may serve as a reference for including 227Ac in circulation models, and the overview provides values for some end-members that contribute to the global Ac distribution. ?? 2007 Elsevier B.V. All rights reserved.

  17. Molecular level characterization of diatom-associated biopolymers that bind 234Th, 233Pa, 210Pb, and 7Be in seawater: A case study with Phaeodactylum tricornutum

    Science.gov (United States)

    Chuang, Chia-Ying; Santschi, Peter H.; Xu, Chen; Jiang, Yuelu; Ho, Yi-Fang; Quigg, Antonietta; Guo, Laodong; Hatcher, Patrick G.; Ayranov, Marin; Schumann, Dorothea

    2015-09-01

    In order to investigate the importance of biogenic silica associated biopolymers on the scavenging of radionuclides, the diatom Phaeodactylum tricornutum was incubated together with the radionuclides 234Th, 233Pa, 210Pb, and 7Be during their growth phase. Normalized affinity coefficients were determined for the radionuclides bound with different organic compound classes (i.e., proteins, total carbohydrates, uronic acids) in extracellular (nonattached and attached exopolymeric substances), intracellular (ethylene diamine tetraacetic acid and sodium dodecyl sulfate extractable), and frustule embedded biopolymeric fractions (BF). Results indicated that radionuclides were mostly concentrated in frustule BF. Among three measured organic components, Uronic acids showed the strongest affinities to all tested radionuclides. Confirmed by spectrophotometry and two-dimensional heteronuclear single quantum coherence-nuclear magnetic resonance analyses, the frustule BF were mainly composed of carboxyl-rich, aliphatic-phosphoproteins, which were likely responsible for the strong binding of many of the radionuclides. Results from this study provide evidence for selective absorption of radionuclides with different kinds of diatom-associated biopolymers acting in concert rather than as a single compound. This clearly indicates the importance of these diatom-related biopolymers, especially frustule biopolymers, in the scavenging and fractionation of radionuclides used as particle tracers in the ocean.

  18. A novel fluorinated thiosemicarbazone derivative- 2-(3,4-difluorobenzylidene) hydrazinecarbothioamide induces apoptosis in human A549 lung cancer cells via ROS-mediated mitochondria-dependent pathway.

    Science.gov (United States)

    Zhao, Yue; Guo, Chuanlong; Wang, Lijun; Wang, Shuaiyu; Li, Xiangqian; Jiang, Bo; Wu, Ning; Guo, Shuju; Zhang, Renshuai; Liu, Kun; Shi, Dayong

    2017-09-09

    Thiosemicarbazone, a class of compounds with excellent biological activity, especially antitumor activity, have attracted wide attention. In this study, a novel fluorinated thiosemicarbazone derivative, 2-(3,4-difluorobenzylidene) hydrazinecarbothioamide (compound 1) was synthesized and its antitumor activities were further investigated on a non-small cell lung cancer cell line (A549) along with its underlying mechanisms. Compound 1 showed significant anti-proliferative activity on A549 cells, which was further proved by colony formation experiment. Compound 1 also inhibits the invasion of A549 cells in a trans-well culture system. Moreover, compound 1 markedly induced apoptosis on A549 cells, and the ratio of Bcl-2/Bax was decreased while the amount of p53, Cleaved-Caspase 3 and Cleaved-PARP expression were increased significantly. Compound 1 decreased the mitochondrial membrane potential, while the content of reactive oxygen was increased obviously. It is revealed that compound 1 mediated cell cycle arrest in G0/G1 phase by reducing G1 phase dependent proteins, CDK4 and Cyclin D1. As a result, it is indicated that compound 1 induced apoptosis on A549 cells was realized by regulating ROS-mediated mitochondria-dependent signaling pathway. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. Synthesis and biological evaluation of 2-(3,4-dimethoxyphenyl)-6-(2-[(18)F]fluoroethoxy)benzothiazole ([(18)F]FEDBT) for PET imaging of breast cancer.

    Science.gov (United States)

    Li, Geng-Ying; Vaulina, Daria D; Li, Jia-Je; Fedorova, Olga S; Wang, Hsin-Ell; Liu, Ren-Shyan; Krasikova, Raisa N; Chen, Chuan-Lin

    2017-08-01

    Given the ever-present demand for improved PET radiotracer in oncology imaging, we have synthesized 2-(3,4-dimethoxyphenyl)-6-(2-[(18)F]fluoroethoxy)benzothiazole ([(18)F]FEDBT), a fluorine-18-containing fluoroethylated benzothiazole to explore its utility as a PET imaging tracer. [(18)F]FEDBT was prepared via kryptofix-mediated nucleophilic substitution of the tosyl group precursor. Fractionated ethanol-based solid-phase (SPE cartridge-based) purification afforded [(18)F]FEDBT in 60% radiochemical yield (EOB), with radiochemical purity in excess of 98% and the specific activity was 35GBq/μmol. The radiotracer displayed clearly higher cellular uptake ratio in various breast cancer cell lines MCF7, MDA-MB-468 and MDA-MB-231. However, both biodistribution and microPET studies have showed an higher abdominal accumulation of [(18)F]FEDMBT and the tumor/muscle ratio of 1.8 was observed in the MDA-MB-231 xenograft tumors mice model. Further the lipophilic improvement is needed for the reducement of hepatobilliary accumulation and to promote the tumor uptake for PET imaging of breast cancer. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. 234U/238U and δ87Sr in peat as tracers of paleosalinity in the Sacramento-San Joaquin Delta of California, USA

    Science.gov (United States)

    Drexler, Judith Z.; Paces, James B.; Alpers, Charles N.; Windham-Myers, Lisamarie; Neymark, Leonid; Bullen, Thomas D.; Taylor, Howard E.

    2013-01-01

    The purpose of this study was to determine the history of paleosalinity over the past 6000+ years in the Sacramento-San Joaquin Delta (the Delta), which is the innermost part of the San Francisco Estuary. We used a combination of Sr and U concentrations, d87Sr values, and 234U/238U activity ratios (AR) in peat as proxies for tracking paleosalinity. Peat cores were collected in marshes on Browns Island, Franks Wetland, and Bacon Channel Island in the Delta. Cores were dated using 137Cs, the onset of Pb and Hg contamination from hydraulic gold mining, and 14C. A proof of concept study showed that the dominant emergent macrophyte and major component of peat in the Delta, Schoenoplectus spp., incorporates Sr and U and that the isotopic composition of these elements tracks the ambient water salinity across the Estuary. Concentrations and isotopic compositions of Sr and U in the three main water sources contributing to the Delta (seawater, Sacramento River water, and San Joaquin River water) were used to construct a three-end-member mixing model. Delta paleosalinity was determined by examining variations in the distribution of peat samples through time within the area delineated by the mixing model. The Delta has long been considered a tidal freshwater marsh region, but only peat samples from Franks Wetland and Bacon Channel Island have shown a consistently fresh signal (Browns Island) has alternated between fresh and oligohaline (0.5-5 ppt).

  1. The Absence of the N-acyl-homoserine-lactone Autoinducer Synthase Genes traI and ngrI Increases the Copy Number of the Symbiotic Plasmid in Sinorhizobium fredii NGR234.

    Science.gov (United States)

    Grote, Jessica; Krysciak, Dagmar; Petersen, Katrin; Güllert, Simon; Schmeisser, Christel; Förstner, Konrad U; Krishnan, Hari B; Schwalbe, Harald; Kubatova, Nina; Streit, Wolfgang R

    2016-01-01

    Plant-released flavonoids induce the transcription of symbiotic genes in rhizobia and one of the first bacterial responses is the synthesis of so called Nod factors. They are responsible for the initial root hair curling during onset of root nodule development. This signal exchange is believed to be essential for initiating the plant symbiosis with rhizobia affiliated with the Alphaproteobacteria. Here, we provide evidence that in the broad host range strain Sinorhizobium fredii NGR234 the complete lack of quorum sensing molecules results in an elevated copy number of its symbiotic plasmid (pNGR234a). This in turn triggers the expression of symbiotic genes and the production of Nod factors in the absence of plant signals. Therefore, increasing the copy number of specific plasmids could be a widespread mechanism of specialized bacterial populations to bridge gaps in signaling cascades.

  2. The absence of the N-acyl-homoserine-lactone autoinducer synthase genes traI and ngrI increases the copy number of the symbiotic plasmid in Sinorhizobium fredii NGR234

    Directory of Open Access Journals (Sweden)

    Jessica Grote

    2016-11-01

    Full Text Available Plant-released flavonoids induce the transcription of symbiotic genes in rhizobia and one of the first bacterial responses is the synthesis of so called Nod factors. They are responsible for the initial root hair curling during onset of root nodule development. This signal exchange is believed to be essential for initiating the plant symbiosis with rhizobia affiliated with the Alphaproteobacteria. Here, we provide evidence that in the broad host range strain Sinorhizobium fredii NGR234 the complete lack of quorum sensing molecules results in an elevated copy number of its symbiotic plasmid (pNGR234a. This in turn triggers the expression of symbiotic genes and the production of Nod factors in the absence of plant signals. Therefore, increasing the copy number of specific plasmids could be a widespread mechanism of specialized bacterial populations to bridge gaps in signalling cascades.

  3. [Comparison and clinical significance of different imageological methods in the detection of transitional carcinoma of upper urinary tract: analysis of 234 cases].

    Science.gov (United States)

    Zhang, Qian; Wang, Bing-dong; Wang, Jie-ping; Zhao, Ya-yuan; Sun, Xiao-wei; Hao, Jin-rui; He, Zhi-song

    2009-12-18

    To determine the diagnostic value of multislice CT urography (MSCTU) in patients with transitional cell carcinoma (TCC) of upper urinary tract by comparing other imageology methods used. Two hundred and thirty four cases of transitional cell carcinoma of upper urinary tract, in which 82 cases were diagnosed pathologically with pelvic carcinoma and 152 cases with ureteral carcinoma, between June 2004 and September 2006 in our institute were enrolled in a retrospective study. Most of them underwent urological ultrasound, intravenous urogram (IVU), retrograde pyelography and MSCTU. We compared the positive rate (PR) and diagnostic rate (DR) of these methods used by chi-square test. Among the 234 cases, 215 patients underwent urologic ultrasound, in which 152 cases were detected to be abnormal, with the PR of 70.7%; Meanwhile, 58 cased were diagnosed by this examination, with the DR of 27.0%. IVU was performed in 193 patients and 132 cases were found to be abnormal, and the PR was 68.4%, 65 cases were diagnosed by IVU and the DR was 33.7%. And 132 patients underwent retrograde pyelography, by which 115 cases of lesion were detected, with the PR of 87.1%; In the meantime, 93 cases were diagnosed, with the DR of 70.5%. MSCTU was performed in 226 cases and 220 cases were found to be abnormal, and the PR was 97.3%; 214 cases were diagnosed by MSCTU, with the DR of 94.7%. The DR of detecting TCC of retrograde pyelography had statistically significant difference with that of ultrasound and IVU (P<0.001). As compared with retrograde pyelography, MSCTU had statistically significant superiority (P<0.001). To shorten the diagnosis time and mitigate the sufferings, patients with hematuria supposed to be TCC of upper urinary tract should be recommended to undergo MSCTU first.

  4. Evolution of groundwater chemistry in coastal aquifers of the south-eastern White Sea area (NW Russia) using14C and234U-238U dating.

    Science.gov (United States)

    Malov, A I

    2018-03-01

    The specific objectives of the study are to clarify the sources and characteristics of groundwater in the aquifers along the coast of the White Sea in northwestern Russia, and on this basis to perform a broad 14 C and 234 U/ 238 U dating of all their types, taking into account the mixing processes. Investigation of an evolution of the groundwater chemistry revealed that the main evolutionary trends are the following: (1) Mixing Late Pleistocene brackish water end member (brackish1) and Mikulino seawater end member with strongly brackish and salty water in the Vpd aquifer (salty Vpd) formation. Groundwater dating showed the "brackish1" residence time in the aquifer of 32.96±2.3ka. Recharge of "brackish1" could have occurred in MIS 3. (2) Mixing Late Pleistocene freshwater end member (fresh LP) and "salty Vpd" end member with brackish water (brackish2) formation. Groundwater dating showed the "brackish2" residence time in the aquifer from 25.1±0.7 to 39.2±6.3ka. Recharge of "fresh LP" could have occurred ~ in MIS 3 also. (3) Mixing Middle Pleistocene-Holocene freshwater of melting glaciers (fresh MP-H) end member and brine end member with the strongly brackish and salty water in Vmz aquifer (salty Vmz) formation. Recharge of "fresh MP-H" could have occurred in Middle Pleistocene-Holocene during MIS 12-MIS 1. As a result of intensive and rapid recharge after the glacial melting, glacial fluids have penetrated at depth to >200m. The results of this study provide a better understanding of the interrelationship of various groundwater flows near the coasts and contribute to a more justified and efficient use of them for drinking water supply in large cities, balneological treatment and industrial extraction of iodine waters. They also allow assessment of the risks of dumping saline drainage water into the environment. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. CREATING THE KULTUK POLYGON FOR EARTHQUAKE PREDICTION: VARIATIONS OF (234U/238U AND 87SR/86SR IN GROUNDWATER FROM ACTIVE FAULTS AT THE WESTERN SHORE OF LAKE BAIKAL

    Directory of Open Access Journals (Sweden)

    S. V. Rasskazov

    2015-01-01

    Full Text Available Introduction. Determinations of (234U/238U in groundwater samples are used for monitoring current deformations in active faults (parentheses denote activity ratio units. The cyclic equilibrium of activity ratio 234U/238U≈≈(234U/238U≈γ≈1 corresponds to the atomic ratio ≈5.47×10–5. This parameter may vary due to higher contents of 234U nuclide in groundwater as a result of rock deformation. This effect discovered by P.I. Chalov and V.V. Cherdyntsev was described in [Cherdyntsev, 1969, 1973; Chalov, 1975; Chalov et al., 1990; Faure, 1989]. In 1970s and 1980s, only quite laborious methods were available for measuring uranium isotopic ratios. Today it is possible to determine concentrations and isotopic ration of uranium by express analytical techniques using inductively coupled plasma mass spectrometry (ICP‐MS [Halicz et al., 2000; Shen et al., 2002; Cizdziel et al., 2005; Chebykin et al., 2007]. Sets of samples canbe efficiently analysed by ICP‐MS, and regularly collected uranium isotope values can be systematized at a new quality level for the purposes of earthquake prediction. In this study of (234U/238U in groundwater at the Kultuk polygon, we selected stations of the highest sensitivity, which can ensure proper monitoring of the tectonic activity of the Obruchev and Main Sayan faults. These two faults that limit the Sharyzhalgai block of the crystalline basement of the Siberian craton in the south are conjugated in the territory of the Kultuk polygon (Fig 1. Forty sets of samples taken from 27 June 2012 to 28 January 2014 were analysed, and data on 170 samples are discussed in this paper.Methods. Isotope compositions of uranium and strontium were determined by methods described in [Chebykin et al., 2007; Pin et al., 1992] with modifications. Analyses of uranium by ISP‐MS technique were performed using an Agilent 7500ce quadrapole mass spectrometer of the Ultramicroanalysis Collective Use Centre; analyses of

  6. ESR dating of tooth enamel: comparison with {230Th }/{234U } speleothem dates at La Chaise-de-Vouthon (Charente), France

    Science.gov (United States)

    Blackwell, Bonnie; Porat, N.; Schwarcz, H. P.; Debénath, A.

    One way to assess a new dating method's reliability is by comparing its results with those from well established, independent techniques. A controlled test of the electron spin resonance (ESR) dating method as it is currently being applied to teeth was attempted for the time range 100-250 ka, beyond that of 14C, at the archaeological site of La Chaise-de-Vouthon (Charente, France). Although absent in modern enamel, a single ESR signal with g = 2.0018 in fossil tooth enamel hydroxyapatite increases in amplitude with increasing irradiation doses. ESR ages are derived from the ratio of the AD, the radiation dose needed to produce the observed ESR signal, relative to the natural, environmental dose rate (ED) experienced by the tooth after deposition. Since the age depends on the uranium (U) uptake history assumed, three ages are calculated assuming: (1) early U uptake (EU); (2) continuous (linear) uptake (LU); (3) recent uptake (RU). Generally, the LU age agrees best with known ages determined by other methods, although the RU model is better for some teeth. ESR dating assumes that the fossil has not suffered recrystallization or significant diagenetic alteration. In the preliminary test, three teeth were dated. In Bourgeois-Delaunay, a bovid molar associated with Palaeolithic artefacts was collected from layers dated at 101 ± 12 to 114 ± 7 ka by {230Th }/{234U } dating of the over- and underlying stalagmitic floors. From Suard, two Equus teeth were collected from beneath a stalagmitic floor dating 112 ± 12 ka. ESR dating teeth significantly underestimated the true age for the teeth: the mean ESR ages range from 37 to 94 ka with standard errors of 2-6 ka, and good replicability. Although more teeth at La Chaise need to be tested to ascertain that the underestimation does not result from random variation commonly seen among teeth within one unit, the consistent underestimation suggests a fault in one of the assumptions underlying the dating method. The most obvious

  7. RNA sequencing analysis of the broad-host-range strain Sinorhizobium fredii NGR234 identifies a large set of genes linked to quorum sensing-dependent regulation in the background of a traI and ngrI deletion mutant.

    Science.gov (United States)

    Krysciak, Dagmar; Grote, Jessica; Rodriguez Orbegoso, Mariita; Utpatel, Christian; Förstner, Konrad U; Li, Lei; Schmeisser, Christel; Krishnan, Hari B; Streit, Wolfgang R

    2014-09-01

    The alphaproteobacterium Sinorhizobium fredii NGR234 has an exceptionally wide host range, as it forms nitrogen-fixing nodules with more legumes than any other known microsymbiont. Within its 6.9-Mbp genome, it encodes two N-acyl-homoserine-lactone synthase genes (i.e., traI and ngrI) involved in the biosynthesis of two distinct autoinducer I-type molecules. Here, we report on the construction of an NGR234-ΔtraI and an NGR234-ΔngrI mutant and their genome-wide transcriptome analysis. A high-resolution RNA sequencing (RNA-seq) analysis of early-stationary-phase cultures in the NGR234-ΔtraI background suggested that up to 316 genes were differentially expressed in the NGR234-ΔtraI mutant versus the parent strain. Similarly, in the background of NGR234-ΔngrI 466 differentially regulated genes were identified. Accordingly, a common set of 186 genes was regulated by the TraI/R and NgrI/R regulon. Coregulated genes included 42 flagellar biosynthesis genes and 22 genes linked to exopolysaccharide (EPS) biosynthesis. Among the genes and open reading frames (ORFs) that were differentially regulated in NGR234-ΔtraI were those linked to replication of the pNGR234a symbiotic plasmid and cytochrome c oxidases. Biotin and pyrroloquinoline quinone biosynthesis genes were differentially expressed in the NGR234-ΔngrI mutant as well as the entire cluster of 21 genes linked to assembly of the NGR234 type III secretion system (T3SS-II). Further, we also discovered that genes responsible for rhizopine catabolism in NGR234 were strongly repressed in the presence of high levels of N-acyl-homoserine-lactones. Together with nodulation assays, the RNA-seq-based findings suggested that quorum sensing (QS)-dependent gene regulation appears to be of higher relevance during nonsymbiotic growth rather than for life within root nodules. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  8. Carbon export fluxes and export efficiency in the central Arctic during the record sea-ice minimum in 2012: a joint 234Th/238U and 210Po/210Pb study

    Science.gov (United States)

    Roca-Martí, Montserrat; Puigcorbé, Viena; Rutgers van der Loeff, Michiel M.; Katlein, Christian; Fernández-Méndez, Mar; Peeken, Ilka; Masqué, Pere

    2016-07-01

    The Arctic sea-ice extent reached a record minimum in September 2012. Sea-ice decline increases the absorption of solar energy in the Arctic Ocean, affecting primary production and the plankton community. How this will modulate the sinking of particulate organic carbon (POC) from the ocean surface remains a key question. We use the 234Th/238U and 210Po/210Pb radionuclide pairs to estimate the magnitude of the POC export fluxes in the upper ocean of the central Arctic in summer 2012, covering time scales from weeks to months. The 234Th/238U proxy reveals that POC fluxes at the base of the euphotic zone were very low (2 ± 2 mmol C m-2 d-1) in late summer. Relationships obtained between the 234Th export fluxes and the phytoplankton community suggest that prasinophytes contributed significantly to the downward fluxes, likely via incorporation into sea-ice algal aggregates and zooplankton-derived material. The magnitude of the depletion of 210Po in the upper water column over the entire study area indicates that particle export fluxes were higher before July/August than later in the season. 210Po fluxes and 210Po-derived POC fluxes correlated positively with sea-ice concentration, showing that particle sinking was greater under heavy sea-ice conditions than under partially ice-covered regions. Although the POC fluxes were low, a large fraction of primary production (>30%) was exported at the base of the euphotic zone in most of the study area during summer 2012, indicating a high export efficiency of the biological pump in the central Arctic.

  9. New considerations on the stratigraphy and environmental context of the oldest (2.34 Ma) Lokalalei archaeological site complex of the Nachukui Formation, West Turkana, northern Kenya Rift

    Science.gov (United States)

    Tiercelin, Jean-Jacques; Schuster, Mathieu; Roche, Hélène; Brugal, Jean-Philippe; Thuo, Peter; Prat, Sandrine; Harmand, Sonia; Davtian, Gourguen; Barrat, Jean-Alix; Bohn, Marcel

    2010-09-01

    At the northwest end of the Lake Turkana Basin (northern Kenya Rift), intensive fieldwork conducted on the Plio-Pleistocene fluvio-lacustrine Nachukui Formation by the National Museums of Kenya and the West Turkana Archaeological Project (WTAP), led to the discovery of more than 50 archaeological sites aged between 2.4 and 0.7 Ma. Among them is the Lokalalei archaeological site complex, which includes the two oldest archaeological sites (2.34 Ma) found in the Kenyan segment of the East African Rift System. The environmental background of the two sites was described as a succession of ephemeral streams with floodplain palaeosols in which the archaeological sites are situated, bordering the western bank of a large axial meandering river flowing southward. The Lokalalei 1 (LA1) and Lokalalei 2C (LA2C) archaeological sites are of extreme importance in terms of knowledge of hominins' knapping activities. The stratigraphic position of the LA1 and LA2C sites as well as implications on the technical differences between the two sites have been successively discussed by Roche et al. (1999), Brown and Gathogo (2002), and Delagnes and Roche (2005). In terms of stratigraphic position, Lokalalei 2C was estimated to be slightly higher in the section (i.e. younger) than Lokalalei 1. An alternative stratigraphic correlation was proposed by Brown and Gathogo (2002), who suggested that LA2C site should have been approximately 100,000 years younger than LA1. New considerations on the stratigraphy and environmental context of the Lokalalei sites have been developed following controversy on the stratigraphic position and time interval between the LA1 and LA2C sites. High-resolution lithostratigraphic work based on bed-to-bed field correlations, facies sedimentology and tephra geochemistry confirms that the LA2C site is slightly higher in the section than the LA1 site by about 11.20 m. This represents a time interval of ˜74,000 years based on an assumed sedimentation rate of 152 mm

  10. Insignificant enhancement of export flux in the highly productive subtropical front, east of New Zealand: a high resolution study of particle export fluxes based on 234Th: 238U disequilibria

    Directory of Open Access Journals (Sweden)

    J. A. Hall

    2012-03-01

    Full Text Available We evaluated the export fluxes of Particulate Organic Carbon (POC in the Subtropical Frontal zone (STF of the SW Pacific sector of the Southern Ocean. The site is characterized by enhanced primary productivity, which has been suggested to be stimulated through so-called natural iron fertilization processes where iron-depleted subantarctic water (SAW mixes with mesotrophic, iron-replete subtropical water (STW. We adopted the small-volume 234Th method to achieve the highest possible spatial sampling resolution in austral late autumn-early winter, May–June, 2008. Inventories of chlorophyll-a, particulate 234Th and POC observed in the upper 100 m were all elevated in the mid-salinity water type (34.5 34.8 salinity waters which were of STW origin with low macronutrients. However, Steady-State 234Th fluxes were similar across the salinity gradient being, 25 ± 0.78 ((1.5 ± 0.047 × 103 in the mid-salinity, and 29 ± 0.53 ((1.8 ± 0.032 × 103 and 22 ± 1.1 Bq m−2 d−1 ((1.3 ± 0.066 × 103 dpm m−2 d–1 in the high and low salinity waters respectively. Bottle POC/Th ratios at the depth of 100 m were used to convert 234Th fluxes into POC export fluxes. The derived POC flux did not appear to be enhanced in mid-salinity waters where the primary productivity was inferred to be the highest at the time of sampling, with a flux of 11 ± 0.45 mmol C m−2 d−1, compared to 14 ± 0.39 mmol C m−2 d−1 in high salinity waters and 8.5 ± 0.66 mmol C m−2 d−1 in low salinity waters. This study thus implied that natural iron fertilization does not necessarily lead to an enhancement of POC export in STF regions.

  11. The importance of tides for sediment dynamics in the deep sea—Evidence from the particulate-matter tracer 234Th in deep-sea environments with different tidal forcing

    Science.gov (United States)

    Peine, Florian; Turnewitsch, Robert; Mohn, Christian; Reichelt, Theresa; Springer, Barbara; Kaufmann, Manfred

    2009-07-01

    Key aspects of deep-ocean fluid dynamics such as basin-scale (residual) and tidal flow are believed to have changed over glacial/interglacial cycles, with potential relevance for climatic change. To constrain the mechanistic links, magnitudes and temporal succession of events analyses of sedimentary paleo-records are of great importance. Efforts have been underway for some time to reconstruct residual-flow patterns from sedimentary records. Attempts to reconstruct tidal flow characteristics from deep-sea sediment deposits, however, are at a very early stage and first require a better understanding of the reflection of modern tides in sediment dynamics. In this context internal (baroclinic) tides, which are formed by the surface (barotropic) tide interacting with seafloor obstacles, are believed to play a particularly important role. Here we compare two modern deep-sea environments with respect to the effect of tides on sediment dynamics. Both environments are influenced by kilometre-scale topographic features but with vastly different tidal forcing: (1) two sites in the Northeast Atlantic (NEA) being surrounded by, or located downstream of, fields of short seamounts (maximum barotropic tidal current velocities ˜5 cm s -1); and (2) a site next to the Anaximenes seamount in the Eastern Mediterranean (EMed) (maximum barotropic tidal current velocities ˜0.5 cm s -1). With respect to other key fluid-dynamical parameters both environments are very similar. Signals of sedimentary particle dynamics, as influenced by processes taking place in the bottom boundary layer, were traced by the vertical water-column distribution of radioactive disequilibria (daughter/parent activity ratios≠1) between the naturally occurring, short-lived (half-life: 24.1 d) particulate-matter tracer 234Th relative to its very long-lived and non-particle-reactive parent nuclide 238U. Activity ratios of 234Th/ 238Uwater samples collected near the seafloor indicate fast 234Th scavenging onto

  12. Carbon-Coated Na3.32 Fe2.34 (P2 O7 )2 Cathode Material for High-Rate and Long-Life Sodium-Ion Batteries.

    Science.gov (United States)

    Chen, Mingzhe; Chen, Lingna; Hu, Zhe; Liu, Qiannan; Zhang, Binwei; Hu, Yuxiang; Gu, Qinfen; Wang, Jian-Li; Wang, Lian-Zhou; Guo, Xiaodong; Chou, Shu-Lei; Dou, Shi-Xue

    2017-06-01

    Rechargeable sodium-ion batteries are proposed as the most appropriate alternative to lithium batteries due to the fast consumption of the limited lithium resources. Due to their improved safety, polyanion framework compounds have recently gained attention as potential candidates. With the earth-abundant element Fe being the redox center, the uniform carbon-coated Na3.32 Fe2.34 (P2 O7 )2 /C composite represents a promising alternative for sodium-ion batteries. The electrochemical results show that the as-prepared Na3.32 Fe2.34 (P2 O7 )2 /C composite can deliver capacity of ≈100 mA h g-1 at 0.1 C (1 C = 120 mA g-1 ), with capacity retention of 92.3% at 0.5 C after 300 cycles. After adding fluoroethylene carbonate additive to the electrolyte, 89.6% of the initial capacity is maintained, even after 1100 cycles at 5 C. The electrochemical mechanism is systematically investigated via both in situ synchrotron X-ray diffraction and density functional theory calculations. The results show that the sodiation and desodiation are single-phase-transition processes with two 1D sodium paths, which facilitates fast ionic diffusion. A small volume change, nearly 100% first-cycle Coulombic efficiency, and a pseudocapacitance contribution are also demonstrated. This research indicates that this new compound could be a potential competitor for other iron-based cathode electrodes for application in large-scale Na rechargeable batteries. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  14. Tracing of natural radionuclides mobility in deep sedimentary environment using radioactive ({sup 234}U/{sup 238}U) disequilibria: application to the Mesozoic formations of the Eastern part of the Paris Basin; Tracage de la mobilite des radionucleides naturels en milieu sedimentaire profond a l'aide des desequilibres radioactifs ({sup 234}U/{sup 238}U): application aux formations mesozoiques de l'est du Bassin de Paris

    Energy Technology Data Exchange (ETDEWEB)

    Deschamps, P

    2003-11-01

    This thesis forms part of the geological investigations undertaken by the French agency for nuclear waste management, ANDRA, around the Meuse/Haute-Marne Underground Research Laboratory (URL) located in the Eastern part of the Paris Basin in order to evaluate the feasibility of high-level radioactive waste repository in deep argilite formations. The aim of the study is to examine the radionuclide migration in the deep Callovo-Oxfordian target argilite layer and its surrounding low- permeability Bathonian and Oxfordian limestone formations in order to assess the long term confining capacities of the sedimentary series. This study is based on measurement of radioactive disequilibria within U-series by Multiple- Collector Inductively Coupled Plasma Mass Spectrometry (MC-ICP-MS). The high precision and accuracy achieved allowed to demonstrate the {sup 234}U/{sup 238}U radioactive equilibrium in the Callovo-Oxfordian argilites. This result shows the uranium immobility in the target formation and provides a strong evidence for the current chemical stability and closure of the system for uranium and most probably for the other actinides. This is a fundamental result with respect to the problematic of disposal of high level radioactive waste in deep geological formation since it provides a in situ indication of the confining capacities of the clayey target formation in the current settings. Conversely, ({sup 234}U/{sup 238}U) disequilibria are systematically observed within zones, located in the surrounding carbonate formations, that are characterized by pressure dissolution structures (stylolites or dissolution seams). These disequilibria provide evidence for a discrete uranium relocation during the last two million years in the vicinity of stylolitic structures. This is a surprising result since it is generally supposed that these deep, low permeability, compact formations behave as closed system at the time scale of the U-series. (author)

  15. Potential Human Health Risk by Metal(loid)s, 234,238U and 210Po due to Consumption of Fish from the “Luis L. Leon” Reservoir (Northern México)

    Science.gov (United States)

    Luna-Porres, Mayra Y.; Rodríguez-Villa, Marco A.; Herrera-Peraza, Eduardo F.; Renteria-Villalobos, Marusia; Montero-Cabrera, María E.

    2014-01-01

    Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC) in fillet samples showed values of 0.007–0.014 and 0.01–0.02 Bq∙kg−1 wet weight (ww), respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16–3.26, 0.70–1.13 and 0.93–1.37 Bq∙kg−1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13–0.39, 0.005–0.126 and 0.009–0.08 mg∙kg−1 ww, respectively, while in gill samples they were 0.11–0.43, 0.002–0.039 and 0.02–0.26 mg∙kg−1 ww. The elemental Bioaccumulation Factor (BAF) for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg−1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg−1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg−1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg−1 in fillet and gills, respectively. Some metal(loid) concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loid)s in fillet among the studied species is probably due to their differences in diet and habitat. PMID:24968208

  16. Potential Human Health Risk by Metal(loids, 234,238U and 210Po due to Consumption of Fish from the “Luis L. Leon” Reservoir (Northern México

    Directory of Open Access Journals (Sweden)

    Mayra Y. Luna-Porres

    2014-06-01

    Full Text Available Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC in fillet samples showed values of 0.007–0.014 and 0.01–0.02 Bq∙kg−1 wet weight (ww, respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16–3.26, 0.70–1.13 and 0.93–1.37 Bq∙kg−1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13–0.39, 0.005–0.126 and 0.009–0.08 mg∙kg−1 ww, respectively, while in gill samples they were 0.11–0.43, 0.002–0.039 and 0.02–0.26 mg∙kg−1 ww. The elemental Bioaccumulation Factor (BAF for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg−1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg−1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg−1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg−1 in fillet and gills, respectively. Some metal(loid concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loids in fillet among the studied species is probably due to their differences in diet and habitat.

  17. Measurement of the 234U(n, f ) cross-section with quasi-monoenergetic beams in the keV and MeV range using a Micromegas detector assembly

    Science.gov (United States)

    Stamatopoulos, A.; Kanellakopoulos, A.; Kalamara, A.; Diakaki, M.; Tsinganis, A.; Kokkoris, M.; Michalopoulou, V.; Axiotis, M.; Lagoyiannis, A.; Vlastou, R.

    2018-01-01

    The 234U neutron-induced fission cross-section has been measured at incident neutron energies of 452, 550, 651 keV and 7.5, 8.7, 10 MeV using the 7Li ( p, n) and the 2H( d, n) reactions, respectively, relative to the 235U( n, f ) and 238U( n, f ) reference reactions. The measurement was performed at the neutron beam facility of the National Center for Scientific Research "Demokritos", using a set-up based on Micromegas detectors. The active mass of the actinide samples and the corresponding impurities were determined via α-spectroscopy using a surface barrier silicon detector. The neutron spectra intercepted by the actinide samples have been thoroughly studied by coupling the NeuSDesc and MCNP5 codes, taking into account the energy and angular straggling of the primary ion beams in the neutron source targets in addition to contributions from competing reactions ( e.g. deuteron break-up) and neutron scattering in the surrounding materials. Auxiliary Monte Carlo simulations were performed making combined use of the FLUKA and GEF codes, focusing particularly on the determination of the fission fragment detection efficiency. The developed methodology and the final results are presented.

  18. Synthesis, characterization and thermodynamic studies of complexes of dimethyl, diethyl, and diphenyltin(IV dichlorides with (2H-1,4-benzothiazine-2,3-(4H-dione dioxime

    Directory of Open Access Journals (Sweden)

    Leyla Shabani

    2012-12-01

    Full Text Available The diorganotin(IV compounds, [Me2SnCl2(H2L], [Et2SnCl2 (H2L] and [Ph2SnCl2(H2L] (H2L = (2H-1,4-benzothiazine-2,3-(4H-dione dioxime, were synthesized by treating the appropriate diorganotin(IV dichloride with H2L in anhydrous ethanol. These complexes were characterized by IR, MS, UV-Vis, and 1H NMR. Thermodynamic studies of the reported complexes have been carried out and their stability were found in the order: [Me2SnCl2(H2L] > [Et2SnCl2(H2L] > [Ph2SnCl2(H2L]. Theoretical calculations at the HF/3-21G* level showed that structures with alkyl groups at axial positions are more stable than their counterparts having alkyl groups at equatorial.DOI: http://dx.doi.org/10.4314/bcse.v26i1.9

  19. Publications | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... of uptake (restricted access). Teleosts take up metals by two major pathways: gills and/or gut. Past research is heavily focused on branchial uptake despite evidence that the gastro-intestinal tract (GIT) is the dominant route in some natural environments. To address this information gap, my thesis characterizes uptake.

  20. Reference: 234 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available c stress factors. The diversity of ethylene functions is achieved, at least in pa... insensitivity of wei2 and wei7, illustrating how interactions between hormones can be used to achieve

  1. 14 CFR 234.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...: Cancelled flight means a flight operation that was not operated, but was listed in a carrier's computer... reporting to computer reservations system vendors, flight also means one-stop or multi-stop single plane... within 30 minutes of any discontinued flight that was contained in the carrier's published schedules for...

  2. 49 CFR 234.263 - Relays.

    Science.gov (United States)

    2010-10-01

    .... (b)(1) Alternating current vane type relays, direct current polar type relays, and relays with soft iron magnetic structure shall be tested at least once every two years. (2) Alternating current...

  3. Publications | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  4. TMFunction data: 234 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  5. 32 CFR 234.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... operates, drives, controls, otherwise has charge of, or is in actual physical control of a mechanical mode.... Possession. Exercising direct physical control or dominion, with or without ownership, over property. State..., by compressed gas, or by spring power; any bow and arrow, crossbow, blowgun, spear gun, hand-thrown...

  6. 2-[(3,4-Dichlorobenzylideneamino]-4-methylphenol

    Directory of Open Access Journals (Sweden)

    Muhammet Kose

    2013-06-01

    Full Text Available In the title compound, C14H11Cl2NO, the dihedral angle between the benzene rings is 15.36 (8°. A phenol–imine-type intramolecular O—H...N hydrogen bond generates an S(5 ring motif. In the crystal, a pair of weak C—H...O hydrogen bonds form an R21(7 ring motif involving glide-plane-related molecules. The molecules linked via these interactions form chains along [101].

  7. 36 CFR 2.34 - Disorderly conduct.

    Science.gov (United States)

    2010-07-01

    ... recklessly creating a risk thereof, such person commits any of the following prohibited acts: (1) Engages in fighting or threatening, or in violent behavior. (2) Uses language, an utterance, or gesture, or engages in a display or act that is obscene, physically threatening or menacing, or done in a manner that is...

  8. 32 CFR 234.7 - Disorderly conduct.

    Science.gov (United States)

    2010-07-01

    ... a risk thereof, such person commits any of the following prohibited acts: (a) Engages in fighting or threatening, or in violent behavior. (b) Uses language, an utterance, or gesture, or engages in a display or act that is obscene, physically threatening or menacing, or done in a manner that is likely to inflict...

  9. Neutron-induced fission cross-section measurement of 234U with quasi-monoenergetic beams in the keV and MeV range using micromegas detectors

    Directory of Open Access Journals (Sweden)

    Tsinganis A.

    2017-01-01

    Full Text Available Accurate data on neutron-induced fission cross-sections of actinides are essential for the design of advanced nuclear reactors based either on fast neutron spectra or alternative fuel cycles, as well as for the reduction of safety margins of existing and future conventional facilities. The fission cross-section of 234U was measured at incident neutron energies of 560 and 660 keV and 7.5 MeV with a setup based on ‘microbulk’ Micromegas detectors and the same samples previously used for the measurement performed at the CERN n_TOF facility (Karadimos et al., 2014. The 235U fission cross-section was used as reference. The (quasi-monoenergetic neutron beams were produced via the 7Li(p,n and the 2H(d,n reactions at the neutron beam facility of the Institute of Nuclear and Particle Physics at the ‘Demokritos’ National Centre for Scientific Research. A detailed study of the neutron spectra produced in the targets and intercepted by the samples was performed coupling the NeuSDesc and MCNPX codes, taking into account the energy spread, energy loss and angular straggling of the beam ions in the target assemblies, as well as contributions from competing reactions and neutron scattering in the experimental setup. Auxiliary Monte-Carlo simulations were performed with the FLUKA code to study the behaviour of the detectors, focusing particularly on the reproduction of the pulse height spectra of α-particles and fission fragments (using distributions produced with the GEF code for the evaluation of the detector efficiency. An overview of the developed methodology and preliminary results are presented.

  10. Neutron-induced fission cross-section measurement of 234U with quasi-monoenergetic beams in the keV and MeV range using micromegas detectors

    Science.gov (United States)

    Tsinganis, A.; Kokkoris, M.; Vlastou, R.; Kalamara, A.; Stamatopoulos, A.; Kanellakopoulos, A.; Lagoyannis, A.; Axiotis, M.

    2017-09-01

    Accurate data on neutron-induced fission cross-sections of actinides are essential for the design of advanced nuclear reactors based either on fast neutron spectra or alternative fuel cycles, as well as for the reduction of safety margins of existing and future conventional facilities. The fission cross-section of 234U was measured at incident neutron energies of 560 and 660 keV and 7.5 MeV with a setup based on `microbulk' Micromegas detectors and the same samples previously used for the measurement performed at the CERN n_TOF facility (Karadimos et al., 2014). The 235U fission cross-section was used as reference. The (quasi-)monoenergetic neutron beams were produced via the 7Li(p,n) and the 2H(d,n) reactions at the neutron beam facility of the Institute of Nuclear and Particle Physics at the `Demokritos' National Centre for Scientific Research. A detailed study of the neutron spectra produced in the targets and intercepted by the samples was performed coupling the NeuSDesc and MCNPX codes, taking into account the energy spread, energy loss and angular straggling of the beam ions in the target assemblies, as well as contributions from competing reactions and neutron scattering in the experimental setup. Auxiliary Monte-Carlo simulations were performed with the FLUKA code to study the behaviour of the detectors, focusing particularly on the reproduction of the pulse height spectra of α-particles and fission fragments (using distributions produced with the GEF code) for the evaluation of the detector efficiency. An overview of the developed methodology and preliminary results are presented.

  11. Koenigs-Knorr reaction of fusel alcohols with methyl (1-bromo-2,3,4-tri-O-acetyl-α-D-glucopyranosid)uronate leading to the protected alkyl glucuronides-crystal structures and high resolution 1H and 13C NMR data.

    Science.gov (United States)

    Mönch, Bettina; Gebert, Antje; Emmerling, Franziska; Becker, Roland; Nehls, Irene

    2012-05-01

    Crystal structures and high resolution (1)H and (13)C NMR spectral data for methyl (alkyl 2,3,4-tri-O-acetyl-β-D-glucopyranosid)uronates (alkyl=methyl, ethyl, n-propyl, i-propyl, n-butyl, sec-butyl, i-butyl, n-pentyl, 2-methyl-1-butyl and 3-methyl-1-butyl) are presented. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  13. Overexpression of the catalytically impaired Taspase1 T234V or Taspase1 D233A variants does not have a dominant negative effect in T(4;11 leukemia cells.

    Directory of Open Access Journals (Sweden)

    Carolin Bier

    Full Text Available BACKGROUND: The chromosomal translocation t(4;11(q21;q23 is associated with high-risk acute lymphoblastic leukemia of infants. The resulting AF4•MLL oncoprotein becomes activated by Taspase1 hydrolysis and is considered to promote oncogenic transcriptional activation. Hence, Taspase1's proteolytic activity is a critical step in AF4•MLL pathophysiology. The Taspase1 proenzyme is autoproteolytically processed in its subunits and is assumed to assemble into an αββα-heterodimer, the active protease. Therefore, we investigated here whether overexpression of catalytically inactive Taspase1 variants are able to interfere with the proteolytic activity of the wild type enzyme in AF4•MLL model systems. METHODOLOGY/FINDINGS: The consequences of overexpressing the catalytically dead Taspase1 mutant, Taspase1(T234V, or the highly attenuated variant, Taspase1(D233A, on Taspase1's processing of AF4•MLL and of other Taspase1 targets was analyzed in living cancer cells employing an optimized cell-based assay. Notably, even a nine-fold overexpression of the respective Taspase1 mutants neither inhibited Taspase1's cis- nor trans-cleavage activity in vivo. Likewise, enforced expression of the α- or β-subunits showed no trans-dominant effect against the ectopically or endogenously expressed enzyme. Notably, co-expression of the individual α- and β-subunits did not result in their assembly into an enzymatically active protease complex. Probing Taspase1 multimerization in living cells by a translocation-based protein interaction assay as well as by biochemical methods indicated that the inactive Taspase1 failed to assemble into stable heterocomplexes with the wild type enzyme. CONCLUSIONS: Collectively, our results demonstrate that inefficient heterodimerization appears to be the mechanism by which inactive Taspase1 variants fail to inhibit wild type Taspase1's activity in trans. Our work favours strategies targeting Taspase1's catalytic activity

  14. Potential of predictive computer models for preoperative patient selection to enhance overall quality-adjusted life years gained at 2-year follow-up: a simulation in 234 patients with adult spinal deformity.

    Science.gov (United States)

    Oh, Taemin; Scheer, Justin K; Smith, Justin S; Hostin, Richard; Robinson, Chessie; Gum, Jeffrey L; Schwab, Frank; Hart, Robert A; Lafage, Virginie; Burton, Douglas C; Bess, Shay; Protopsaltis, Themistocles; Klineberg, Eric O; Shaffrey, Christopher I; Ames, Christopher P

    2017-12-01

    OBJECTIVE Patients with adult spinal deformity (ASD) experience significant quality of life improvements after surgery. Treatment, however, is expensive and complication rates are high. Predictive analytics has the potential to use many variables to make accurate predictions in large data sets. A validated minimum clinically important difference (MCID) model has the potential to assist in patient selection, thereby improving outcomes and, potentially, cost-effectiveness. METHODS The present study was a retrospective analysis of a multiinstitutional database of patients with ASD. Inclusion criteria were as follows: age ≥ 18 years, radiographic evidence of ASD, 2-year follow-up, and preoperative Oswestry Disability Index (ODI) > 15. Forty-six variables were used for model training: demographic data, radiographic parameters, surgical variables, and results on the health-related quality of life questionnaire. Patients were grouped as reaching a 2-year ODI MCID (+MCID) or not (-MCID). An ensemble of 5 different bootstrapped decision trees was constructed using the C5.0 algorithm. Internal validation was performed via 70:30 data split for training/testing. Model accuracy and area under the curve (AUC) were calculated. The mean quality-adjusted life years (QALYs) and QALYs gained at 2 years were calculated and discounted at 3.5% per year. The QALYs were compared between patients in the +MCID and -MCID groups. RESULTS A total of 234 patients met inclusion criteria (+MCID 129, -MCID 105). Sixty-nine patients (29.5%) were included for model testing. Predicted versus actual results were 50 versus 40 for +MCID and 19 versus 29 for -MCID (i.e., 10 patients were misclassified). Model accuracy was 85.5%, with 0.96 AUC. Predicted results showed that patients in the +MCID group had significantly greater 2-year mean QALYs (p = 0.0057) and QALYs gained (p = 0.0002). CONCLUSIONS A successful model with 85.5% accuracy and 0.96 AUC was constructed to predict which patients would reach

  15. Synthesis of ceramic powders of La{sub 9,56} (SiO{sub 4}){sub 6}O{sub 2,34} and La{sub 9,8}Si{sub 5,7}Mg{sub O,3}O{sub 26,}4 by modified sol-gel process; Sintese de pos ceramicos de La{sub 9,56} (SiO{sub 4}){sub 6}O{sub 2,34} e La{sub 9,8}Si{sub 5,7}Mg{sub O,3}O{sub 26,}4 por processo sol-gel modificado

    Energy Technology Data Exchange (ETDEWEB)

    Lira, Sabrina Lopes; Paiva, Mayara Rafaela Soares; Misso, Agatha Matos; Elias, Daniel Ricco; Yamagata, Chieko, E-mail: yamagata@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CCTM/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Ciencia e Tecnologia de Materiais

    2012-07-01

    Lanthanum silicate oxyapatite materials are promising for application as electrolyte in solid oxide fuel cells because of high ionic conductivity at temperatures between 600 deg C and 800 deg C. In this work, oxyapatites with the composition La{sub 9,56}(SiO{sub 4}){sub 6}O{sub 2,34}, and La{sub 9,8}Si{sub 5,7}Mg{sub 0,3}O{sub 26,4} were synthesized by using the sol-gel method, followed by precipitation. Initially, the gel of silica was synthesized from sodium silicate solution, by acid catalysis using lanthanum and magnesium chloride solution. Then, the La and Mg hydroxides were precipitated with NaOH in the gel. The powders were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and measurements of specific surface area. The crystalline oxyapatite phase of La{sub 9,56}(SiO{sub 4}){sub 6}O{sub 2,34}, and was La{sub 9,8}Si{sub 5,7}Mg{sub 0,3}O{sub 26,4} obtained by calcination at 900 deg C for 2 and 1h respectively (author)

  16. Quantification of {sup 232}Th, {sup 234}U, {sup 235}U and {sup 238}U in river mollusks by magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS); Cuantificacion de {sup 232}Th, {sup 234}U, {sup 235}U y {sup 238}U en moluscos de rios por espectrometria de masas de sector magnetico con fuente de plasma acoplado inductivamente (ICP-SFMS)

    Energy Technology Data Exchange (ETDEWEB)

    Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Alfaro de la T, M. C., E-mail: arevalo0591@hotmail.com [Universidad Autonoma de San Luis Potosi, Dr. Salvador Nava s/n, Zona Universitaria, 78290 San Luis Potosi, SLP (Mexico)

    2016-09-15

    The present work deals with the methodology established for the quantification of {sup 232}Th, {sup 234}U, {sup 238}U and {sup 235}U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO{sub 3} minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of {sup 232}Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ({sup 232}Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of {sup 232}Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)

  17. The particulate {sup 7}Be/{sup 210}Pb{sub xs} and {sup 234}Th/{sup 210}Pb{sub xs} activity ratios as tracers for tidal-to-seasonal particle dynamics in the Gironde estuary (France): Implications for the budget of particle-associated contaminants

    Energy Technology Data Exchange (ETDEWEB)

    Saari, Hanna-Kaisa [Universite de Bordeaux, UMR5805 EPOC, F-33405 Talence Cedex (France); Schmidt, Sabine, E-mail: s.schmidt@epoc.u-bordeaux1.fr [CNRS, UMR5805 EPOC, F-33405 Talence Cedex (France); Castaing, Patrice; Blanc, Gerard [Universite de Bordeaux, UMR5805 EPOC, F-33405 Talence Cedex (France); Sautour, Benoit [Universite de Bordeaux, UMR5805 EPOC, Station Marine d' Arcachon, F-33120 Arcachon (France); Masson, Olivier [IRSN, BP 3, 13115 Saint Paul Lez Durance (France); Cochran, J. Kirk [Marine Sciences Research Center, School of Marine and Atmospheric Sciences, Stony Brook University, Stony Brook, New York 11794-5000 (United States)

    2010-09-15

    The short-lived natural radionuclides {sup 7}Be (T{sub 1/2} = 53 days), {sup 234}Th{sub xs} (T{sub 1/2} = 24.1 days) and {sup 210}Pb{sub xs} (T{sub 1/2} = 22.3 years), i.e. {sup 234}Th and {sup 210}Pb in excesses of that supported within particles by the decay of their parent isotopes, were analysed in suspended particulate matter (SPM) to study the particle dynamics in the Gironde fluvial estuarine system (France), strongly impacted by heavy metal pollution. From surveys of this land-ocean interface in 2006 and 2007, we established a times series of these radioisotopes and of their activity ratios ({sup 7}Be/{sup 210}Pb{sub xs} and {sup 234}Th/{sup 210}Pb{sub xs} ARs) in particles sampled under different hydrological conditions. The particulate {sup 7}Be/{sup 210}Pb{sub xs} AR varies along the fluvial estuarine system mainly due to variations in {sup 7}Be activities, controlled by riverine, oceanic and atmospheric inputs and by resuspension of old {sup 7}Be-deficient sediments. These processes vary with river discharge, tidal cycle and season. Therefore, seasonal particle transport processes can be described using variations of the SPM {sup 7}Be/{sup 210}Pb{sub xs} ARs. During high river discharge, the SPM {sup 7}Be/{sup 210}Pb{sub x} ARs decrease from river to the ocean. The turbidity maximum zone (TMZ) is dispersed and the particles, and the associated contaminants, are rapidly transported from river to coastal waters, without significant retention within the TMZ. During low river discharge, the TMZ intrudes into the fluvial estuary, and the lowest {sup 7}Be/{sup 210}Pb{sub x} ARs are observed there due to resuspension of {sup 7}Be-deficient sediments. Away from the TMZ, from the middle to lower estuary, SPM {sup 7}Be/{sup 210}Pb{sub x} ARs increase, indicating that the particles have been recently tagged with {sup 7}Be. We explain this trend as being caused by marine input of dissolved radionuclides, as traced by SPM {sup 234}Th/{sup 210}Pb{sub xs} ARs

  18. AIMSsim Version 2.3.4 - System Manual

    Science.gov (United States)

    2008-01-01

    permet au système AGTV de pénétrer des phénomènes météorologiques tels que le brouillard, la neige et la pluie beaucoup plus efficacement qu’une...installée à l’extérieur d’un aéronef ou d’un véhicule. L’utilisation de gyros à l’intérieur de la boule permet à la caméra de maintenir son

  19. AIMSsim Version 2.3.4 - User Manual

    Science.gov (United States)

    2008-01-01

    phénomènes météorologiques tels que le brouillard, la neige et la pluie beaucoup plus efficacement qu’une caméra FLIR. La caméra FLIR est un système...d’un véhicule. L’utilisation de gyros à l’intérieur de la boule permet à la caméra de maintenir son orientation par rapport à la Terre, sans être

  20. 234 Fruiting Efficiency of Pentaclethra Macraphylla Benth: A Case ...

    African Journals Online (AJOL)

    Nekky Umera

    One of the major problems of P. macrophylla is the threat of extinction mainly due to .... evolution of mast fruiting in the aseasonal tropics. Am. Nat. 132-44-. 66. Bawa, K.S. and C.J. Webb (1984): Flower, fruit and seed abortions in tropical forest trees: implications for the evolution of maternal and paternal reproductive ...

  1. Teenage Suicide: What Can the Schools Do? Fastback 234.

    Science.gov (United States)

    Pfeifer, Jerilyn K.

    This document is a short summary of teenage suicide issues intended for use by teachers. Possible causes for teenage suicide are discussed, including: (1) chemical abuse; (2) unrealistic view of death; (3) the nuclear threat; (4) societal changes; (5) family changes; (6) lifestyle decisions; (7) academic pressures; and (8) the success code.…

  2. 48 CFR 1852.234-2 - Earned Value Management System.

    Science.gov (United States)

    2010-10-01

    ... SPACE ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions... Contracting Officer may take remedial action, that may include, but is not limited to, a reduction in fee. (c... company procedures in satisfying the CPR required by the contract through recurring program/project and...

  3. Dicty_cDB: VFA234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 74 2e-13 2 BU715686 |BU715686.1 SJMCHE04 SJM Schistosoma japonicum cDNA, mRNA sequence. 58 3e-12 2 AX488918...64 3e-10 2 BU776741 |BU776741.1 SJEDCC02 SJE Schistosoma japonicum cDNA, mRNA sequence. 50 4e-10 2 U25180...64 4e-10 2 BU766685 |BU766685.1 SJEAIG07 SJE Schistosoma japonicum cDNA, mRNA sequence. 50 5e-10 2 BU771972...BU771972 |BU771972.1 SJEELA04 SJE Schistosoma japonicum cDNA, mRNA sequence. 50 6e-10 2 dna update 2003...|pid:none) Schistosoma japonicum phosphoglyce... 68 9e-11 FN315990_1( FN315990 |pid:none) Schistosoma japonicum

  4. 50 CFR 216.234 - Mitigation, monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Rocket Launches from the Kodiak Launch... five replicate fixed-wing aerial surveys of all hauled out Steller sea lions and harbor seals at Ugak...

  5. Dicty_cDB: SHL234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available K--- ---NPLCNADIFVPCGGRPESVQLTNVDKMFTATGESRFPIIVEGANLFFTQKARLMIEE KGAIIFKDASANKGGVTSSSLEVLAALALNDEEF...k--- ---NPLCNADIFVPCGGRPESVQLTNVDKMFTATGESRFPIIVEGANLFFTQKARLMIEE KGAIIFKDASANKGGVTSSSLEVLAALALNDEEF

  6. 16 CFR 23.4 - Misrepresentation as to gold content.

    Science.gov (United States)

    2010-01-01

    ... unfair or deceptive to misrepresent the presence of gold or gold alloy in an industry product, or the... abbreviation to describe all or part of an industry product composed throughout of an alloy of gold, unless a... designation of the karat fineness of the alloy that is of at least equal conspicuousness as the term used. (6...

  7. Dicty_cDB: VFJ234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value VSD112 (VSD112Q) /CSM/VS/VSD1-A.../SSC690Q.Seq.d/ 155 1e-37 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 4e-34 1 dna update 2009. 1.20 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  8. 234 Fruiting Efficiency of Pentaclethra Macraphylla Benth: A Case ...

    African Journals Online (AJOL)

    Nekky Umera

    inflorescence as a percentage of the pooled mean number of flowers produced per inflorescence. P.macrophylla had regular fruiting pattern in both locations with no ... commercial value especially in the southeastern part of Nigeria. Its seed is an essential component of the popular “African salad” served in homes, wedding ...

  9. Radiochemical separation of thorium 234 from uranile acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Rendon, R.M.; Solache, R.M.; Tenorio, D. (Instituto Nacional de Investigaciones Nucleares, Mexico City)

    1984-03-15

    The optimum conditions for the chemical separation of thorium compounds obtained by the chemical effects of ..cap alpha.. decay of uranium 238, in uranile acetylacetonate were established. The separation technique used was solvent extraction; the retention value obtained was 9.8+-2.1%.

  10. Dicty_cDB: SHF234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YNLSKLQDPRIEKLPYSIRILLESAVRNCDN FEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKRLGGDPAK INPLVPV...YNLSKLQDPRIEKLPYSIRILLESAVRNCDN FEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKRLGGDPAK INPLVPV

  11. Dicty_cDB: CFH234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hwmimvtvtk*HPLNKLSFTNSKLNSTHGITLGFDPQYDTA YPDENGLGWDILASFYNMDINAPSFNIEK--- ---VGXGIXIPAKEGYXLXKXGXXKTWVKKY*rlsli*ixkaxqxmaexxxkxrf...psig*lwlq*qsntr*tsspspiqnsiqlmg*psvlihsmill iqmkmvwdgislhlfiiwismlhllilkk--- ---VGXGIXIPAKEGYXLXKXGXXKTWVKKY*rlsli*ixkaxqxmaexxxkxrf

  12. Airline Service Quality Performance 234 (On-Time performance data).

    Science.gov (United States)

    2011-07-01

    This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled service ...

  13. Airline Service Quality Performance 234 (On-Time performance data).

    Science.gov (United States)

    2012-01-01

    This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled service ...

  14. Ethyl 2-[3-(4-nitrobenzoylthioureido]benzoate

    Directory of Open Access Journals (Sweden)

    Sohail Saeed

    2010-04-01

    Full Text Available In the title compound, C17H15N3O5S, the nitro and thioureido groups are twisted by 7.2 (7 and 21.4 (2°, respectively, from the nitrobenzene ring plane whereas the thioureido and the ethyl ester group make dihedral angles of 43.0 (1 and 18.0 (2°, respectively, with the benzene rings to which they are attached. Intramolecular N—H...O hydrogen-bonding interactions are observed. In the crystal, intermolecular N—H...O hydrogen bonds connect the molecules into chains running along the a axis.

  15. 32 CFR 234.17 - Vehicles and traffic safety.

    Science.gov (United States)

    2010-07-01

    ... open container. (2) Carrying or storing a bottle, can, or other receptacle containing an alcoholic beverage that is open or has been opened, or whose seal is broken, or the contents of which have been... alcohol, drug, and controlled substance content. (ii) Refusal by an operator to submit to a test is...

  16. Dicty_cDB: SSI234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 96 1e-18 U13853_1( U13853 |pid:none) pGEX-4T1 cloning vector, complete sequ... 89 1e-16 U85201_1( U85201...comple... 89 1e-16 FJ526990_1( FJ526990 |pid:none) Cloning vector pEG(KT), complete s... 89 1e-16 protein

  17. NO REWARD BUT HONOUR? 23/4 7993

    African Journals Online (AJOL)

    Cameronians (Scottish Rifles ) ten tye van die ontbinding daarvan. Hy was daarna verbonde aan die Queen's. Own. Highlanders. (Seaforth en. Camerons), die Universiteit van Edin- burgh en 1ste Battaljon 52 Lowland Vol- unteers. Nadat hy in 1972afgetree het, was hy een van die eienaars van 'n ho- tel in Wallis. Deesdae ...

  18. All projects related to | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: LABOUR MARKET, YOUTH UNEMPLOYMENT, SMALL ENTERPRISES, MEDIUM ENTERPRISES, GENDER ANALYSIS, LABOUR POLICY. Region: South of Sahara, Angola, Botswana, Ethiopia, Ghana, Malawi, Namibia, Nigeria, Uganda, Zambia, South Africa. Program: Employment and Growth. Total Funding: CA$ ...

  19. 48 CFR 52.234-4 - Earned Value Management System.

    Science.gov (United States)

    2010-10-01

    ...) that has been determined by the Cognizant Federal Agency (CFA) to be compliant with the guidelines in..., at the time of award, the Contractor's EVM System has not been determined by the CFA as complying...) Unless a waiver is granted by the CFA, Contractor proposed EVMS changes require approval of the CFA prior...

  20. Publications | Page 234 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  1. Chemometrics-assisted spectrophotometric method for simultaneous determination of Pb²⁺ and Cu²⁺ ions in different foodstuffs, soil and water samples using 2-benzylspiro [isoindoline-1,5'-oxazolidine]-2',3,4'-trione using continuous wavelet transformation and partial least squares - calculation of pKf of complexes with rank annihilation factor analysis.

    Science.gov (United States)

    Abbasi Tarighat, Maryam; Nabavi, Masoume; Mohammadizadeh, Mohammad Reza

    2015-06-15

    A new multi-component analysis method based on zero-crossing point-continuous wavelet transformation (CWT) was developed for simultaneous spectrophotometric determination of Cu(2+) and Pb(2+) ions based on the complex formation with 2-benzyl espiro[isoindoline-1,5 oxasolidine]-2,3,4 trione (BSIIOT). The absorption spectra were evaluated with respect to synthetic ligand concentration, time of complexation and pH. Therefore according the absorbance values, 0.015 mmol L(-1) BSIIOT, 10 min after mixing and pH 8.0 were used as optimum values. The complex formation between BSIIOT ligand and the cations Cu(2+) and Pb(2+) by application of rank annihilation factor analysis (RAFA) were investigated. Daubechies-4 (db4), discrete Meyer (dmey), Morlet (morl) and Symlet-8 (sym8) continuous wavelet transforms for signal treatments were found to be suitable among the wavelet families. The applicability of new synthetic ligand and selected mother wavelets were used for the simultaneous determination of strongly overlapped spectra of species without using any pre-chemical treatment. Therefore, CWT signals together with zero crossing technique were directly applied to the overlapping absorption spectra of Cu(2+) and Pb(2+). The calibration graphs for estimation of Pb(2+) and Cu (2+)were obtained by measuring the CWT amplitudes at zero crossing points for Cu(2+) and Pb(2+) at the wavelet domain, respectively. The proposed method was validated by simultaneous determination of Cu(2+) and Pb(2+) ions in red beans, walnut, rice, tea and soil samples. The obtained results of samples with proposed method have been compared with those predicted by partial least squares (PLS) and flame atomic absorption spectrophotometry (FAAS). Copyright © 2015 Elsevier B.V. All rights reserved.

  2. Uniform mixing of antiferromagnetism and high- Tc superconductivity in multilayer copper oxides Ba2Can-1CunO2nF2 (n=2,3,4) with apical fluorines: C63u-NMR/NQR and F19-NMR studies

    Science.gov (United States)

    Shimizu, S.; Sakaguchi, T.; Mukuda, H.; Kitaoka, Y.; Shirage, P. M.; Kodama, Y.; Iyo, A.

    2009-02-01

    We report C63u-NMR/NQR and F19-NMR studies on the multilayered high- Tc copper oxides Ba2Can-1CunO2nF2 with n=2,3,4 , where n is the number of CuO2 planes. It is revealed that bilayered Ba2CaCu2O4F2 is an underdoped superconductor with hole carriers, which are introduced into CuO2 planes by an unexpected deviation from the nominal content of apical fluorines. In a previous paper, we proposed a self-doping mechanism as the origin of carrier doping in n=3 and n=4 ; in the mechanism, electrons are transferred from the inner CuO2 plane (IP) to the outer one (OP). However, since it has been found that the bilayered compound is hole doped, we have re-examined the superconducting and magnetic properties in n=3 and n=4 by C63u-NMR/NQR and F19-NMR . The extensive NMR studies have confirmed that the apical-fluorine compounds are not self-doped but hole doped and that antiferromagnetism (AFM) and superconductivity (SC) coexist in a single CuO2 plane. In n=4 , the AFM ordering occurs at TN=80K well above Tc=55K , where the respective AFM moments are MAFM=0.11μB and 0.18μB at the OP and the IP. In n=3 , on the other hand, the underdoped single IP exhibits a spontaneous moment MAFM=0.12μB at low temperatures and a peak in the nuclear-spin-lattice relaxation rate 1/T1 of F19 at TN=23K much lower than Tc=76K . We note that the increase in the number of IPs from one to two results in the strengthening of the interlayer coupling; TN increases as the interlayer coupling becomes stronger, although the doping levels for both compounds are comparable. Consequently, we conclude that the uniform mixing of AFM and SC is a general property inherent to a single CuO2 plane in an underdoped regime for hole doping. This conclusion incorporates the angle-resolved photoemission spectroscopy results on the n=4 compound [Chen , Phys. Rev. Lett. 97, 236401 (2006)]; it was found that the two Fermi sheets of the IP and OP are observed and that the SC gap opens at the IP and OP below Tc=55K .

  3. Evaluation of total effective dose due to certain environmentally placed naturally occurring radioactive materials using a procedural adaptation of RESRAD code.

    Science.gov (United States)

    Beauvais, Z S; Thompson, K H; Kearfott, K J

    2009-07-01

    Due to a recent upward trend in the price of uranium and subsequent increased interest in uranium mining, accurate modeling of baseline dose from environmental sources of radioactivity is of increasing interest. Residual radioactivity model and code (RESRAD) is a program used to model environmental movement and calculate the dose due to the inhalation, ingestion, and exposure to radioactive materials following a placement. This paper presents a novel use of RESRAD for the calculation of dose from non-enhanced, or ancient, naturally occurring radioactive material (NORM). In order to use RESRAD to calculate the total effective dose (TED) due to ancient NORM, a procedural adaptation was developed to negate the effects of time progressive distribution of radioactive materials. A dose due to United States' average concentrations of uranium, actinium, and thorium series radionuclides was then calculated. For adults exposed in a residential setting and assumed to eat significant amounts of food grown in NORM concentrated areas, the annual dose due to national average NORM concentrations was 0.935 mSv y(-1). A set of environmental dose factors were calculated for simple estimation of dose from uranium, thorium, and actinium series radionuclides for various age groups and exposure scenarios as a function of elemental uranium and thorium activity concentrations in groundwater and soil. The values of these factors for uranium were lowest for an adult exposed in an industrial setting: 0.00476 microSv kg Bq(-1) y(-1) for soil and 0.00596 microSv m(3) Bq(-1) y(-1) for water (assuming a 1:1 234U:238U activity ratio in water). The uranium factors were highest for infants exposed in a residential setting and assumed to ingest food grown onsite: 34.8 microSv kg Bq(-1) y(-1) in soil and 13.0 microSv m(3) Bq(-1) y(-1) in water.

  4. Разработка Култукского сейсмопрогностического полигона: вариации ( 234U/ 238U) и 87Sr/ 86Sr в подземных водах из активных разломов западного побережья Байкала

    OpenAIRE

    РАССКАЗОВ СЕРГЕЙ ВАСИЛЬЕВИЧ; ЧЕБЫКИН ЕВГЕНИЙ ПАВЛОВИЧ; ИЛЬЯСОВА АЙГУЛЬ МАРАТОВНА; ВОДНЕВА ЕЛЕНА НИКОЛАЕВНА; ЧУВАШОВА ИРИНА СЕРГЕЕВНА; БОРНЯКОВ СЕРГЕЙ АЛЕКСАНДРОВИЧ; СЕМИНСКИЙ АЛЕКСАНДР КОНСТАНТИНОВИЧ; СНОПКОВ СЕРГЕЙ ВИКТОРОВИЧ; ЧЕЧЕЛЬНИЦКИЙ ВЛАДИМИР ВАСИЛЬЕВИЧ; ГИЛЁВА НАДЕЖДА АЛЕКСЕЕВНА

    2015-01-01

    Введение. Для отслеживания текущих деформаций в зонах активных разломов перспективны определения ( 234U/ 238U) в подземных водах (скобки обозначают единицы активности). Циклическое равновесие отношения активностей 234U/ 238U≈( 234U/ 238U)≈γ≈1 соответствует атомному отношению ≈5.47×10 -5. Вариации этого параметра могут быть обусловлены эффектом Чалова-Чердынцева обогащением подземных вод нуклидом 234U в результате деформаций пород [ Cherdyntsev, 1969, 1973; Chalov, 1975; Chalov et al., 1990; F...

  5. 45 CFR 234.130 - Assistance in the form of institutional services in intermediate care facilities.

    Science.gov (United States)

    2010-10-01

    ... responsibility, within the State agency, with one or more staff members with sufficient staff time exclusive of other duties to direct and guide the agency's activities with respect to services in intermediate care... supervision of a physician with participation by a registered professional nurse and other appropriate medical...

  6. Report on the Evaluation Results of the Course "Mechanic Undercarriage Leopard 2"

    Science.gov (United States)

    1998-01-14

    Evaluatiemodel 14 3.2 Methoden van gegevensverzameling 17 3.2.1 Vragenlijsten 17 3.2.2 Observaties 19 3.2.3 Toetsen 20 3.3 Evaluatiestappen 20 3.3.1...cijfers kan worden gemaakt is dat het empirisch bewijsmateriaal voor deze "geschatte percentages" op zijn minst schaars is. Hoewel men twijfels kan...voorstaande indeling is gekozen omdat deze indeling handvatten biedt om naar de praktijk te kijken. Het biedt een raamwerk voor het kiezen van methoden en het

  7. 40 CFR 421.234 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new... Maximum for monthly average mg/kg (pounds per million pounds) of copper, nickel, and cobalt in the crushed... Total suspended solids 1.155 0.924 pH 1 1 1 Within the range of 7.5 to 10.0 at all times. (b) Nickel...

  8. 234. Tratamiento de la Mediastinitis y Las Dehiscencias Esternales Complejas Mediante Osteosíntesis Costal

    Directory of Open Access Journals (Sweden)

    A. Bermúdez García

    2012-04-01

    Conclusiones: la osteosíntesis en cirugía cardíaca se muestra como una alternativa segura aun en casos de infección local profunda de la herida, tras terapia de aspiración continua (VAC con buenos resultados, y se trata de una técnica sencilla donde lo más importante es la elección del momento óptimo para la intervención de cada paciente.

  9. The four-fermion interaction in D=2,3,4: a nonperturbative treatment

    OpenAIRE

    Rochev, V. E.; Saponov, P. A.

    1997-01-01

    A new nonperturbative approach is used to investigate the Gross-Neveu model of four fermion interaction in the space-time dimensions 2, 3 and 4, the number $N$ of inner degrees of freedom being a fixed integer. The spontaneous symmetry breaking is shown to exist in $D=2,3$ and the running coupling constant is calculated. The four dimensional theory seems to be trivial.

  10. Page 1 Sådhand, Vol. 12, Part 3, March 1988, pp. 229–234. (C ...

    Indian Academy of Sciences (India)

    programme. On 21 November 1963 a 2-stage Nike-Apache rocket was successfully launched from Thumba and the Thumba Equatorial Rocket Launching Station. (TERLs) became operational, thereby heralding the dawn of the Indian Space. Programme. The Indian Space Research Organisation (ISRO) came into being in.

  11. 5-(4-Bromophenyl-2-(3,4-methylenedioxyphenyl-3-methylsulfanyl-1-benzofuran

    Directory of Open Access Journals (Sweden)

    Hong Dae Choi

    2009-10-01

    Full Text Available The title compound, C22H15BrO3S, crystallizes with four molecules in the asymmetric unit. The 4-bromophenyl rings are rotated out of the benzofuran planes, with dihedral angles for the four molecules of 20.8 (2, 17.8 (2, 23.5 (4 and 23.9 (4°. The dihedral angles between the 3,4-methylenedioxyphenyl ring and the benzofuran plane are 13.5 (2, 7.1 (2, 18.6 (3 and 14.2 (3° in the four molecules. The crystal structure is stabilized by weak nonclassical intermolecular C—H...O hydrogen bonds. The crystal structure also exhibits intermolecular aromatic π–π interactions between the benzene and furan rings and between the 4-bromophenyl and 3,4-methylenedioxyphenyl rings from molecules of the same type; the centroid–centroid distances are 3.92 (1 and 3.79 (1, 3.91 (1, 3.77 (1 and 3.77 (1, and 3.79 (1 and 3.75 (1Å in the four molecules.

  12. Archaeological Data Recovery at 31Dh234, Falls Lake Project, Durham County, North Carolina

    Science.gov (United States)

    1988-12-01

    fir-e- soil or- clay r- ecover -ed fr-om featur-e andIstr-atified contexts will be carefully r-etr-ieved and packaged in discr-ete, wateror-oor container...number" of individual specimens r- ecover -ed fr-on most "litnic- cer’amic scatter" sites, oarticuiar-iy in preser-vation-ooor contexts like eroded piednont

  13. : tous les projets | Page 234 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: PUBLISHING, INTELLECTUAL PROPERTY, COPYRIGHT, ACCESS TO INFORMATION, Internet, STUDENTS. Région: Brazil, South America, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, Far East Asia, South Asia. Programme: Économies en réseaux. Financement ...

  14. Unsuitability of bakery work for a person with atopy: a study of 234 bakery workers.

    Science.gov (United States)

    Järvinen, K A; Pirilä, V; Björksten, F; Keskinen, H; Lehtinen, M; Stubb, S

    1979-03-01

    A disease of the atopic group was established in 25% of bakery employees investigated: 9% had asthma, 25% allergic rhinitis and 5% atopic eczema. The definite role of flour dust as an allergen maintaining asthma was established in 14 of 21 bakery employees with asthma. The onset of asthma in bakery work occurred after an average of 4.2 years of exposure to flour dust. The study revealed that 71% of the bakers suffering from an atopic disease had close relations with a history of atopic disease, whereas the corresponding percentage for the healthy group was 17. The results indicated that no person with current atopic disease or earlier signs of one should be given employment in the bakery branch. A relative bar to employment appears to be also the occurrence of these forms of diseases in the applicant's close relations.

  15. 77 FR 234 - Rule Concerning Disclosures Regarding Energy Consumption and Water Use of Certain Home Appliances...

    Science.gov (United States)

    2012-01-04

    ... Certain Home Appliances and Other Products Required Under the Energy Policy and Conservation Act (``Appliance Labeling Rule'') AGENCY: Federal Trade Commission. ACTION: Extension of comment period. SUMMARY...

  16. 14 CFR 234.8 - Calculation of on-time performance codes.

    Science.gov (United States)

    2010-01-01

    ... reportable flight, except those scheduled to operate three times or less during a month. In addition, each reporting carrier shall assign an on-time performance code to each of its single plane one-stop or multi-stop flights, or portion thereof, that the carrier holds out to the public through a CRS, the last...

  17. 49 CFR 234.205 - Operating characteristics of warning system apparatus.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Operating characteristics of warning system... characteristics of warning system apparatus. Operating characteristics of electromagnetic, electronic, or... limits within which the system is designed to operate. ...

  18. Onaism: An Artistic Model of Yoruba Civilization in Nigeria (Pp. 234 ...

    African Journals Online (AJOL)

    FIRST LADY

    Abstract. This paper focuses on Ona stylistic tendency as an artistic model of Yoruba civilization in Nigeria. The quest to carve an identity led to series of experiments with diverse motifs and idioms in order to create art works reflecting our traditional setting. The Ona artistic movement is one of the many fruits or harvest ...

  19. 49 CFR 234.267 - Insulation resistance tests, wires in trunking and cables.

    Science.gov (United States)

    2010-10-01

    ... be made between all conductors and ground, between conductors in each multiple conductor cable, and between conductors in trunking. Insulation resistance tests shall be performed when wires, cables, and... be made annually. (d) A circuit with a conductor having an insulation resistance of less than 200,000...

  20. 00001:Airline Service Quality Performance 234 (On-Time performance data).

    Science.gov (United States)

    2014-02-01

    00001:This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled se...

  1. Accidental nuclear excursion recuplex operation 234-5 facility: Final medical report

    Energy Technology Data Exchange (ETDEWEB)

    Fuqua, P. A.

    1962-04-07

    The April 7, 1962 criticality accident involving human exposures was the first to have occurred in any production facility at Hanford. The accidental nuclear excursion did not result in any mechanical damage or spread of contamination. Three employees received over-exposure to gamma and neutron radiation. None were fatally exposed and in each case the over-exposure was recognized promptly. Following an initial period of medical observation and testing, the men were released to work. They continued to be followed clinically. Clinical studies performed were hematological procedures including leukocyte chromosome aberrations, morphologically aberrant blood cells, bone marrow evaluations, blood chemistry determinations, amino acid excretion studies, seminal fluid, urinary gonadotropins and estrogen excretion studies, testicular biopsies and crystalline lens examinations. These studies, along with a brief description of the accident and of the dosimetry, are summarized in this report by those participating in the studies. In view of the dose ranges received in these cases, both the negative and positive findings are considered to be of unusual interest due to the lack of knowledge of effects following human exposures at these levels.

  2. Whole-genome sequencing of 234 bulls facilitates mapping of monogenic and complex traits in cattle

    DEFF Research Database (Denmark)

    Daetwyler, Hans D; Capitan, Aurélien; Pausch, Hubert

    2014-01-01

    The 1000 bull genomes project supports the goal of accelerating the rates of genetic gain in domestic cattle while at the same time considering animal health and welfare by providing the annotated sequence variants and genotypes of key ancestor bulls. In the first phase of the 1000 bull genomes p...

  3. 4,5,6,7-Tetrachloro-N-(2,3,4-trifluorophenylphthalimide

    Directory of Open Access Journals (Sweden)

    Yin-Jun Zhang

    2011-07-01

    Full Text Available The asymmetric unit of the title compound, C14H2Cl4F3NO2, contains two independent molecules. In each molecule, the phthalimide ring system is nearly planar [maximum atomic deviation = 0.031 (2 or 0.038 (2 Å] and oriented with respect to the benzene ring at 65.04 (7 or 71.76 (10°. Weak intermolecular C—H...O and C—H...F hydrogen bonding is present in the crystal structure.

  4. 21 CFR 1.234 - How and when do you update your facility's registration information?

    Science.gov (United States)

    2010-04-01

    ... access to the Internet through any of the methods described in § 1.231(a)), you may update your facility... through any of the methods provided under § 1.231(a), you may update your facilities' registrations by CD-ROM. (1) Registrants submitting their updates in CD-ROM format must use ISO 9660 (CD-R or CD-RW) data...

  5. 2-[3-(4-Methoxyphenyl-1-phenyl-1H-pyrazol-5-yl]phenol

    Directory of Open Access Journals (Sweden)

    2009-03-01

    Full Text Available The title compound, C22H18N2O2, was derived from 1-(2-hydroxyphenyl-3-(4-methoxyphenylpropane-1,3-dione. The central pyrazole ring forms dihedral angles of 16.83 (5, 48.97 (4 and 51.68 (4°, respectively, with the methoxyphenyl, phenyl and hydroxyphenyl rings. The crystal packing is stabilized by O—H...N hydrogen bonding.

  6. Editorial Revista Contaduría y Administración No. 234

    OpenAIRE

    López Herrera Francisco; Garcia Narvaez Alberto

    2011-01-01

    En un contexto de fuerte competencia, el análisis minucioso y preciso de las relaciones mercado-producto es un elemento indispensable para el diseño de estrategias de mercado que puedan contar con buenas probabilidades de éxito. Johan H. Martínez, Hugo Alberto Rivera R., Carlos E. Maldonado y Rubén Iván A. Mendoza presentan su trabajo de investigación Adquisición de ventajas competitivas mediante la generación de un territorio estratégico. En él se muestra la propuesta mediante la cual dichos...

  7. Characteristics of 234 dog bite incidents in Ireland during 2004 and 2005.

    Science.gov (United States)

    O'Sullivan, E N; Jones, B R; O'Sullivan, K; Hanlon, A J

    2008-07-12

    Information was obtained by telephone interview from 100 dog owners whose dog had bitten a person, and from 134 victims of bites by a dog not owned by the victim. Three-quarters of the victims were female and aged from 21 to 60 years. The majority of the dogs were owned, male, two to six years old, over 10 kg in bodyweight and belonged to the popular breeds: collies, cocker/springer spaniels, terrier breeds, Jack Russell terriers, German shepherd dogs, golden retrievers and crossbreeds. The numbers of bites by the different breeds indicated that those that inflicted the most bites were the popular breeds rather than the breeds with any greater propensity to bite. Most attacks were rapid single bites and in 50 per cent of the cases, neither the owner nor the victim was able to identify any signal of the dog's intention to bite. Overall, 21 per cent of the incidents were rated as 'serious' and 2 per cent as 'life threatening'. One fifth of the dogs were euthanased as a result of the incident. Half the incidents required professional medical assistance for the victim. Almost half the incidents took place while the victim was walking or passing close to the dog's territory, or while the victim was interacting with the dog at home.

  8. Assessing the durability of concrete regarding ASR[ACI SP-234-15

    Energy Technology Data Exchange (ETDEWEB)

    Stark, J.; Giebson, C. [Bauhaus Univ., Weimar (Germany). F.A. Finger-Inst. for Building Materials Sciences

    2006-07-01

    Damages on concrete structures caused by alkali-aggregate reaction (AAR) were discussed. In Germany, the first damage caused by the alkali-silica reaction (ASR) occurred on a bridge that was built in 1964 and which had to be demolished in 1968 due to the loss of structural stability. As a result of intensive research into the cause of damage, the first Alkali-Guideline was published in 1974 by the German Committee for Reinforced Concrete. The guideline made it possible to classify alkali-reactive aggregates which contained opaline sandstone and flint. In order to prevent deleterious ASR, the guidelines proposed clear measures for moisture, external alkali supply and cement content. The guidelines were revised many times over the past decades to include other rock type aggregates that also posed problems. The guideline is going to be revised one more time to include testing methods that assess the influence of an external alkali supply, such as de-icing solutions, for pavement concretes. The cyclic climate storage was used and proved as an appropriate method. It was concluded that the new mortar bar test and cyclic climate storage represent more opportunities to assess the durability of concretes regarding ASR due to alkali-reactive slow/late aggregates. 17 refs., 2 tabs., 11 figs.

  9. {sup 234}Th as tracer of organic carbon export in Bransfield Strait, Antarctic

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Joselene de; Vieira, Lucia Helena, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), SP (Brazil). Gerencia de Metrologia das Radiacoes. Lab. de Radiometria Ambiental; Braga, Elisabete de Santis, E-mail: edsbraga@usp.br [Instituto Oceanografico da Universidade de Sao Paulo, SP (Brazil); Duarte, Celina Lopes, E-mail: clduarte@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), SP (Brazil). Centro de Tecnologia das Radiacoes

    2011-07-01

    The element thorium has multiple isotopes that have emerged collectively as a powerful set of tracers for particle associated processes in the oceans. The production of 2{sup 34T}h from 2{sup 38U}, coupled with the conservative behavior of 2{sup 38U} in seawater, makes the source of 2{sup 34T}h easy to characterize. Because of its very particle reactive behavior, 2{sup 34T}h is removed from a parcel of water in only two ways, through decay and through particle flux. Therefore, a steady-state 1D activity balance can be used to calculate its flux. This work presents results of a collaborative research on organic carbon fluxes distribution in the Bransfield Strait. Macro-nutrients, micro nutrients and chlorophyll-a distributions were used to examine the pathway sources. 2{sup 34T}h was used as a tracer of organic carbon fluxes distribution in the Bransfield Strait in order to evaluate its influence in the CO{sub 2} drawdown, since POC export via sinking particles is the primary mechanism of carbon sequestration in the Southern Ocean. Fluxes up to 15274 dmp m-2 d-1 were estimated, the highest value observed in Station 09 at 794 m depth. POC exported fluxes derived from the disequilibrium 2{sup 34T}h/ 2{sup 38U} model varied from 0.6 to 16000 mmol C m{sup -2} d{sup -1}. (author)

  10. 14 CFR 234.4 - Reporting of on-time performance.

    Science.gov (United States)

    2010-01-01

    ... should use the following codes to identify causes for cancelled flights: Code A—Air Carrier B—Extreme... broad set of conditions: weather-non-extreme, airport operations, heavy traffic volume, air traffic... equipment or a breech of security that causes the evacuation of the airport or individual concourses, or the...

  11. Dichlorido{2-[(3,4-dimethylphenyliminomethyl]pyridine-κ2N,N′}copper(II

    Directory of Open Access Journals (Sweden)

    Mehdi Khalaj

    2011-11-01

    Full Text Available In the title complex, [CuCl2(C14H14N2], the CuII atom exhibits a very distorted tetrahedral coordination geometry involving two chloride ions and two N-atom donors from the Schiff base ligand. The range for the six bond angles about the Cu2+ cation is 81.49 (11–145.95 (9°. The chelate ring including the CuII atom is approximately planar, with a maximum deviation of 0.039 (4 Å for one of the C atoms; this plane forms a dihedral angle of 46.69 (9° with the CuCl2 plane.

  12. Исследование фракционирования изотопов урана (234U, 238U) в процессе образования кристаллов льда

    OpenAIRE

    ЯКОВЛЕВ Е.Ю.; КИСЕЛЁВ Г.П.; ДРУЖИНИН С.В.; ЗЫКОВ С.Б.

    2016-01-01

    С момента открытия явления фракционирования четных изотопов урана (эффект Чердынцева-Чалова) среди ряда исследователей сложилось устойчивое убеждение, что разделения изотопной пары урана 234U и 238U в минеральных системах не происходит, и фракционирование возможно только при переходе из твердой фазы в жидкую по причине различной подвижности изотопов. Наблюдаемые избытки изотопа 234U в суммарном уране различных минералов и горных пород, возраст которых значительно превышает период установления...

  13. TINGKAT KANDUNGAN UNSUR RADIOAKTIF AIR SUNGAI AYUNG DI DENPASAR BALI

    Directory of Open Access Journals (Sweden)

    Dewa Nyoman Alit Ardana

    2012-11-01

    Full Text Available Ayung river is one of the longest rivers in Bali. The upstream of the river is in regency of Bangli, Badung, Buleleng, Tabananand downstream is located in Padang Galak beach, East Denpasar Sub-regency. As the sample of the study, the water of the river wastaken from the stream entering the city of Denpasar. The sample was taken in five different points and for each point was taken twice. Thefirst was taken at 5 p.m, and the second was at 6 a.m. This study aims at finding out the rate of radioactive content of Ayung river water inthe city of Denpasar.The water sample was analyzed in Radiometry Analysis Group of Radiation Physics and environmental research centre andNuclear Technique Development, Jalan Taman Sari 71 Bandung – 40132. The process of counting was conducted in this place in order toknow the rate of the element activities and then identification of elements contens in the sample. The result of the counting and identifyingwas compered with standard grade of radioactivity in the area.The element of identification result and the amount of activity rate found showed that the element were natural radioactiveelements, the content: 40K (Kalium-40, 234Th (Thorium-234, 233Th (Thorium-233, 228Ac (Actinium-288, 114mIn (Indium-114m. Thehighest activity of radioactive elements in each sample point: in E2 point content element 40K with the activity 2.08 Bq/lt, in point A1 234Thwith the activity 16.34 Bq/lt, in point E1 containts 233Th with activity 598.29 Bq/lt, in point E1 and E2 contain 228Ac with the activity939.63 Bq/lt. The height of activity value of the counting and identifying elements was still under the rate of the highest level.The result of the study showed that radioactive elements 40K had the tendency of increasing radioactivity. The same thinghappened to 233Th at the peak of energi 185.00 keV. The content of its radioactive tends to exist in each point of sample point and theactivity tends to increase. Though the rate of

  14. An aerial radiological survey of the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Hendricks, T J; Riedhauser, S R

    1999-12-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys.

  15. P2-34: Similar Dimensions Underlie Emotional and Conversational Expressions in Korean and German Cultural Contexts

    Directory of Open Access Journals (Sweden)

    Ahyoung Shin

    2012-10-01

    Full Text Available Although facial expressions are one of the most important ways of communication in human society, most studies in the field focus only on the emotional aspect of facial expressions. The communicative/conversational aspects of expressions remain largely neglected. In addition, whereas it is known that there are culturally universal emotional expressions, less is known about how conversational expressions are perceived across cultures. Here, we investigate the underlying dimensions of the complex space of emotional and conversational expressions in a cross-cultural context. For the experiments, we used 620 video sequences of the KU facial expression database (62 expressions of 10 Korean actors, and 540 video sequences of the MPI facial expression database (54 expressions of 10 German actors. Four groups of native German and Korean participants were asked to group the sequences of the German or Korean databases into clusters based on similarity, yielding a fully crossed design across cultural contexts and databases. The confusion matrices created from the grouping data showed similar structure for both databases, but also yielded significantly less confusion for own-culture judgments. Interestingly, multidimensional scaling of the confusion matrices showed that for all four participant groups, two dimensions explained the data sufficiently. Most importantly, post-hoc analyses identified these two dimensions as valence and arousal, respectively, for all cultural contexts and databases. We conclude that although expressions from a familiar background are more effectively grouped, the evaluative dimensions for both German and Korean cultural contexts are exactly the same, showing that cultural universals exist even in this complex space.

  16. Outcome and prognostic factors following curative-intent surgery for oral tumours in dogs: 234 cases (2004 to 2014).

    Science.gov (United States)

    Sarowitz, B N; Davis, G J; Kim, S

    2017-03-01

    To describe the long-term outcomes and prognostic factors associated with curative-intent surgery for oral tumours in a large series of dogs. Retrospective review of records for dogs with oral tumours treated with curative-intent surgery. Data collected included signalment, weight, surgical procedure, lymph node staging results, computed tomography results, tumour size, histopathology results including margin evaluation, complications, adjunctive therapies, local recurrence or metastasis, date and cause of death and owner satisfaction. Median cause-specific survival was shortest for malignant melanoma (206 days) and osteosarcoma (209 days). Local recurrence rate was highest for fibrosarcoma (54·2%) and distant metastatic rate was highest for malignant melanoma (30%). Curative-intent surgery resulted in complete surgical margins in 85·2% of cases. Results suggest tumour type, completeness of excision, tumour size, and age may affect disease-free interval and cause-specific survival. Fibrosarcoma had a higher risk of recurrence compared to other tumour types. © 2017 British Small Animal Veterinary Association.

  17. 77 FR 32711 - 30-Day Notice of Proposed Information Collection: DS-234, Special Immigrant Visa Biodata Form...

    Science.gov (United States)

    2012-06-01

    ... Collection. Originating Office: Bureau of Population, Refugees, and Migration, Office of Admissions (PRM/A... Center of the Bureau of Population, Refugees and Migration. Dated: May 14, 2012. Kelly A. Gauger, Deputy Director, Office of Admissions, Bureau of Population, Refugees, and Migration, Department of State. BILLING...

  18. 2,3,4-Triacetoxy-1-[5-(1,2,3,4-tetraacetoxybutylpyrazin-2-yl]butyl acetate

    Directory of Open Access Journals (Sweden)

    Graeme J. Gainsford

    2008-01-01

    Full Text Available The title compound, C28H36N2O16, was obtained unintentionally in an attempt to synthesize 1,3,4,6-tetra-O-acetyl-2-azido-2-deoxy-d-mannopyranose. The crystal packing utilizes methyl–acetoxy C—H...O and methyl–pyrazine C—H...N hydrogen bonding.

  19. A new Nav1.7 sodium channel mutation I234T in a child with severe pain.

    NARCIS (Netherlands)

    Ahn, H.S.; Dib-Hajj, S.D.; Cox, J.J.; Tyrrell, L.; Elmslie, F.V.; Clarke, A.A.; Drenth, J.P.H.; Woods, C.G.; Waxman, S.G.

    2010-01-01

    Dominant gain-of-function mutations that hyperpolarize activation of the Na(v)1.7 sodium channel have been linked to inherited erythromelalgia (IEM), a disorder characterized by severe pain and redness in the feet and hands in response to mild warmth. Pharmacotherapy remains largely ineffective for

  20. Μελέτη των χαρακτηριστικών της δέσμης νετρονίων και προσδιορισμός παραμέτρων συντονισμού της σύλληψης νετρονίων στο 234U με την μέθοδο της ολικής απορρόφησης, στην πειραματική διάταξη n_TOF του CERN

    CERN Document Server

    Lampoudis, Christos

    At an international level several issues accompany the long-term development of nuclear science and its applications: nuclear waste management, new reactor design, increasingly safety requirements, public acceptance etc. This has triggered many sophisticated R&D activities, such as Accelerator Driven Systems or next generation reactor concepts and enhanced the ongoing effort to expand and improve the existing nuclear data. Among other measurements of special interest, is the neutron capture cross section determination for several isotopes related to the nuclear fuel cycle. This text mainly presents the obtained results from the (n,γ) cross section measurement of 234U that was performed at n_TOF facility (CERN). In detail we describe the main features of the facility, the TAC (Total Absorption Calorimeter) detection arrangement and its performance under specific experimental conditions. Results in the form of R-matrix resonance parameters and cross sections are discussed in parallel with the existing ENDF...

  1. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  2. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  3. In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation

    NARCIS (Netherlands)

    Albers-Wolthers, C H J; de Gier, J|info:eu-repo/dai/nl/304830887; Walen, M; van Kooten, P J S; Lambalk, C B; Leegwater, P A J|info:eu-repo/dai/nl/074236539; Roelen, B A J|info:eu-repo/dai/nl/109291859; Schaefers-Okkens, A C|info:eu-repo/dai/nl/074015265; Rutten, V P M G|info:eu-repo/dai/nl/092848028; Millar, R P M; Kooistra, H S|info:eu-repo/dai/nl/205285864

    2017-01-01

    Kisspeptins (KPs) and their receptor (GPR54 or KiSS1R) play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the

  4. Constraining the calculation of 234,236,238U (n ,γ ) cross sections with measurements of the γ -ray spectra at the DANCE facility

    Science.gov (United States)

    Ullmann, J. L.; Kawano, T.; Baramsai, B.; Bredeweg, T. A.; Couture, A.; Haight, R. C.; Jandel, M.; O'Donnell, J. M.; Rundberg, R. S.; Vieira, D. J.; Wilhelmy, J. B.; Krtička, M.; Becker, J. A.; Chyzh, A.; Wu, C. Y.; Mitchell, G. E.

    2017-08-01

    The cross section for neutron capture in the continuum region has been difficult to calculate accurately. Previous results for 238U show that including an M 1 scissors-mode contribution to the photon strength function resulted in very good agreement between calculation and measurement. This paper extends that analysis to U,236234 by using γ -ray spectra measured with the Detector for Advanced Neutron Capture Experiments (DANCE) at the Los Alamos Neutron Science Center to constrain the photon strength function used to calculate the capture cross section. Calculations using a strong scissors-mode contribution reproduced the measured γ -ray spectra and were in excellent agreement with the reported cross sections for all three isotopes.

  5. The absence of the N-acyl-homoserine-lactone autoinducer synthase genes tral and ngrl increases the copy number of the symbiotic plasmid in Sinorhizobium fredii NGR234

    Science.gov (United States)

    Plant-released flavonoids induce the transcription of symbiotic genes in rhizobia and one of the first bacterial responses is the synthesis of so called Nod factors. They are responsible for the initial root hair curling during onset of root nodule development. This signal exchange is believed to be...

  6. Oral conditions in patients with Sjögren’s Syndrome: a Systematic Review - doi:10.5020/18061230.2006.p234

    Directory of Open Access Journals (Sweden)

    Marina Fernandes de Sena

    2012-01-01

    Full Text Available The aim of this study was to investigate through a systematic review, the oral manifestations of Sjögren’s syndrome. It had as research sources: manual searches in publications, sites and electronic data bases such as MEDLINE, LILACS and BBO. As its inclusion criteria: cross-sectional, case-control and cohort studies which data collection was done by means of clinical indexes for dental caries, periodontal disease and oral mucosa. The selected idioms were: Portuguese, English and Spanish; in the period of 1990 to 2003. Searching strategies used included the following words: Sjögren, dmf, caries, decay, periodontal, plaque and gingivitis. Thirteen studies were selected, one of these in Spanish and the others in English. All delineations were case-control, 54% of these aimed at evaluating the relationship between patients with the syndrome and caries presence, 85% with periodontal disease and 32% relating to the alterations of oral mucosa. The analyzed studies showed that the main symptom of Sjögren’s syndrome is xerostomy and that exist a slight association between syndromic patients and dental caries index and some alterations of oral mucosa and a weak association with periodontal diseases.

  7. Allelic imbalance and cytogenetic deletion of 1p in colorectal adenomas: a target region identified between DIS199 and DIS234

    DEFF Research Database (Denmark)

    Bomme, L; Heim, S; Bardi, G

    1998-01-01

    Both cytogenetic and molecular genetic analyses have shown that many colorectal adenomas carry an acquired deletion distally in the short arm of one chromosome 1, but the two methods have never been brought to bear on the same tumors. The major part of this study was the analysis of 53 previously...... region. This genomic area contains the human homologue of the tumor modifier gene Mom1 (1p35-36.1), which, in mice, modifies the number of intestinal tumors in multiple intestinal neoplasia (Min)-mutated animals. To evaluate whether the imbalances corresponded to interstitial deletions of 1p material, we...... at five of eight microsatellite loci. A comparison of the genetic findings with clinicopathologic data indicated that adenomas in the rectum have 1p abnormalities more often than do adenomas of the sigmoid colon, and that adenomas with 1p changes are larger than adenomas without abnormalities...

  8. Reply to comments by Mastalerz, V. on "Shallow gasoff the Rhône prodelta, Gulf of Lions" Marine Geology 234 (215-231)

    Science.gov (United States)

    Garcia-Garcia, Ana; Orange, Daniel L.; Lorenson, T.D.; Radakovitch, Olivier; Tesi, Tommaso; Miserocchi, Stefano; Berne, Serge; Friend, Patrick; Nittrouer, Chuck; Normand, Alain

    2008-01-01

    We really appreciate the interest and comments regarding our manuscript. We hope we address all the lingering issues in this reply. This also gives us the opportunity of publishing an update on our dataset that will complete the original manuscript (see Table 1). We have followed the author pattern in our answers: 1-Gas sampling procedure, 2-Reported gas concentrations results, 3-General remarks, 4-Conclusions.

  9. 234. Implantación trans apical de válvula aórtica: excelentes resultados en pacientes de alto riesgo

    Directory of Open Access Journals (Sweden)

    T.E. Chávez

    2010-01-01

    Conclusiones: La técnica de recambio transapical de válvulas aórticas reduce significativamente el riesgo operatorio en pacientes de alto riesgo en comparación con el método convencional de recambio valvular aórtico.

  10. Largest Earthquakes Induced During the Hydraulic Stimulation of Wells GPK2-3-4 at the Geothermal Site of Soultz-Sous-Forets (FRANCE)

    Science.gov (United States)

    Charlety, J.; Cuenot, N.; Dorbath, L.; Dorbath, C.; Haessler, H.; Frogneux, M.

    2005-12-01

    During the five last years, four hydraulic stimulations were carried out at the geothermal site of Soultz-sous-Forêts (France). In order to monitor the seismic activity induced by the massive injection of fluid, we have installed for each stimulation a surface seismic network composed of at least 13 seismological stations. Every hydraulic experiment has induced more than 3000 micro-earthquakes. A large part of them has been processed automatically in order to follow the large scale structure of the geothermal reservoir. In this study, we present and analyse the microseismic activity of magnitude, M_d, from 1.4 to 2.9. These values correspond to the least magnitude felt by the population and the largest seismic event ever produced since the beginning of the project in 1987, respectively. For this range of magnitude, the micro-earthquakes have been manually picked in order to have a higher precision. This analysis is thus achieved via the location and the focal mechanism of each event. We will point out the view of the seismic activity based on the data from the surface seismological network. We propose a comparison of the behaviour of the large magnitude seismicity during these four stimulations and bring out the common trends. The results clearly show the role of the large structures on the circulation of the fluid within the reservoir. Consequently the behaviour of the heat exchanger is mainly ruled by pre-existing tectonic structures. However the real influence of the fluid on the generation of large seismic event is still misunderstood but our observations can give some informative clues.

  11. SU-F-T-234: Quality Improvements in the Electronic Medical Record of Patients Treated with High Dose-Rate Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Diener, T [Cleveland State University, Cleveland, OH (United States); Wilkinson, D [Cleveland Clinic Foundation, Cleveland, OH (United States)

    2016-06-15

    Purpose: To improve workflow efficiency and patient safety by assessing the quality control documentation for HDR brachytherapy within our Electronic Medical Record System (Mosaiq). Methods: A list of parameters based on NRC regulations, our quality management program (QMP), recommendations of the ACR and the American Brachytherapy Society, and HDR treatment planning risks identified in our previous FMEA study was made. Next, the parameter entries were classified according to the type of data input—manual, electronic, or both. Manual entry included the electronic Brachytherapy Treatment Record (BTR) and pre-treatment Mosaiq Assessments list. Oncentra Treatment Reports (OTR) from the Oncentra Treatment Control System constituted the electronic data. The OTR includes a Pre-treatment Report for each fraction, and a Treatment Summary Report at the completion of treatment. Each entry was then examined for appropriateness and completeness of data; adjustments and additions as necessary were then made. Results: Ten out of twenty-one recorded treatment parameters were identified to be documented within both the BTR and OTR. Of these ten redundancies, eight were changed from recorded values to a simple checklist in the BTR to avoid recording errors. The other redundancies were kept in both documents due to their value to ensuring patient safety. An edit was made to the current BTR quality assessment; this change revises the definition of a medical event in accordance with ODH Regulation 3701:1-58-101. One addition was made to the current QMP documents regarding HDR. This addition requires a physician to be present through the duration of HDR treatment in accordance with ODH Regulation 3701:1-58-59; Paragraph (F); Section (2); Subsection (a). Conclusion: Careful examination of HDR documentation that originates from different sources can help to improve the accuracy and reliability of the documents. In addition, there may be a small improvement in efficiency due to elimination of unnecessary redundancies.

  12. The Impact of Social Institutions on the Economic Role of Women in Developing Countries. OECD Development Centre Working Paper No. 234

    Science.gov (United States)

    Morrisson, Christian; Jutting, Johannes

    2004-01-01

    Donor agencies and policy makers tend to agree that increased access of women to education, health, credit, formal legal rights and employment opportunities, in conjunction with economic growth, will substantially improve the socio-economic role of women in developing countries. This paper challenges that view. It argues that these measures might…

  13. Design procedures for the use of composites in strengthening of reinforced concrete structures state-of-the-art report of the RILEM Technical Committee 234-DUC

    CERN Document Server

    Sena-Cruz, José

    2016-01-01

    This book analyses the current knowledge on structural behaviour of RC elements and structures strengthened with composite materials (experimental, analytical and numerical approaches for EBR and NSM), particularly in relation to the above topics, and the comparison of the predictions of the current available codes/recommendations/guidelines with selected experimental results. The book shows possible critical issues (discrepancies, lacunae, relevant parameters, test procedures, etc.) related to current code predictions or to evaluate their reliability, in order to develop more uniform methods and basic rules for design and control of FRP strengthened RC structures. General problems/critical issues are clarified on the basis of the actual experiences, detect discrepancies in existing codes, lacunae in knowledge and, concerning these identified subjects, provide proposals for improvements. The book will help to contribute to promote and consolidate a more qualified and conscious approach towards rehabilitation...

  14. A concise route to branched erythrono-gamma-lactones. Synthesis of the leaf-closing substance potassium (+/-)-(2R,3R)-2,3,4-trihydroxy-2-methylbutanoate

    DEFF Research Database (Denmark)

    Pedersen, Daniel Sejer; Robinson, Tony V; Taylor, Dennis K

    2009-01-01

    A series of 1,2-dioxanes 3 were ring-opened with Co(SALEN)(2) to furnish lactol regioisomers 4 and 5 (86-99% yield). The lactols were oxidized to gamma-lactones 8 and 9 (72-96% yield) and deprotected to afford the 2-C- and 3-C-alkyl and aryl branched erythrono-gamma-lactones 1, 6, and 7 (65-94% y...

  15. The Prediction of Consumer Buying Intentions: A Comparative Study of the Predictive Efficacy of Two Attitudinal Models. Faculty Working Paper No. 234.

    Science.gov (United States)

    Bhagat, Rabi S.; And Others

    The role of attitudes in the conduct of buyer behavior is examined in the context of two competitive models of attitude structure and attitude-behavior relationship. Specifically, the objectives of the study were to compare the Fishbein and Sheth models on the criteria of predictive as well as cross validities. Data on both the models were…

  16. Operations Support of Phase 2 Integrated Demonstration In Situ Bioremediation. Volume 2, Final report: Data in tabular form, Disks 2,3,4

    Energy Technology Data Exchange (ETDEWEB)

    Hazen, T.C. [Westinghouse Savannah River Co., Aiken, SC (United States)

    1993-09-01

    This document consists solely of data acquired during phase 2 of the integrated demonstration project concerning in situ bioremediation performed at the Savannah River Site, Aiken, South Carolina. The data is presented in tabular form.

  17. Ethyl 2-(3,4-dimethyl-5,5-dioxo-1H,4H-benzo[e]pyrazolo[4,3-c][1,2]thiazin-1-ylacetate

    Directory of Open Access Journals (Sweden)

    Sana Aslam

    2012-10-01

    Full Text Available In the title molecule, C15H17N3O4S, the heterocyclic thiazine ring adopts a twist-boat conformation, which differs from that in related compounds, with adjacent S and C atoms displaced by 0.981 (4 and 0.413 (5 Å, respectively, on the same side of the mean plane formed by the remaining ring atoms. The mean plane of the benzene ring makes a dihedral angle of 23.43 (14° with the mean plane of the pyrazole ring. In the crystal, molecules are connected by weak C—H...O hydrogen bonds to form a three-dimensional network. The H atoms of the methyl group attached to the pyrazole ring were refined over six sites with equal occupancies.

  18. Pre-wetted lightweight coarse aggregate reduces long-term deformations of high-performance lightweight concrete[ACI SP-234-41

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, M. [Chile Catholic Pontifica Univ. (Chile). School of Civil Engineering]|[Georgia Inst. of Technology, Atlanta, GA (United States). School of Civil and Environmental Engineering; Kurtis, K.E.; Kahn, L.F. [Georgia Inst. of Technology, Atlanta, GA (United States). School of Civil and Environmental Engineering

    2006-07-01

    High performance lightweight concrete (HPLC) refers to concretes that have the characteristics of both high performance concrete and structural lightweight concrete. HPLC has advantages from the synergy between its two predecessors. The advantages include improvement in elastic compatibility between aggregate and cementitious matrix which leads to reduced microcracking in the interface zone; improvement in cement hydration due to internal curing; and reduction in autogenous shrinkage of the cement matrix. Although extensive studies on HPLC durability, compressive strength and shrinkage have been carried out, the creep of HPLC and the influence of internal curing on creep of HPLC remain unknown. For that reason, this study focused on creep and shrinkage results and analysis. The use of HPLC in prestressed bridge girders can extend the length of the bridge girders by 15 to 20 per cent. Long-term creep and shrinkage deformations are of particular interest in understanding the implications of using lightweight aggregate on prestressing losses. In this study, creep was measured on 45 specimens stored at 50 per cent relative humidity and 23 degrees C for a period of 120 days. Fifteen cylindrical specimens were cast from each of 3 mixtures under study. In addition, 30 specimens were used as companion shrinkage specimens. The study compared creep and shrinkage behaviour of various specimens, as well as creep and shrinkage behaviour with loading and drying starting at the age of 24 hours and at 28 days. The total time dependent deformations with loading and drying starting at the age of 24 hours and at 28 days were also examined. Preliminary results on the reported concrete mixtures indicate lower long-term deformation for HPLC compared to high performance concrete. The results confirm observations in literature that the water initially stored in the aggregate is released over time and reduces the long-term duration of the HPLC. It was noted that the creep and shrinkage of high performance concrete mixtures may vary widely depending on the aggregates, supplementary cementitious materials, and admixtures. It was suggested that future studies should focus on measuring changes in internal relative humidity in sealed and unsealed specimens produced with pre-wetted and air-dried lightweight aggregate and normal weight aggregate under loading and drying conditions. 50 refs., 4 tabs., 5 figs.

  19. Crystal structure of benzyl (E)-2-(3,4-di-meth-oxy-benzyl-idene)hydrazine-1-carbodi-thio-ate.

    Science.gov (United States)

    Tan, Yew-Fung; Break, Mohammed Khaled Bin; Tahir, M Ibrahim M; Khoo, Teng-Jin

    2015-02-01

    The title compound, C17H18N2O2S2, synthesized via a condensation reaction between S-benzyl di-thio-carbazate and 3,4-di-meth-oxy-benzaldehyde, crystallized with two independent mol-ecules (A and B) in the asymmetric unit. Both mol-ecules have an L-shape but differ in the orientation of the benzyl ring with respect to the 3,4-di-meth-oxy-benzyl-idine ring, this dihedral angle is 65.59 (8)° in mol-ecule A and 73.10 (8)° in mol-ecule B. In the crystal, the A and B mol-ecules are linked via pairs of N-H⋯S hydrogen bonds, forming dimers with an R 2 (2)(8) ring motif. The dimers are linked via pairs of C-H⋯O hydrogen bonds, giving inversion dimers of dimers. These units are linked by C-H⋯π inter-actions, forming ribbons propagating in the [100] direction.

  20. Gamma-Ray Emission Spectra as a Constraint on Calculations of 234,236,238U Neutron-Capture Cross Sections

    Energy Technology Data Exchange (ETDEWEB)

    Ullmann, John Leonard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kawano, Toshihiko [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bredeweg, Todd Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Baramsai, Bayarbadrakh [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Couture, Aaron Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Haight, Robert Cameron [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jandel, Marian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mosby, Shea Morgan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); O' Donnell, John M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rundberg, Robert S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vieira, David J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wilhelmy, Jerry B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Becker, John A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wu, Ching-Yen [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Krticka, Milan [Charles Univ., Prague (Czech Republic)

    2015-05-28

    Neutron capture cross sections in the “continuum” region (>≈1 keV) and gamma-emission spectra are of importance to basic science and many applied fields. Careful measurements have been made on most common stable nuclides, but physicists must rely on calculations (or “surrogate” reactions) for rare or unstable nuclides. Calculations must be benchmarked against measurements (cross sections, gamma-ray spectra, and <Γγ>). Gamma-ray spectrum measurements from resolved resonances were made with 1 - 2 mg/cm2 thick targets; cross sections at >1 keV were measured using thicker targets. The results show that the shape of capture cross section vs neutron energy is not sensitive to the form of the strength function (although the magnitude is); the generalized Lorentzian E1 strength function is not sufficient to describe the shape of observed gamma-ray spectra; MGLO + “Oslo M1” parameters produces quantitative agreement with the measured 238U(n,γ) cross section; additional strength at low energies (~ 3 MeV) -- likely M1-- is required; and careful study of complementary results on low-lying giant resonance strength is needed to consistently describe observations.

  1. Crystal structure and Hirshfeld surface analysis of 1-carboxy-2-(3,4-dihydroxyphenylethan-1-aminium bromide 2-ammonio-3-(3,4-dihydroxyphenylpropanoate

    Directory of Open Access Journals (Sweden)

    Perumal Kathiravan

    2016-11-01

    Full Text Available In the title molecular salt, C9H12NO4+·Br−·C9H11NO4, one of the dopa molecules is in the cationic form in which the α-amino group is protonated and the α-carboxylic acid group is uncharged, while the second dopa molecule is in the zwitterion form. The Br− anion occupies a special position and is located on a twofold rotation axis. The two dopa molecules are interconnected by short O—H...O hydrogen bonds. In the crystal, the various units are linked by O—H...O, N—H...Br and N—H...O hydrogen bonds, forming a three-dimensional framework. The title compound was refined as an inversion twin with an absolute structure parameter of 0.023 (8.

  2. Mass spectroscopy analysis of [sup 136]Ra and of the [sup 234]U / [sup 238]U disequilibria in natural waters: a new dating tool in hydrogeology. Analyses par spectrometrie de masse du [sup 136]Ra et des desequilibres [sup 234]U / [sup 238]U dans les eaux naturelles: un nouvel outil de datation en hydrogeologie

    Energy Technology Data Exchange (ETDEWEB)

    Joffroy, M.E.

    1997-10-27

    Physico-chemical characteristics of radium and its geochemical behaviour in underground waters remain badly known. The aim of this work is to try to determine its origins, behaviour with respect to other elements, and content in waters. After a recall of the classical techniques used for radium analysis, the thermal ionization mass spectrometry used in this study is described in details. A special method has been developed for radium extraction and separation from barium. Thanks to this technical improvement, the exchanges between the matrix and the pore water in aquifers and soils could have been studied using very small water samples. Two examples of application are presented: the small hydrologic system (soils, surface waters and springs) in the crystalline environment of the side basin of the Blackburn river in the Laurentides north of Ottawa (Canada), and the carbonated environment of the Cretaceous chalk aquifer of the Paris basin (France) with highly mineralized waters. In both examples, complementary analyses of soils and of the aquifers matrix were performed with the study of [sup 226]Ra/[sup 238]U, Ra/Ba, Ra/Ca, and Ra/Sr ratios. Different models of ground waters dating for aquifer recharge studies and using [sup 3]H, [sup 14]C and [sup 36]Cl are validated and compared with the [sup 226]Ra dating method developed in this study. The comparison between the different dating methods shows that the complexity of radium geochemistry in carbonated environment greatly limits the use of [sup 226]Ra in ground water dating and that the geochronological models are highly site-dependent. (J.S.) 226 refs.

  3. South African Radio League Introduction to Amateur Radio: A study guide for the Radio Amateur Examination

    CSIR Research Space (South Africa)

    Burger, Chris

    2016-01-01

    Full Text Available Balanced feeders ........................................................................................................ 234 Coaxial cables ............................................................................................................ 235...

  4. Production of neutron-rich nuclides in the heavy-element region via /sup 3/He-induced reactions

    Energy Technology Data Exchange (ETDEWEB)

    Chu, Y.Y.; Zhou, M.L.

    1982-01-01

    We have measured the production cross sections for /sup 233/Th and /sup 231/Th from the bombardment of /sup 238/U with /sup 3/He ions at 46-, 53-, and 60-MeV at the Brookhaven 60-in. isochronous cyclotron. We have also attempted to observe the decay of /sup 233/Ac produced via /sup 238/U(/sup 3/He,/sup 8/B) or equivalent reactions using 61 MeV /sup 3/He ions by first separating thorium from actinium and then performing chemical purifications on the second thorium sample into which the actinium has decayed. In the four experiments we performed, three gave results consistent with the ..beta.. half-life of /sup 233/Ac somewhat longer than 120 s and the production cross section from this target-projectile combination in the order of 1 to 2 ..mu..b.

  5. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  6. Procyanidin dimers Are Metabolized by Human Microbiota with 2-(3,4-Dihydroxyphenyl)acetic Acid and 5-(3,4-Dihydroxyphenyl)-y-valerolactone as the Major Metabolites

    NARCIS (Netherlands)

    Appeldoorn, M.M.; Vincken, J.P.; Aura, A.M.; Hollman, P.C.H.; Gruppen, H.

    2009-01-01

    Procyanidins (PCs) are highly abundant phenolic compounds in the human diet and might be responsible for the health effects of chocolate and wine. Due to low absorption of intact PCs, microbial metabolism might play an important role. So far, only a few studies, with crude extracts rich in PCs but

  7. Measurements of the Electric Form Factor of the Neutron up to Q2=3.4 GeV2 using the Reaction He3(e,e'n)pp

    CERN Document Server

    Riordan, S; Craver, B; Kelleher, A; Kolarkar, A; Miller, J; Cates, G D; Liyanage, N; Wojtsekhowski, B; Acha, A; Allada, K; Anderson, B; Aniol, K A; Annand, J R M; Arrington, J; Averett, T; Beck, A; Bellis, M; Boeglin, W; Breuer, H; Calarco, J R; Camsonne, A; Chen, J P; Chudakov, E; Coman, L; Crowe, B; Cusanno, F; Day, D; Degtyarenko, P; Dolph, P A M; Dutta, C; Ferdi, C; Fernandez-Ramirez, C; Feuerbach, R; Fraile, L M; Franklin, G; Frullani, S; Fuchs, S; Garibaldi, F; Gevorgyan, N; Gilman, R; Glamazdin, A; Gomez, J; Grimm, K; Hansen, J O; Herraiz, J L; Higinbotham, D W; Holmes, R; Holmstrom, T; Howell, D; deJager, C W; Jiang, X; Jones, M K; Katich, J; Kaufman, L J; Khandaker, M; Kelly, J J; Kiselev, D; Korsch, W; LeRose, J; Lindgren, R; Markowitz, P; Margaziotis, D J; Beck, S May-Tal; Mayilyan, S; McCormick, K; Meziani, Z E; Michaels, R; Moffit, B; Nanda, S; Nelyubin, V; Ngo, T; Nikolenko, D M; Norum, B; Pentchev, L; Perdrisat, C F; Piasetzky, E; Pomatsalyuk, R; Protopopescu, D; Puckett, A J R; Punjabi, V A; Qian, X; Qiang, Y; Quinn, B; Rachek, I; Ransome, R D; Reimer, P E; Reitz, B; Roche, J; Ron, G; Rondon, O; Rosner, G; Saha, A; Sargsian, M; Sawatzky, B; Segal, J; Shabestari, M; Shahinyan, A; Shestakov, Yu; Singh, J; Sirca, S; Souder, P; Stepanyan, S; Stibunov, V; Sulkosky, V; Tajima, S; Tobias, W A; Udias, J M; Urciuoli, G M; Vlahovic, B; Voskanyan, H; Wang, K; Wesselmann, F R; Vignote, J R; Wood, S A; Wright, J; Yao, H; Zhu, X

    2010-01-01

    The electric form factor of the neutron was determined from studies of the reaction He3(e,e'n)pp in quasi-elastic kinematics in Hall A at Jefferson Lab. Longitudinally polarized electrons were scattered off a polarized target in which the nuclear polarization was oriented perpendicular to the momentum transfer. The scattered electrons were detected in a magnetic spectrometer in coincidence with neutrons that were registered in a large-solid-angle detector. More than doubling the Q2-range over which it is known, we find GEn = 0.0225 +/- 0.0017 (stat) +/- 0.0024 (syst), 0.0200 +/- 0.0023 +/- 0.0018, and 0.0142 +/- 0.0019 +/- 0.0013 for Q2 = 1.72, 2.48, and 3.41 GeV2, respectively.

  8. Nontypical iodine–halogen bonds in the crystal structure of (3 E )-8-chloro-3-iodomethylidene-2,3-dihydro-1,4-oxazino[2,3,4- ij ]quinolin-4-ium triiodide

    Energy Technology Data Exchange (ETDEWEB)

    Bartashevich, E. V.; Batalov, V. I.; Yushina, I. D.; Stash, A. I.; Chen, Y. S.

    2016-03-23

    Two kinds of iodine–iodine halogen bonds are the focus of our attention in the crystal structure of the title salt, C12H8ClINO+·I3-, described by X-ray diffraction. The first kind is a halogen bond, reinforced by charges, between the I atom of the heterocyclic cation and the triiodide anion. The second kind is the rare case of a halogen bond between the terminal atoms of neighbouring triiodide anions. The influence of relatively weakly bound iodine inside an asymmetric triiodide anion on the thermal and Raman spectroscopic properties has been demonstrated.

  9. Nontypical iodine–halogen bonds in the crystal structure of (3 E )-8-chloro-3-iodomethylidene-2,3-dihydro-1,4-oxazino[2,3,4- ij ]quinolin-4-ium triiodide

    Energy Technology Data Exchange (ETDEWEB)

    Bartashevich, E.V.; Batalov, V.I.; Yushina, I.D.; Stash, A.I.; Chen, Y.S. (South Ural); (Karpov); (UC)

    2016-04-29

    Two kinds of iodine–iodine halogen bonds are the focus of our attention in the crystal structure of the title salt, C12H8ClINO+·I3-, described by X-ray diffraction. The first kind is a halogen bond, reinforced by charges, between the I atom of the heterocyclic cation and the triiodide anion. The second kind is the rare case of a halogen bond between the terminal atoms of neighbouring triiodide anions. Lastly, the influence of relatively weakly bound iodine inside an asymmetric triiodide anion on the thermal and Raman spectroscopic properties has been demonstrated.

  10. Nontypical iodine-halogen bonds in the crystal structure of (3E)-8-chloro-3-iodomethylidene-2,3-dihydro-1,4-oxazino[2,3,4-ij]quinolin-4-ium triiodide.

    Science.gov (United States)

    Bartashevich, E V; Batalov, V I; Yushina, I D; Stash, A I; Chen, Y S

    2016-04-01

    Two kinds of iodine-iodine halogen bonds are the focus of our attention in the crystal structure of the title salt, C12H8ClINO(+)·I3(-), described by X-ray diffraction. The first kind is a halogen bond, reinforced by charges, between the I atom of the heterocyclic cation and the triiodide anion. The second kind is the rare case of a halogen bond between the terminal atoms of neighbouring triiodide anions. The influence of relatively weakly bound iodine inside an asymmetric triiodide anion on the thermal and Raman spectroscopic properties has been demonstrated.

  11. A Joint Experimental and Computational Study of the Negative Ion Photoelectron Spectroscopy of the 1-Phospha-2,3,4-triazolate Anion, HCPN 3

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Gao-Lei; Chen, Bo; Transue, Wesley J.; Hrovat, David A.; Cummins, Christopher C.; Borden, Weston Thatcher; Wang, Xue-Bin

    2016-08-11

    We report here the results of a combined experimental and computational study of the negative ion photoelectron spectroscopy (NIPES) of the recently synthesized, planar, aromatic, HCPN3– ion. The adiabatic electron detachment energy of HCPN3– (electron affinity of HCPN3•) was measured to be 3.555 ± 0.010 eV, a value that is intermediate between the electron detachment energies of the closely related (CH)2N3– and P2N3– ions. High level electronic structure calculations and Franck–Condon factor (FCF) simulations reveal that transitions from the ground state of the anion to two nearly degenerate, low-lying, electronic states, of the neutral HCPN3• radical are responsible for the congested peaks at low binding energies in the NIPE spectrum. The best fit of the simulated NIPE spectrum to the experimental spectrum indicates that the ground state of HCPN3• is a 5π-electron 2A" π radical state, with a 6π-electron, 2A', σ radical state being at most ~1.0 kcal/mol higher in energy. This assignment contrasts with our recent finding that the ground state of P2N3• is a 6π-electron σ radical state

  12. Anti-inflammatory effect of O-methylated flavonol 2-(3,4-dihydroxy-phenyl)-3,5-dihydroxy-7-methoxy-chromen-4-one obtained from Cassia sophera Linn in rats.

    Science.gov (United States)

    Mondal, Arijit; Rajalingam, D; Kumar Maity, Tapan

    2013-05-20

    Cassia sophera Linn (Family Caesalpiniaceae), popularly known as kasundi, is used both in the Indian traditional system and folk medicine to treat several inflammatory pathologies such as asthma, arthritis and pains. The aim of the present study was to evaluate the scientific basis of anti-inflammatory activity of Cassia sophera ethanol extracts and of an isolated constituent of Cassia sophera. The anti-inflammatory activity of Cassia sophera was studied using the carrageenan, dextran induced rat paw edema, and cotton pellet induced granuloma in rats. The ethanol extract was administered at the concentrations of 200 and 400mg/kg body weight whereas rhamnetin (RN) was administered at a dose of 10 and 15 mg/kg, b.w. Indomethacin was used as standard drug. The HPLC analysis revealed that good amounts of rhamnetin (0.18%) was present in Cassia sophera.The ethanol extracts at 400mg/kg, showed maximum inhibition of inflammation induced by carrageenan (44%), dextran (40%), cotton pellets (37.47%). On the other hand rhamnetin (15 mg/kg) exhibited maximum anti-inflammatory effect, that is 79 and 33% at the end of 3h with carrageenin, and dextran-induced rat paw edema, respectively. In a chronic test rhamnetin (15 mg/kg) showed 43.32% reduction in granuloma weight. The marked inhibitory effect on paw edema and granuloma showed that Cassia sophera possess remarkable anti-inflammatory activity which may be due to rhamnetin at least in part, supporting the folkloric usage of the plant to treat various inflammatory diseases. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  13. Crystal structure and Hirshfeld surface analysis of 1-carboxy-2-(3,4-dihydroxyphenylethan-1-aminium chloride 2-ammonio-3-(3,4-dihydroxyphenylpropanoate: a new polymorph of l-dopa HCl and isotypic with its bromide counterpart

    Directory of Open Access Journals (Sweden)

    Perumal Kathiravan

    2016-11-01

    Full Text Available The title molecular salt, C9H12NO4+·Cl−·C9H11NO4, is isotypic with that of the bromide counterpart [Kathiravan et al. (2016. Acta Cryst. E72, 1544–1548]. The title salt is a second monoclinic polymorph of the l-dopa HCl structure reported earlier in the monoclinic space group P21 [Jandacek & Earle (1971. Acta Cryst. B27, 841–845; Mostad & Rømming (1974. Acta Chemica Scand. B28, 1161–1168]. In the title compound, monoclinic space group I2, one of the dopa molecules has a positive charge with a protonated α-amino group and the α-carboxylic acid group uncharged, while the second dopa molecule has a neutral charge, the α-amino group is protonated and the α-carboxylic acid is deprotonated. In the previously reported form, a single dopa molecule is observed in which the α-amino group is protonated and the α-carboxylic acid group is uncharged. The invariant and variations of various types of intermolecular interactions present in these two forms of dopa HCl structures are discussed with the aid of two-dimensional fingerprint plots.

  14. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  15. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  16. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC234 (Link to dictyBase) - - - Contig-U16464-1 VFC234P (Link... to Original site) VFC234F 292 VFC234Z 462 VFC234P 754 - - Show VFC234 Library VF (Link to library) Clone ID VFC234 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16464-1 Original site URL http://dict...2 5e-06 6 AL844509 |AL844509.1 Plasmodium falciparum chromosome 13. 48 4e-04 4 AC117075 |AC117075.2 Dict...brane 4.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VFC234 is nuc 5' end seq. ID VFC234

  18. Crystal structure and Hirshfeld surface analysis of 1-carb­oxy-2-(3,4-di­hydroxy­phen­yl)ethan-1-aminium bromide 2-ammonio-3-(3,4-di­hydroxy­phen­yl)propano­ate

    Science.gov (United States)

    Kathiravan, Perumal; Balakrishnan, Thangavelu; Venkatesan, Perumal; Ramamurthi, Kandasamy; Percino, María Judith; Thamotharan, Subbiah

    2016-01-01

    In the title mol­ecular salt, C9H12NO4 +·Br−·C9H11NO4, one of the dopa mol­ecules is in the cationic form in which the α-amino group is protonated and the α-carb­oxy­lic acid group is uncharged, while the second dopa mol­ecule is in the zwitterion form. The Br− anion occupies a special position and is located on a twofold rotation axis. The two dopa mol­ecules are inter­connected by short O—H⋯O hydrogen bonds. In the crystal, the various units are linked by O—H⋯O, N—H⋯Br and N—H⋯O hydrogen bonds, forming a three-dimensional framework. The title compound was refined as an inversion twin with an absolute structure parameter of 0.023 (8). PMID:27840704

  19. Crystal structure and Hirshfeld surface analysis of 1-carb­oxy-2-(3,4-di­hydroxy­phen­yl)ethan-1-aminium chloride 2-ammonio-3-(3,4-di­hydroxy­phen­yl)propano­ate: a new polymorph of l-dopa HCl and isotypic with its bromide counterpart

    Science.gov (United States)

    Kathiravan, Perumal; Balakrishnan, Thangavelu; Venkatesan, Perumal; Ramamurthi, Kandasamy; Percino, María Judith; Thamotharan, Subbiah

    2016-01-01

    The title mol­ecular salt, C9H12NO4 +·Cl−·C9H11NO4, is isotypic with that of the bromide counterpart [Kathiravan et al. (2016 ▸). Acta Cryst. E72, 1544–1548]. The title salt is a second monoclinic polymorph of the l-dopa HCl structure reported earlier in the monoclinic space group P21 [Jandacek & Earle (1971 ▸). Acta Cryst. B27, 841–845; Mostad & Rømming (1974 ▸). Acta Chemica Scand. B28, 1161–1168]. In the title compound, monoclinic space group I2, one of the dopa mol­ecules has a positive charge with a protonated α-amino group and the α-carb­oxy­lic acid group uncharged, while the second dopa mol­ecule has a neutral charge, the α-amino group is protonated and the α-carb­oxy­lic acid is deprotonated. In the previously reported form, a single dopa mol­ecule is observed in which the α-amino group is protonated and the α-carb­oxy­lic acid group is uncharged. The invariant and variations of various types of inter­molecular inter­actions present in these two forms of dopa HCl structures are discussed with the aid of two-dimensional fingerprint plots. PMID:27840723

  20. Structure-activity relationship study towards non-peptidic positron emission tomography (PET) radiotracer for gastrin releasing peptide receptors : Development of [F-18] (S)-3-(1H-indol-3-yl)-N-[1-[5-(2-fluoroethoxy) pyridin-2-yl]cyclohexylmethyl]-2-methyl-2-[3-(4-nitrophenyl)ureido]propionamide

    NARCIS (Netherlands)

    Lacivita, Enza; Lucente, Ermelinda; Kwizera, Chantal; Farinha Antunes, Ines; Niso, Mauro; De Giorgio, Paola; Perrone, Roberto; Colabufo, Nicola A.; Elsinga, Philip H.; Leopoldo, Marcello

    2017-01-01

    Gastrin-releasing peptide receptors (GRP-Rs, also known as bombesin 2 receptors) are overexpressed in a variety of human cancers, including prostate cancer, and therefore they represent a promising target for in vivo imaging of tumors using positron emission tomography (PET). Structural

  1. Activity measurements of a suite of radionuclides ({sup 40}K, {sup 137}Cs, {sup 210}Pb, {sup 210}Po, {sup 228}Ra, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu, {sup 239}Pu, {sup 239+240}Pu, {sup 241}Am) in vegetal reference material (seaweed)

    Energy Technology Data Exchange (ETDEWEB)

    Outola, I. [Maryland Univ., MD (United States); Inn, K.G.W.; Karam, L.R. [National Institute of Standards and Technology (NIST), Gaithersburg, MD (United States)

    2008-12-15

    In 2005, the CCRI decided that a comparison undertaken from 2002 to 2005 by the NIST (SIM) in the development of a new seaweed standard reference material (SRM) was sufficiently well constructed that it could be converted into a supplementary comparison under CCRI(II), with comparison identifier CCRI(II)-S1, so as to support calibration and measurement capability (CMC) claims for radionuclide measurements in reference material (specifically, plant material). Previous comparisons of radionuclides have been of single or multiple nuclides in non-complex matrices and results of such could not be extended to support capabilities to measure the same nuclides in reference materials. The results of this comparison have been reported to the participants, and were also used to determine the certified reference values of the SRM. The key comparison working group (KCWG) of the CCRI(II) has approved this approach as a mechanism to link all the results to the certified 'reference values' in lieu of the key comparison reference value (KCRV) of these specified radionuclides in this type of matrix (vegetative) so as to support CMCs of similar materials. (authors)

  2. Synthesis and Characterization of Mixed Chalcogen Triangular Complexes with New Mo-3(mu(3)-S)(mu(2)-Se-2)(3)(4+) and M-3(mu(3)-S)mu(2)-Se)(3)(4+) (M = Mo, W) Cluster Cores

    DEFF Research Database (Denmark)

    Gushchin, Artem; Ooi, Bee Lean; Harris, Pernille

    2009-01-01

    In our pursuit of mixed chalcogen-bridged cluster complexes, solids of the compositions Mo3SSe6Br4 and W3SSe6Br4 were prepared using high-temperature synthesis from the elements. Treatment of Mo3SSe6Br4 with Bu4NBr in a vibration mill yielded (Bu4N)(3)([Mo-3(mu(3)-S)(mu(2)-Se-2)(3)Br-6]Br} (I). I...

  3. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  4. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  5. There is a Significant Relationship Between Computer Attitudes and Library Anxiety Among African American Graduate Students. A review of: Jiao, Qun G., and Anthony J. Onwuegbuzie. “The Impact of Information Technology on Library Anxiety: The Role of Computer Attitudes.” Information Technology & Libraries 23.4 (Dec. 2004: 138 ‐44.

    Directory of Open Access Journals (Sweden)

    Gill Needham

    2007-03-01

    Full Text Available Objective – To investigate whether African American students’ computer attitudes predict levels of library anxiety. Design – A user study in which two instruments were administered to a group of graduate students to measure computer attitudes and library anxiety. Setting – The College of Education at an historically black college and university in the United States of America. Subjects – Ninety ‐four, predominantly female, African American graduate students, ranging in age from 22 ‐62 years old, and enrolled in either a statistics or a measurement course. Methods – Two instruments, the Computer Attitude Scale (CAS and the Library Anxiety Scale (LAS were administered to all the study participants. The Computer Anxiety Scale contains forty Likert ‐type items that assess individuals’ attitudes toward computers and their use. It includes four scales which can be administered separately: 1. Anxiety or fear of computers 2. Confidence in the ability to use computers 3. Liking or enjoying working with computers 4. Computer usefulnessThe LAS contains forty ‐three, 5 ‐point, Likert ‐format items that assess levels of library anxiety experienced by college students. It also has five subscales as follows: 1. Barriers with staff 2. Affective barriers 3. Comfort with the library 4. Knowledge of the library 5. Mechanical barriers Main results – There were twenty correlations between the library anxiety subscale scores and the computer attitude subscale scores. Four of these correlations were statistically significant. Liking or enjoying working with computers was statistically significantly linked to affective barriers, comfort with the library, and knowledge of the library. There was also a statistically significant association between an attitude of computer usefulness and knowledge of the library. Conclusion – These findings suggest that in this group of students there is a medium to strong relationship between computer attitudes and library anxiety.

  6. Joe Zhang, Party Man, Company Man

    DEFF Research Database (Denmark)

    Brødsgaard, Kjeld Erik

    2014-01-01

    Book review of: Joe Zhang: Party Man, Company Man. Honolulu: Enrich Professional Publishing, 2014. 234 pp.......Book review of: Joe Zhang: Party Man, Company Man. Honolulu: Enrich Professional Publishing, 2014. 234 pp....

  7. GETDB: 113511 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 1 Request - ubiquitous epi (SG) no larva ubiquitous - - - comment1:A, comment2:34... Larval X-gal ubiquitous Adult GFP - Lethality - Also known as - Original Comments comment1:A, comment2:34A8

  8. 75 FR 41920 - Agency Information Collection; Activity Under OMB Review; Airline Service Quality Performance...

    Science.gov (United States)

    2010-07-19

    ...; Airline Service Quality Performance--Part 234 AGENCY: Research & Innovative Technology Administration... INFORMATION: OMB Approval No. 2138-0041 Title: Airline Service Quality Performance--Part 234. Form No.: BTS...

  9. Ebonyi Medical Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. OUJ Umeora Dr. Ebonyi State Uni. Teaching Hospital. P.O. Box 980 Abakaliki – Ebonyi State Nigeria. Postal code: 480001. Alternative email address: ebsuthemj@yahoo.com. Phone: +234 8039558074. Fax: +234 43 221856, +234. Email: oujair@yahoo.com ...

  10. EST Table: FS829498 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS829498 E_FL_fmgV_32C07_R_0 10/09/28 34 %/210 aa ref|XP_001656347.1| bestrophin 2,...3,4 [Aedes aegypti] gb|EAT45610.1| bestrophin 2,3,4 [Aedes aegypti] 10/09/10 32 %/234 aa FBpp0113082|Best1-P

  11. The chemistry of the actinide elements, Volume II

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is an exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  12. Chemistry of the actinide elements. Vol. 2. 2. Ed

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Morss, L.R.; Seaborg, G.T. (eds.)

    1986-01-01

    This is a comprehensive, exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven transuranium elements. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermodynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive list of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  13. Chemistry of the actinide elements. Vol. 1, 2nd Ed

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Morss, L.R.; Seaborg, L.R. (eds.)

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven transuranium elements. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermodynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  14. The chemistry of the actinide elements. Volume I

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  15. Gold-coated lanthanide phosphate nanoparticles for an {sup 225}Ac in vivo alpha generator

    Energy Technology Data Exchange (ETDEWEB)

    McLaughlin, M.F. [Missouri Univ., Columbia, MO (United States). Dept. of Chemistry; Oak Ridge National Lab., TN (United States); Woodward, J.; Boll, R.A.; Rondinone, A.J.; Mirzadeh, S. [Oak Ridge National Lab., TN (United States); Robertson, J.D. [Missouri Univ., Columbia, MO (United States). Dept. of Chemistry

    2013-11-01

    Retaining radioactive daughter products at a clinically relevant target site remains one of the major challenges in development of in vivo {alpha} generators with radionuclides such as {sup 225}Ac and {sup 223}Ra. In this work, we examine the ability of layered nanoparticle constructs to retain {sup 225}Ac and the first decay daughter, {sup 221}Fr. Actinium-225 is cocrystalized in a lanthanide phosphate nanoparticle consisting of varying amounts of La and Gd. Additional lanthanide phosphate layers improve retention capability while an outer layer of gold facilitates the attachment of targeting moieties for in vivo use. Retention of {sup 225}Ac in the nanoparticles is near quantitative while the {sup 221}Fr retention varies from 60-89% as a function of time, the number of layers, and nanoparticle composition. Decay corrected radiochemical yield in the multi-shell syntheses are high (76%) and comparable to or better than existing delivery approaches. (orig.)

  16. Uranium decay products found on Mir space blanket mitt.

    Science.gov (United States)

    Grismore, R; Rosen, A Z; Llewellyn, R A; Taylor, J S

    2001-01-01

    The space blanket mitt which covered the Trek detector on Mir during four years of orbital flight has been measured for gamma radiation with HPGe and multidimensional spectrometers. Difference spectra from very-long-period spectrometer runs on the mitt and on a similar non-deployed mitt from the same manufacturer show that the mitt has acquired small but significant amounts of gamma radioactivity during orbital flight. Twelve gamma-ray peaks have been measured in the difference spectra, including peaks identified as due to 214Bi and 214Pb from the uranium-radium alpha decay series, and others possibly due to the uranium-actinium series. This implies the presence of a sparse population of uranium decay products in lower orbital space which can only have come from nuclear explosions, burned-up satellite nuclear batteries, the solar wind, or supernova fragments in the local interstellar medium.

  17. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  18. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  19. Activation of Hh Signaling: A Critical Biological Consequence of ETS Gene Anomalies in Prostate Cancer

    Science.gov (United States)

    2013-01-01

    illustration on the right. 1 1 1 234 391 234 391 391 558 234 558 558 GST-pull down GST-pull down AR constructs (pcDNA 3.1 His-) Input Input GST-hGli2...endocrine therapy for prostatic cancer. Urol Clin North Am. 1991; 18(1):1–13. [PubMed: 1899494] 6. Culig Z, Bartsch G. Androgen axis in prostate cancer

  20. Precise determination of the absolute intensities of the gamma-ray lines of {sup 235}U and some {sup 238}U daughters

    Energy Technology Data Exchange (ETDEWEB)

    Al-Saleh, F.S. [Physics Department, Girls College of Education in Riyadh (Saudi Arabia)]. E-mail: ferdoasalsaleh@hotmail.com; Al-Mukren, Al-J.H. [Physics Department, Girls College of Education in Riyadh (Saudi Arabia); Farouk, M.A. [NCNSRC, AEA Cairo (Egypt)

    2006-12-01

    The intensities of some gamma-ray lines emitted from {sup 234}Th and {sup 234}Pa are usually used to estimate the concentrations of {sup 238}U in different environmental samples. However, the absolute intensity values currently available for some gamma-ray lines which are used for determination of these concentrations seem to be inaccurate and include some discrepancies. In the present work, the absolute intensity values for some gamma-ray lines of {sup 235}U, {sup 234}Th and {sup 234}Pa have been studied and precisely evaluated using a hyper pure germanium high-resolution gamma spectrometer.

  1. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... RKAADKGSSAAM Sbjct: 1 ... GVTEIAPGDVSTAIKYCRVASAGSRRAMYGLGRAYAAGGQTAEALAAYRKAADKGSSAAM 60 ... Query: 175 AESNAEAQYQLGMMMAD...GIGGPKDDAGARALFEKAAGQGHPGALMQMGAFAQAGRGGPKD 234 ... AESNAEAQYQLGMMMADGIGGPKDDAGA...RALFEKAAGQGHPGALMQMGAFAQAGRGGPKD Sbjct: 121 AESNAEAQYQLGMMMADGIGGPKDDAGARALFEKAAGQGHPGALMQMGAFAQAGRGGPKD 180 ...

  2. Development of a Monoclonal Antibody Against Estrogen Quinone-Adducted Proteins as Potential Biomarkers of Breast Cancer Risk

    Science.gov (United States)

    2002-06-01

    E2-3,4-Q) covalently linked to hen egg albumin (OA) 1. Basis for the idea that E2-3,4-Q could form simple and stable adducts to protein amino groups...hen egg albumin (OA)], in comparison to a high molecular-weight protein, e.g., keyhole limpet hemocyanin (KLH), is a superior carrier for...Backbone 0 0 0 Immune Receptor //HO 2-OHE2-6-N-GABA Figure 4 3. Synthesis I: Direct coupling of E2-3,4-Q to hen egg albumin (OA) a. Preparation of E2-3,4-Q

  3. 77 FR 33808 - Agency Information Collection; Activity Under OMB Review: Airline Service Quality Performance...

    Science.gov (United States)

    2012-06-07

    ...: Airline Service Quality Performance--Part 234 AGENCY: Research & Innovative Technology Administration... Desk Officer. SUPPLEMENTARY INFORMATION: OMB Approval No. 2138-0041 Title: Airline Service Quality...

  4. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  5. Synthesis of 6-O-(5-acetamido-3,5-dideoxy-α-D-glycero-D-galacto-2-nonulopyranosylonic acid)-D-galactose [6-O-(N-acetyl-α-D-neuraminyl)-D-galactose

    NARCIS (Netherlands)

    Vliegenthart, J.F.G.; Vleugel, D.J.M. van der; Wassenburg, F.R.; Zwikker, J.W.

    1982-01-01

    Condensation of methyl 5-acetamido-4,7,8,9-tetra-O-acetyl-2-chloro-2,3,5-trideoxy-beta-D-glycero-D-galacto-2-nonulopyranosonate with benzyl 2,3,4-tri-O-benzyl-beta-D-galactopyranoside, using silver salicylate as promoter, gave benzyl 2,3,4-tri-O-benzyl-6-O-(methyl

  6. Design and exploration of novel boronic acid inhibitors reveals important interactions with a clavulanic acid-resistant sulfhydryl-variable (SHV) β-lactamase.

    Science.gov (United States)

    Winkler, Marisa L; Rodkey, Elizabeth A; Taracila, Magdalena A; Drawz, Sarah M; Bethel, Christopher R; Papp-Wallace, Krisztina M; Smith, Kerri M; Xu, Yan; Dwulit-Smith, Jeffrey R; Romagnoli, Chiara; Caselli, Emilia; Prati, Fabio; van den Akker, Focco; Bonomo, Robert A

    2013-02-14

    Inhibitor resistant (IR) class A β-lactamases pose a significant threat to many current antibiotic combinations. The K234R substitution in the SHV β-lactamase, from Klebsiella pneumoniae , results in resistance to ampicillin/clavulanate. After site-saturation mutagenesis of Lys-234 in SHV, microbiological and biochemical characterization of the resulting β-lactamases revealed that only -Arg conferred resistance to ampicillin/clavulanate. X-ray crystallography revealed two conformations of Arg-234 and Ser-130 in SHV K234R. The movement of Ser-130 is the principal cause of the observed clavulanate resistance. A panel of boronic acid inhibitors was designed and tested against SHV-1 and SHV K234R. A chiral ampicillin analogue was discovered to have a 2.4 ± 0.2 nM K(i) for SHV K234R; the chiral ampicillin analogue formed a more complex hydrogen-bonding network in SHV K234R vs SHV-1. Consideration of the spatial position of Ser-130 and Lys-234 and this hydrogen-bonding network will be important in the design of novel antibiotics targeting IR β-lactamases.

  7. Double-monoclonal immunofluorometric assays for pregnancy-associated plasma protein A/proeosinophil major basic protein (PAPP-A/proMBP) complex in first-trimester maternal serum screening for Down syndrome.

    Science.gov (United States)

    Qin, Q P; Christiansen, M; Oxvig, C; Pettersson, K; Sottrup-Jensen, L; Koch, C; Nørgaard-Pedersen, B

    1997-12-01

    Four double-monoclonal time-resolved immunofluorometric assays (TrIFMAs) have been developed for the specific determination of pregnancy-associated plasma protein A/proeosinophil major basic protein (PAPP-A/ proMBP) complex in first-trimester maternal serum samples. The assays have a functional sensitivity of working range from 4 to 1000 mIU/L. These 4 assays, together with a polyclonal sandwich TrIFMA, were compared for their ability to discriminate between normal pregnancies (n = 149) and pregnancies carrying a Down syndrome fetus (n = 36) in maternal serum screening samples from gestational weeks 4-13. In 26 Down syndrome pregnancies from gestational weeks 7-12, the median PAPP-A multiples of the median concentration in controls (MoMs) determined by monoclonal antibody combinations 234-3/234-2*, 234-4/234-2*, 234-4/234-5*, and 234-5/234-6* were 0.35, 0.37, 0.42, and 0.44, respectively, whereas the median MoM determined by the polyclonal assay was 0.56. ROC curve analysis also showed that better overall diagnostic accuracy and detection rates were achieved by the monoclonal TrIFMAs than by the polyclonal TrIFMA. This report is the first to describe assays that specifically measure PAPP-A/proMBP complex without possible interference from other proMBP-containing complexes.

  8. NCBI nr-aa BLAST: CBRC-PABE-07-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-07-0001 ref|XP_001642290.1| hypothetical protein Kpol_234p2 [Vanderwaltoz...yma polyspora DSM 70294] gb|EDO14432.1| hypothetical protein Kpol_234p2 [Vanderwaltozyma polyspora DSM 70294] XP_001642290.1 2.0 29% ...

  9. NCBI nr-aa BLAST: CBRC-HSAP-06-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0002 ref|XP_001642290.1| hypothetical protein Kpol_234p2 [Vanderwaltoz...yma polyspora DSM 70294] gb|EDO14432.1| hypothetical protein Kpol_234p2 [Vanderwaltozyma polyspora DSM 70294] XP_001642290.1 2e-05 32% ...

  10. NCBI nr-aa BLAST: CBRC-TGUT-37-0204 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-37-0204 ref|XP_001642290.1| hypothetical protein Kpol_234p2 [Vanderwaltoz...yma polyspora DSM 70294] gb|EDO14432.1| hypothetical protein Kpol_234p2 [Vanderwaltozyma polyspora DSM 70294] XP_001642290.1 2e-14 55% ...

  11. Drug: D01394 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01394 Drug Epirizole (JP16/USAN); Mebron (TN) C11H14N4O2 234.1117 234.2545 D01394....pyretics and analgesics, anti-inflammatory agents 1148 Basic antiinflammatory analgesics D01394 Epirizo

  12. Zoologist (The): Contact

    African Journals Online (AJOL)

    Principal Contact. Prof. A.B. Odaibo Editor-in-Chief University of Ibadan, Ibadan. Nigeria. Hydrobiology & Fisheries Unit, Department of Zoology, University of Ibadan, Ibadan. Oyo State. Nigeria. West Africa. Alternative Email Address: adebakar19@yahoo.com. Phone: +234-(0)- 803-049-74. Fax: +234-02-8103043

  13. 75 FR 25165 - Defense Federal Acquisition Regulation Supplement; Cost and Software Data Reporting System

    Science.gov (United States)

    2010-05-07

    ... Regulation Supplement; Cost and Software Data Reporting System AGENCY: Defense Acquisition Regulations System... summarized as follows: The objective of the rule is to set forth Cost and Software Data Reporting System...--MAJOR SYSTEM ACQUSITION 3. Add subpart 234.71 to read as follows: Subpart 234.71--Cost and Software Data...

  14. Animal Research International: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr. J. E. Eyo Dr. Department of Zoology, University of Nig Department of Zoology, POBox 3146, University of Nigeria, Nsukka, Enugu State, Nigeria. Phone: 234 42 308030. Email: joseph.eyo@unn.edu.ng. Support Contact. N. S. Oluah Phone: +234-83732127. Email: ndubusioluah@yahoo.com.

  15. Subscriptions

    African Journals Online (AJOL)

    Subscriptions Contact. Dr Jide Owoeye College press Publishers Lts P O Box 30678 Ibadan Oyo State NIGERIA Phone: 234 02 8101963. Fax: 234 02 8104165. Email: ajiadlcu@gmail.com. International Rates. Subscription per volume (2 issues) $50 (including airmail and handling). Advertisement per volume $50 (full ...

  16. African Journal of Endocrinology and Metabolism: Contact

    African Journals Online (AJOL)

    Principal Contact. Prof. G.O. Ajayi Editor-in-Chief University of Lagos Department of Obstetrics & Gynaecology, College of Medicine, University of Lagos, P.M.B. 12003, Idi-Araba Lagos Nigeria Phone: 234-1-8507681. Fax: 234-1-17404387. Email: goajayi@yahoo.com ...

  17. 10 CFR Appendix B to Part 30 - Quantities 1 of Licensed Material Requiring Labeling

    Science.gov (United States)

    2010-01-01

    ... Uranium (natural) 2 100 Uranium-233 .01 Uranium-234—Uranium-235 .01 Vanadium-48 10 Xenon-131m 1,000 Xenon... alpha disintegration rate of U-238, U-234, and U-235. Note: For purposes of § 20.303, where there is...

  18. 48 CFR 11.002 - Policy.

    Science.gov (United States)

    2010-10-01

    ...); (iv) Products containing recovered materials (Subpart 23.4); (v) Biobased products (Subpart 23.4); and..., 41 U.S.C. 253a(a), and 41 U.S.C. 264b, agencies shall— (1) Specify needs using market research in a... significant inefficiencies or loss of markets to United States firms. Requiring activities are responsible for...

  19. EST Table: FS735977 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS735977 E_FL_bmmt_04J24_R_0 11/12/09 n.h 10/09/28 36 %/182 aa ref|XP_001865897.1| best...rophin 2,3,4 [Culex quinquefasciatus] gb|EDS42461.1| bestrophin 2,3,4 [Culex quinquefasciatus] 10/09/03

  20. EST Table: FY748702 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY748702 E_FL_famL_39P03_F_0 11/11/04 79 %/157 aa ref|XP_001656347.1| bestrophin 2,...3,4 [Aedes aegypti] gb|EAT45610.1| bestrophin 2,3,4 [Aedes aegypti] 11/11/04 63 %/157 aa FBpp0251679|DwilGK2

  1. An Extensible NetLogo Model for Visualizing Message Routing Protocols

    Science.gov (United States)

    2017-08-01

    table:make set contacts table:make set color white set shape "circle 2" set size contact-range set label who set label- color grey set heading random 360...frame the world with dark red patches [set pcolor red - 4] ; show the grid [sprout-cells 1 [set shape "square 2" set color grey

  2. 78 FR 74012 - Approval and Promulgation of Implementation Plans; State of Oregon; Revised Format for Materials...

    Science.gov (United States)

    2013-12-10

    .../1999 1/22/2003, 68 FR Flexographic 2891. Printing. Division 234--Emission Standards for Wood Products.... 2891. 234-0430 Exceptions......... 10/14/1999 1/22/2003, 68 FR 2891. Board Products Industries (Veneer.../1993 2/25/1997, 62 FR for Existing 8385. Sources. 021-225 Wood-Waste Boilers. 3/10/1993 2/25/1997, 62...

  3. 77 FR 18306 - Agency Information Collection; Activity Under OMB Review; Airline Service Quality Performance

    Science.gov (United States)

    2012-03-27

    ...; Airline Service Quality Performance AGENCY: Research & Innovative Technology Administration (RITA), Bureau.... SUPPLEMENTARY INFORMATION: OMB Approval No. 2138-0041. Title: Airline Service Quality Performance Reports--Part...-Baggage Reports'' pursuant to 14 CFR 234.4 and 234.6. These reports are used to monitor the quality of air...

  4. Dicty_cDB: Contig-U09091-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 Score = 180 bits (91), Expect = 1e-45 Identities = 253/253 (100%) Strand = Plus / Plus Query: 234 tcccnat...ntanactaccnctggncaaantaaaactggtttngcnccnantgcaancggnt 293 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 234 tcccnatntanactaccnctggncaaantaaaactggtttngcnccnantgcaancggn...acncgncnttggangnattgga 413 Query: 414 aancngnccttttaggggcnggnttancnggntttgcccnaaa...nttanttggnaannattggacncgncnttgg 152 Query: 404 angnattggaaancngnccttttaggggcnggnttancnggntttgcccna

  5. Drug: D00505 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00505 Drug Phenelzine sulfate (USP); Nardil (TN) C8H12N2. H2SO4 234.0674 234.2728 D00505.gif Antidepressant...129) Dopaminergic synapse map07027 Antidepressants map07216 Catecholamine transfe... Phenelzine sulfate (USP) USP drug classification [BR:br08302] Antidepressants Mo

  6. NCBI nr-aa BLAST: CBRC-PTRO-27-0281 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0281 ref|XP_001642290.1| hypothetical protein Kpol_234p2 [Vanderwaltoz...yma polyspora DSM 70294] gb|EDO14432.1| hypothetical protein Kpol_234p2 [Vanderwaltozyma polyspora DSM 70294] XP_001642290.1 4e-08 35% ...

  7. Temporal and Petrogenetic Constraints on Volcanic Accretionary Processes at 9-10 Degrees North East Pacific Rise

    Science.gov (United States)

    2010-06-01

    Sims, S. Weyer , and J. Schweiters (2008), Measurement of 234U/238U and 230Th/232Th in volcanic rocks using the Neptune PIMMS, J. Anal. At. Spectrom...doi:10.1029/2002GC000419. Ball, L., K. Sims, S. Weyer , and J. Schweiters (2008), Measurement of 234U/238U and 230Th/232Th in volcanic rocks using

  8. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  9. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  10. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.

    2016-03-09

    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  11. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  12. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

    2011-03-15

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

  13. Review of radionuclide source terms used for performance-assessment analyses; Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ``uranium`` and 4n+3 ``actinium`` decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides.

  14. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  15. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  16. Measurements of gamma radiation levels and spectra in the San Francisco Bay Area

    Science.gov (United States)

    Lo, B. T.; Brozek, K. P.; Angell, C. T.; Norman, E. B.

    2011-10-01

    Much of the radiation received by an average person is emitted by naturally-occurring radioactive isotopes from the thorium, actinium, and uranium decay series, or potassium. In this study, we have measured gamma radiation levels at various locations in the San Francisco Bay Area and the UC Berkeley campus from spectra taken using an ORTEC NOMAD portable data acquisition system and a large-volume coaxial HPGe detector. We have identified a large number of gamma rays originating from natural sources. The most noticeable isotopes are 214Bi, 40K, and 208Tl. We have observed variations in counting rates by factors of two to five between different locations due to differences in local conditions - such as building, concrete, grass, and soil compositions. In addition, in a number of outdoor locations, we have observed 604-, 662-, and 795-keV gamma rays from 134,137Cs, which we attribute to fallout from the recent Fukushima reactor accident. The implications of these results will be discussed. This work was supported in part by a grant from the U. S. Dept. of Homeland Security.

  17. Rapid Column Extraction Method for Actinides and Sr-89/90 in Water Samples

    Energy Technology Data Exchange (ETDEWEB)

    MAXWELL III, SHERROD L.

    2005-06-15

    The SRS Environmental Laboratory analyzes water samples for environmental monitoring, including river water and ground water samples. A new, faster actinide and strontium 89/90 separation method has been developed and implemented to improve productivity, reduce labor costs and add capacity to this laboratory. This method uses stacked TEVA Resin{reg_sign}, TRU Resin{reg_sign} and Sr-Resin{reg_sign} cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), curium (Cm) and thorium (Th) using a single multi-stage column combined with alpha spectrometry. By using vacuum box cartridge technology with rapid flow rates, sample preparation time is minimized. The method can be used for routine analysis or as a rapid method for emergency preparedness. Thorium and curium are often analyzed separately due to the interference of the daughter of Th-229 tracer, actinium (Ac)-225, on curium isotopes when measured by alpha spectrometry. This new method also adds a separation step using DGA Resin{reg_sign}, (Diglycolamide Resin, Eichrom Technologies) to remove Ac-225 and allow the separation and analysis of thorium isotopes and curium isotopes at the same time.

  18. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  19. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  20. checkCIF/PLATON report Datablock: ll5182-c2m

    Indian Academy of Sciences (India)

    PLAT710_ALERT_4_G Delete 1-2-3 or 2-3-4 Linear Torsion Angle ... #. 41 Do ! O1 -CO1 -O1 -CO2 -141.46 0.06 2.555 1.555 1.555 5.555. PLAT710_ALERT_4_G Delete 1-2-3 or 2-3-4 Linear Torsion Angle ... #. 92 Do ! O6 -CO3 -O4 -C5 180.00 0.00 1.555 1.555 1.555 1.555. PLAT710_ALERT_4_G Delete 1-2-3 or 2-3-4 ...

  1. 75 FR 48359 - Endangered and Threatened Wildlife and Plants; Indiana Bat; Notice of Intent To Prepare an...

    Science.gov (United States)

    2010-08-10

    .... Jane Ledwin, (573) 234-2132. Individuals who are hearing impaired or speech impaired may call the.... During summer months, they forage for insects along streams, in riparian forests and floodplains, and in...

  2. Profile and laboratory analyses data collected in the North Atlantic Ocean on the OCEANUS cruises WB0409, WB0413, WB0506, and WB0508 as part of the EDDIES project from 2004-06-24 to 2005-08-25 (NODC Accession 0086575)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Total Thorium-234 and Uranium-238 from Niskin bottle samples taken on all EDDIES WB cruises dates: 24 June 2004 to 25 August 2004 (20040624-20050825) location: N:...

  3. Biosphere reserves – learning sites of sustainable development?

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2008-01-01

    Roč. 14, č. 3 (2008), s. 221-234 ISSN 1211-7420 Institutional research plan: CEZ:AV0Z60870520 Keywords : nature protection * learning sites * biosphere reserves * sustainable development Subject RIV: DO - Wilderness Conservation

  4. Low molecular weight organic acids in root exudates and cadmium ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    234. Cieslinski G, Van Rees KCJ, Szmigielska AM, Krishnamurti GSR,. Huang PM (1998). Lowmolecular-weight organic acids in rhizosphere soils of durum wheat and their effect on cadmium bioaccumulation. Plant Soil, 203: ...

  5. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Troposphere Exchange Processes, Ground & Space-B Address: Space Physics Laboratory, Vikram Sarabhai Space Centre, Thiruvananthapuram 695 022, Kerala Contact: Office: (0471) 256 2157. Residence: (0471) 234 2603, 98955 94770. Fax: (0471) ...

  6. Poincare Algebra Extension with Tensor Generator

    OpenAIRE

    Soroka, Dmitrij V.; Soroka, Vyacheslav A.

    2005-01-01

    A tensor extension of the Poincar\\'e algebra is proposed for the arbitrary dimensions. Casimir operators of the extension are constructed. A possible supersymmetric generalization of this extension is also found in the dimensions $D=2,3,4$.

  7. Tensor extension of the Poincar\\'e algebra

    OpenAIRE

    Soroka, Dmitrij V.; Soroka, Vyacheslav A.

    2004-01-01

    A tensor extension of the Poincar\\'e algebra is proposed for the arbitrary dimensions. Casimir operators of the extension are constructed. A possible supersymmetric generalization of this extension is also found in the dimensions $D=2,3,4$.

  8. 14 CFR 135.152 - Flight data recorders.

    Science.gov (United States)

    2010-01-01

    ... acceleration (Vertical); (6) Pitch attitude; (7) Roll attitude; (8) Manual radio transmitter keying, or CVR..., Bell 412, Bell 412SP, Boeing Chinook (BV-234), Boeing/Kawasaki Vertol 107 (BV/KV-107-II), deHavilland...

  9. Application of the contingent valuation method to estimate a ...

    African Journals Online (AJOL)

    Department of Economics, PO Box 77000, Nelson Mandela Metropolitan University, Port Elizabeth, 6031, South .... catchment area is made up mostly of privately owned farms, ..... 3 234 for the Kowie) and the desired level of precision was set.

  10. 28 ORIGINAL ARTICLE Auteur Correspondant: bodumosu@unilag ...

    African Journals Online (AJOL)

    boaz

    Correspondence: bodumosu@unilag.edu.ng Tel +234 803 451 5048. RUNNING TITLE: EXTENDED-SPECTRUM BETA-LACTAMASE PRODUCING. ENTEROBACTERIACEAEISOLATE IN COMMUNAL WATER SOURCES. ABSTRACT. The role of Enterobacteriaceae in dissemination and reservoir of antibiotic resistance ...

  11. Disease: H01272 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01272 Hypoplastic left heart syndrome (HLHS) Hypoplastic left heart syndrome (HLHS... aortic valve. [DS:H00554] ICD-10: Q23.4 OMIM: 241550 614435 PMID:19298922 Grossfeld P, Ye M, Harvey R Hypoplastic

  12. 2004 Hawaii Longline Sociological Baseline Data System

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from 234 interviews of longline owners, captains, and crew collected during 2003-2004. Topics include personal history and demographic variables, involvement...

  13. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Department of Biotechnology and Bioinformatics, Jaypee University of Information Technology (JUIT), Waknaghat, Teh Kandaghat, Solan 173 234, India; School of Computer Science and Information Technology, Devi Ahilya Vishwavidyalaya (DAVV), Indore 452 013, India; Computational Biology Group, Abhyudaya ...

  14. Androgüüni kummaline pilk : fotograaf Ly Lestberg uurib androgüüni motiivi kaudu inimese hinge / Kärt Hellerma

    Index Scriptorium Estoniae

    Hellerma, Kärt, 1956-

    1999-01-01

    Kunstnik-fotograafi Ly Lestbergi näitus "Insomnia" Raatuse galeriis ja Cafe Anglais: 9 mustvalget suureformaadilist fotot noorest naisest. Ilmunud ka kogumikus: Avanenud ruum / Kärt Hellerma. Tallinn, 2006, lk. 232-234

  15. Foundations of health psychology

    National Research Council Canada - National Science Library

    Friedman, Howard S; Silver, Roxane Cohen

    2007-01-01

    ... and Effective Treatment 9 Adjustment to Chronic Disease: Progress and Promise in Research Annette L. Stanton and Tracey A. Revenson 203 10 Aging and Health 234 Karen S. Rook, Susan T. Charles, and...

  16. Journal of Meteorology and Climate Science: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr. K.O Ogunjobi Editor-in-Chief Federal University of Technology, Akure (FUTA) Department of Meteorology Federal University of Technology Akure, Ondo State Nigeria Phone: +234-7031145866. Email: jobik2000@yahoo.com ...

  17. African Journal of Paediatric Surgery: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr Aba Francis Uba Editor-in-Chief Paediatric Surgery Unit Department of Surgery Jos University Teaching Hospital P.M.B. 2076 Jos Plateau State Nigeria Phone: (234) 080371 54469. Email: afranu@yahoo.com ...

  18. Ten-Competence: Life-Long Competence Development and Learning

    NARCIS (Netherlands)

    Koper, Rob; Specht, Marcus

    2006-01-01

    Koper, R., & Specht, M. (2008). Ten-Competence: Life-Long Competence Development and Learning. In M-A. Cicilia (Ed.), Competencies in Organizational e-learning: concepts and tools (pp. 234-252). Hershey: IGI-Global.

  19. APA District Branch / State Association Directory

    Science.gov (United States)

    ... 785) 233-7154 Fax: (785) 234-2433 kansas.psych.org Kentucky Kentucky Psychiatric Medical Association Miranda Sloan, ... 635-5070 Fax: (573) 635-7823 www.missouri.psych.org Montana Montana Psychiatric Association Leonard Lantz, Acting ...

  20. Protein (Cyanobacteria): 279233 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09780620.1 1117:4884 1150:2505 35823:234 376219:95 Putative diguanylate cyclase with PAS/PAC and GAF sens...ors Arthrospira sp. PCC 8005 MSHLHRWLQSIKRRFKYCWLALFIGAIATLAVLLIWHKLYIREQRHFAQLVQQE

  1. Protein (Cyanobacteria): 279238 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Arthrospira maxima CS-328 MINVKMSDFSRFHEQDNLDSEHHYHFDGNLHRLATAIEQERKRFAGLSEP...ZP_03273845.1 1117:4884 1150:2505 35823:234 129910:139 513049:139 diguanylate cycla

  2. A comparison of risk and protective factors related to suicide ideation among residents and specialists in academic medicine

    National Research Council Canada - National Science Library

    Eneroth, Mari; Gustafsson Sendén, Marie; Løvseth, Lise T; Schenck-Gustafsson, Karin; Fridner, Ann

    2014-01-01

    .... As such, the correlates of suicide ideation may also vary between these two groups. In the present study, work- and health-related factors and their association with suicidal thoughts among residents (n=234) and specialists (n=813...

  3. Chemical, time series and other data collected in the South Pacific Ocean on the MELVILLE cruises PS02_2002 and COOK19MV as part of the SOFEX project from 2002-01-29 to 2002-02-20 (NODC Accession 0086464)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Thorium 234, POC and biogenic silica from the 2002 SOFeX project South Patch experiment dates: 29 January 2002 to 20 February 2002 (20020129-20020220) location: N:...

  4. Sooaspekt ja selle keeleline ülekanne : Emil Tode Piiririik / Riita-Ilona Märka

    Index Scriptorium Estoniae

    Märka, Riita-Ilona

    2003-01-01

    "Piiririigi" tõlge inglise keelde: Õnnepalu, Tõnu. Border state : [novel] / translated from the Estonian by Madli Puhvel. Evanston [USA] : Northwestern University Press, 2000. Autorist lk. 234 (inglise k.) ja lk. 237 (vene k.)

  5. The Blattodea s.s. (Insecta, Dictyoptera) of the Guiana Shield

    National Research Council Canada - National Science Library

    Evangelista, Dominic A; Chan, Kimberly; Kaplan, Kayla L; Wilson, Megan M; Ware, Jessica L

    2015-01-01

    .... The complete checklist contains 234 species of Blattodea s.s. currently known in the shield. This checklist shows particularly low richness in Guianan Venezuela, Roraima and Amapa Brazil, but this is likely an artifact due to under–sampling...

  6. Drug: D01446 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available n Japan [BR:br08301] 2 Agents affecting individual organs 23 Digestive organ agents 234 Antacids 2344 Inorganic salts... D01446 Magnesium carbonate (JP16/USP) 235 Purgatives, clysters 2355 Inorganic salts

  7. Drug: D00932 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available nate (JP16); Calcium carbonate, precipitated (JAN); Calcium carbonate (USP) 23 Digestive organ agents 234 Antacids 2344 Inorganic sal...ts D00932 Precipitated calcium carbonate (JP16); Calcium

  8. Protein (Cyanobacteria): 279234 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781866.1 1117:4884 1150:2505 35823:234 376219:95 putative Diguanylate cyclase with PAS/PAC and GAF sens...ors Arthrospira sp. PCC 8005 MNQLMEDRSKILWIAGNVGNDNHSLPQSILQNNGYEVHLVIGLKPAYNAIQSWP

  9. Protein (Cyanobacteria): 279248 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Arthrospira maxima CS-328 MMDKYLCPCCSEPLLIHIIAHKKIGFCMNCHQEMPLIEQSRQMATVTEPV...ZP_03273626.1 1117:4884 1150:2505 35823:234 129910:158 513049:158 diguanylate cycla

  10. Protein (Cyanobacteria): 279247 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782276.1 1117:4884 1150:2505 35823:234 376219:114 putative Diguanylate cyclase with PAS/PAC and GAF sen...sors Arthrospira sp. PCC 8005 MMDKYLCPCCSEPLLIHIIAHKKIGFCMNCHQEMPLIEQSRQMATVTEPVDVS

  11. Invasiveness does not predict impact: response of native land snail communities to plant invasions in riparian habitats

    Czech Academy of Sciences Publication Activity Database

    Horáčková, J.; Juřičková, L.; Šizling, A. L.; Jarošík, Vojtěch; Pyšek, Petr

    2014-01-01

    Roč. 9, č. 9 (2014), s. 1-10, e108296 E-ISSN 1932-6203 Institutional support: RVO:67985939 Keywords : plant invasions * land snails * impact Subject RIV: EF - Botanics Impact factor: 3.234, year: 2014

  12. Airline service quality performance reports

    Science.gov (United States)

    2002-01-01

    The purpose of this federal regulation (Citation 14CFR234) is to set forth required data that certain air carriers must submit to the Department of Transportation and to computer reservations system vendors in computerized form, except as otherwise p...

  13. Bias Corrected Spatially Downscaled Monthly CMIP5 Climate Projections

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This archive contains 234 projections of monthly BCSD CMIP5 projections of precipitation and monthly means of daily-average, daily maximum and daily minimum...

  14. Author template for journal articles

    African Journals Online (AJOL)

    Bojan

    2012-03-08

    Mar 8, 2012 ... Key words: Conjugated linoleic acid, Lactobacillus plantarum ZS2058, linoleate isomerase, purification, .... absorption of organic phase was determined at 234 nm. The ..... but the mechanism of such inhibition is unclear.

  15. effects of sulphur addition on addition on and mechanical properties

    African Journals Online (AJOL)

    User

    234-8034714355. 8034714355. 1. EFFECTS OF SULPHUR ADDITION ON. ADDITION ON. 2. AND MECHANICAL PROPERTIES O. 3. 4. C. W. Onyia. 5. 1DEPT. OF METALLURGICAL AND MATERIALS. 6. 2, 4DEPT. OF METALLURGICAL ...

  16. Microsatellite markers reveal low genetic differentiation among ...

    African Journals Online (AJOL)

    Camelus dromedarius) populations. Results from questionnaires on demography indicated that approximately 476 camels were extant in South Africa, Namibia and Botswana in 2003. We have sampled 234 camels for genetic analysis using a ...

  17. Agrawal, Prof. Hari Om

    Indian Academy of Sciences (India)

    Sc. (Holland), FNASc. Date of birth: 1 July 1936. Specialization: Virology, Microbiology, Environmental Sciences and Biotechnology Address: Sri Laxman Bhavan, 20/2, Indira Nagar, Lucknow 226 016, U.P.. Contact: Residence: (0522) 234 1586

  18. Download this PDF file

    African Journals Online (AJOL)

    cadewumi

    carbon nanotube and layered double hydroxide as a drug delivery system especially in ... Material and Methods: Transmission and field emission scanning electron ..... Handbook: Pages217–234; Inorganic Nanostructures for Drug Delivery.

  19. Tensor extension of the Poincare algebra

    Energy Technology Data Exchange (ETDEWEB)

    Soroka, Dmitrij V. [Kharkov Institute of Physics and Technology, 61108 Kharkov (Ukraine)]. E-mail: dsoroka@kipt.kharkov.ua; Soroka, Vyacheslav A. [Kharkov Institute of Physics and Technology, 61108 Kharkov (Ukraine)]. E-mail: vsoroka@kipt.kharkov.ua

    2005-02-10

    A tensor extension of the Poincare algebra is proposed for the arbitrary dimensions. Casimir operators of the extension are constructed. A possible supersymmetric generalization of this extension is also found in the dimensions D=2,3,4.

  20. African Journal of Physiotherapy and Rehabilitation Sciences: Contact

    African Journals Online (AJOL)

    Principal Contact. Prof. Arinola O. Sanya Editor In Chief College of Medicine, University of Ibadan Editor in Chief Department of Physiotherapy, College of Medicine University of Ibadan Ibadan Nigeria Phone: +234-8023278607. Email: arinsanya@yahoo.com ...

  1. Paradoxical antiproliferative effect by a murine mammary tumor-derived epithelial cell line

    Directory of Open Access Journals (Sweden)

    Scharovsky O Graciela

    2007-10-01

    Full Text Available Abstract Background Despite significant advancement in breast cancer therapy, there is a great need for a better understanding of the mechanisms involved in breast carcinogenesis and progression, as well as of the role of epigenetic contributions from stromal cells in mammary tumorigenesis. In this study, we isolated and characterized murine mammary tumor-derived epithelial and myofibroblast cell lines, and investigated the in vitro and in vivo effect of cellular soluble factors produced by the epithelial cell line on tumor cells. Methods Morphology, immunophenotype, cytogenetics, invasiveness, and tumorigenicity of epithelial (LM-234ep and myofibroblast (LM-234mf cell lines isolated from two murine mammary adenocarcinomas with common ancestor were studied. The in vitro effects of LM-234ep conditioned medium on proliferation, cell cycle distribution, and expression of cell cycle proteins, were investigated in LM-234mf cells, mouse melanoma cells (B16-F10, and human cervical adenocarcinoma cells (HeLa. The in vivo anti-tumor activity of LM-234ep conditioned media was evaluated in subcutaneous tumors formed in nude mice by B16-F10 and HeLa cells. Results LM-234ep cells were found to be cytokeratin positive and hipertriploid, whereas LM-234mf cells were α-smooth muscle actin positive and hypohexaploid. Chromosome aberrations were found in both cases. Only LM-234mf revealed to be invasive in vitro and to secrete active MMP-2, though neither of the cell types were able to produce progressing tumors. LM-234ep-derived factors were able to inhibit the in vitro growth of LM-234mf, B16-F10, and HeLa cells, inducing cell cycle arrest in G0/G1 phase. The administration of LM-234ep conditioned medium inhibited the growth of B16-F10 and HeLa tumors in nude mice. Conclusion Our data suggest the existence of epithelial cell variants with tumor suppressive properties within mammary tumors. To our knowledge, this is the first report showing antiproliferative and

  2. inal. articles

    African Journals Online (AJOL)

    persistent proteinuria was found in 23.4% (blacks 25%,. Indians 1 .2%) and .... GFR was assessed ll> •g ""'Tc- DTPA (normal range 98- 150 rnl/ min for men, 95 - .... Proteinuria. Persistent (p.p). 23.4 (11). 25.0 (9). 18.2 (2). Without retinopathy. 0 (0). 0 (0). 0 (0). Onset from DM diagnosis (yrs)* 11.4 ± 3.2 10.3 ± 2.1 16.5 ± 2.1.

  3. Emergency Preparedness: A Handbook for Families.

    Science.gov (United States)

    1982-06-01

    invaluable. Emergency medical supply kit: Adhesive tape, roll 2" wide Nose drops (water soluble) Applicators, sterile, cotton-tipped Petroleum jelly...Antiseptic solution Rubbing alcohol Antibiotics (prescribed) Smelling salts Aspirin tablets Safety pins, assorted sizes Bandage, sterile roll, 2" wide 8 oz...those found in a good first aid kit (bandages, antiseptics, etc.), plus all the items normally kept in a well-stocked home medicine chest ( aspirin

  4. Dicty_cDB: SFD417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n L-li... 232 1e-59 AY336797_1( AY336797 |pid:none) Rhipicephalus haemaphysaloides hae... 232 1e-59 protein ...59303_1( DQ459303 |pid:none) Aedes aegypti cathepsin L (CAT-L1)... 234 2e-60 AY336798_1( AY336798 |pid:none)... Rhipicephalus haemaphysaloides hae... 234 3e-60 AY795054_1( AY795054 |pid:none) Artemia franciscana catheps

  5. Estimates of micro-, nano-, and picoplankton contributions to particle export in the northeast Pacific

    OpenAIRE

    B. L. Mackinson; S. B. Moran; M. W. Lomas; G. M. Stewart; R. P. Kelly

    2014-01-01

    The contributions of micro-, nano-, and picoplankton to particle export were estimated from measurements of size-fractionated particulate 234Th, organic carbon, and phytoplankton indicator pigments obtained during five cruises between 2010 and 2012 along Line P in the subarctic northeast Pacific Ocean. Sinking fluxes of particulate organic carbon (POC) and indicator pigments were calculated from 234Th–238U disequilibria and, during two cruises, measured by s...

  6. Estimates of micro-, nano-, and picoplankton contributions to particle export in the northeast Pacific

    OpenAIRE

    B. L. Mackinson; S. B. Moran; M. W. Lomas; G. M. Stewart; R. P. Kelly

    2015-01-01

    The contributions of micro-, nano-, and picoplankton to particle export were estimated from measurements of size-fractionated particulate 234Th, organic carbon, and phytoplankton indicator pigments obtained during five cruises between 2010 and 2012 along Line P in the subarctic northeast Pacific Ocean. Sinking fluxes of particulate organic carbon (POC) and indicator pigments were calculated from 234Th–238U disequilibria and, during two cruises, measured by a sediment trap at...

  7. A Penetration Mechanics Database

    Science.gov (United States)

    1992-01-31

    Rockwell C is based on data in ASTM E-140.2 The conversion from tensile strengths was used for all materials and tensile strengths, even those producing...Jorgensen Company, 1986. 2. ASTM E-1 40, Standard Hardness Conversion Tables for Metals (Relationship Between Brinell Hardness. Vickers Hardness...425 * No. 2.3.4 2.3.4 C-II Sorensen, Klmsey, Sisby, Schleffler, Sherrick, and de Rossett (1991) 4 Test No. 6433 6434 6333 6335 6332 6334 6337 L (nun

  8. PSES-a Novel Prostate Specific Chimeric Enhancer for Prostate Cancer Gene Therapy

    Science.gov (United States)

    2007-02-01

    most new cancer diagnoses, aside from skin cancer, at 234,460 men in the United States and will be the second most common cause of cancer deaths at...that prostate cancer will account for the most new cancer diagnoses, aside from skin cancer, at 234,460 men in the United States and will be the second...prostatectomy, cryoablation therapy, external beam radiation and brachytherapy ; however, 25% of these men will experience biochemical disease recurrence

  9. 7 CFR 51.3209 - Damage.

    Science.gov (United States)

    2010-01-01

    ... larger onions; (d) Sunburn when dark green in color and affecting an area equivalent to that of a circle... equivalent to that of a circle 1/2 inch in diameter on an onion 23/4 inches in diameter which does not have... that of a circle 3/4 inch in diameter on an onion 23/4 inches in diameter which has the outer papery...

  10. Conceptual model: possible changes of the seawater uranium isotopic composition through time

    Energy Technology Data Exchange (ETDEWEB)

    Nowitzki, Hannah; Frank, Norbert; Fohlmeister, Jens [Universitaet Heidelberg (Germany)

    2015-07-01

    U behaves in seawater like a conservative element. More than 99% of the oceanic U content is {sup 238}U, whereas {sup 234}U is only present in trace amounts. As the residence time of U is significantly longer than the mixing time of the ocean, the ocean is well mixed with respect to U and its isotopic composition (Dunk 2002). Moreover, living corals incorporate U without isotopic fractionation. Therefore, the past seawater isotopic evolution of ({sup 234}U/{sup 238}U) can be accessed via U/Th age-dating of corals and the subsequent calculation of the initial ({sup 234}U/{sup 238}U) value. The isotopic ({sup 234}U/{sup 238}U) composition of seawater during the last 360 ka scatters around the modern seawater value (δ{sup 234}U ∼ (145±15) %, Henderson 2002). As these variations in the δ{sup 234}U value are rather small, a 'constant seawater isotopic composition hypothesis' is often used to validate U/Th ages of fossil corals. However, some authors find that the variability of the isotopic composition exceeds the expected range and suggest that it provides valuable information on variations in continental weathering and global run-off fluctuations or sea-level changes. This work will attempt to compare literature data of the seawater U isotopic composition to the results of a conceptual box-model of the oceanic U budget.

  11. Cytotoxic 2-phenyacrylnitriles, the importance of the cyanide moiety and discovery of potent broad spectrum cytotoxic agents.

    Science.gov (United States)

    Tarleton, Mark; Gilbert, Jayne; Sakoff, Jennette A; McCluskey, Adam

    2012-11-01

    We previously reported the discovery of a simple conjugated cyano pharmacophore which had led to the development of (Z)-2-(3,4-dichlorophenyl)-3-(4-nitrophenyl)acrylonitrile, as a selective inhibitor of oestrogen receptor positive (ER+ve) human breast cancer cell line, MCF-7. Further exploration though modification of the acrylonitrile and aromatic substituents has highlighted key structural components necessary for broad spectrum cytotoxicity. The acrylic acid derivates (Z)-2-(3,4-dichlorophenyl)-3-(4-nitrophenyl)acrylic acid and (Z)-2-(3,4-dichlorophenyl)-3-(4-methoxyphenyl)acrylic acid (9) were inactive; confirming the importance of the cyanide moiety. The most potent 2-phenylacrylonitriles synthesized were (Z)-2-(3,4-dichlorophenyl)-3-(1H-indol-3-yl)acrylonitrile and (Z)-2-(3,4-dichlorophenyl)-3-(1H-indol-5-yl)acrylonitrile (20) with an average GI(50) values of 1.4 and 0.53 μM respectively. Five additional (Z)-2-(3,4-dichlorophenyl)-3-(indolyl)acrylonitriles also displayed average GI(50) values of ≤8.4 μM. In the case of indole, this represents a 32-fold increase in broad spectrum cytotoxicity relative to the lead. Crown Copyright © 2012. Published by Elsevier Masson SAS. All rights reserved.

  12. Improved (225)Ac daughter retention in InPO4 containing polymersomes.

    Science.gov (United States)

    de Kruijff, R M; Drost, K; Thijssen, L; Morgenstern, A; Bruchertseifer, F; Lathouwers, D; Wolterbeek, H T; Denkova, A G

    2017-10-01

    Alpha-emitting radionuclides like actinium-225 ((225)Ac) are ideal candidates for the treatment of small metastasised tumours, where the long half-life of (225)Ac enables it to also reach less accessible tumours. The main challenge lies in retaining the recoiled alpha-emitting daughter nuclides, which are decoupled from targeting agents upon emission of an alpha particle and can subsequently cause unwanted toxicity to healthy tissue. Polymersomes, vesicles composed of amphiphilic block copolymers, are capable of transporting (radio)pharmaceuticals to tumours, and are ideal candidates for the retention of these daughter nuclides. In this study, the Geant4 Monte Carlo simulation package was used to simulate ideal vesicle designs. Vesicles containing an InPO4 nanoparticle in the core were found to have the highest recoil retention, and were subsequently synthesized in the lab. The recoil retention of two of the daughter nuclides, namely francium-221 ((221)Fr) and bismuth-213 ((213)Bi) was determined at different vesicle sizes. Recoil retention was found to have improved significantly, from 37 ± 4% and 22 ± 1% to 57 ± 5% and 40 ± 2% for (221)Fr and (213)Bi respectively for 100nm polymersomes, as compared to earlier published results by Wang et al. where (225)Ac was encapsulated using a hydrophilic chelate (Wang et al. 2014). To better understand the different parameters influencing daughter retention, simulation data was expanded to include vesicle polydispersity and nanoparticle position within the polymersome. The high retention of the recoiling daughters and the (225)Ac itself makes this vesicle design very suitable for future in vivo verification. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Efforts to control the errant products of a targeted in vivo generator.

    Science.gov (United States)

    Jaggi, Jaspreet Singh; Kappel, Barry J; McDevitt, Michael R; Sgouros, George; Flombaum, Carlos D; Cabassa, Catalina; Scheinberg, David A

    2005-06-01

    Alpha-particle immunotherapy by targeted alpha-emitters or alpha-emitting isotope generators is a novel form of extraordinarily potent cancer therapy. A major impediment to the clinical use of targeted actinium-225 (225Ac) in vivo generators may be the radiotoxicity of the systemically released daughter radionuclides. The daughters, especially bismuth-213 (213Bi), tend to accumulate in the kidneys. We tested the efficacy of various pharmacologic agents and the effect of tumor burden in altering the pharmacokinetics of the 225Ac daughters to modify their renal uptake. Pharmacologic treatments in animals were started before i.v. administration of the HuM195-225Ac generator. 225Ac, francium-221 (221Fr), and 213Bi biodistributions were calculated in each animal at different time points after 225Ac generator injection. Oral metal chelation with 2,3-dimercapto-1-propanesulfonic acid (DMPS) or meso-2,3-dimercaptosuccinic acid (DMSA) caused a significant reduction (P < 0.0001) in the renal 213Bi uptake; however, DMPS was more effective than DMSA (P < 0.001). The results with DMPS were also confirmed in a monkey model. The renal 213Bi and 221Fr activities were significantly reduced by furosemide and chlorothiazide treatment (P < 0.0001). The effect on renal 213Bi activity was further enhanced by the combination of DMPS with either chlorothiazide or furosemide (P < 0.0001). Competitive antagonism by bismuth subnitrate moderately reduced the renal uptake of 213Bi. The presence of a higher target-tumor burden significantly prevented the renal 213Bi accumulation (P = 0.003), which was further reduced by DMPS treatment (P < 0.0001). Metal chelation, diuresis with furosemide or chlorothiazide, and competitive metal blockade may be used as adjuvant therapies to modify the renal accumulation of 225Ac daughters.

  14. A survey of arsenic, manganese, boron, thorium, and other toxic metals in the groundwater of a West Bengal, India neighbourhood.

    Science.gov (United States)

    Bacquart, Thomas; Bradshaw, Kelly; Frisbie, Seth; Mitchell, Erika; Springston, George; Defelice, Jeffrey; Dustin, Hannah; Sarkar, Bibudhendra

    2012-07-01

    Around 150 million people are at risk from arsenic-contaminated groundwater in India and Bangladesh. Multiple metal analysis in Bangladesh has found other toxic elements above the World Health Organization (WHO) health-based drinking water guidelines which significantly increases the number of people at risk due to drinking groundwater. In this study, drinking water samples from the Bongaon area (North 24 Parganas district, West Bengal, India) were analyzed for multiple metal contamination in order to evaluate groundwater quality on the neighbourhood scale. Each sample was analyzed for arsenic (As), boron (B), barium (Ba), chromium (Cr), manganese (Mn), molybdenum (Mo), nickel (Ni), lead (Pb), and uranium (U). Arsenic was found above the WHO health-based drinking water guideline in 50% of these tubewells. Mn and B were found at significant concentrations in 19% and 6% of these tubewells, respectively. The maps of As, Mn, and B concentrations suggest that approximately 75% of this area has no safe tubewells. The concentrations of As, Mn, B, and many other toxic elements are independent of each other. The concentrations of Pb and U were not found above WHO health-based drinking water guidelines but they were statistically related to each other (p-value = 0.001). An analysis of selected isotopes in the Uranium, Actinium, and Thorium Radioactive Decay Series revealed the presence of thorium (Th) in 31% of these tubewells. This discovery of Th, which does not have a WHO health-based drinking water guideline, is a potential public health challenge. In sum, the widespread presence and independent distribution of other metals besides As must be taken into consideration for drinking water remediation strategies involving well switching or home-scale water treatment.

  15. Determination of uranium concentration in ground water samples of Northern Greece

    Directory of Open Access Journals (Sweden)

    Pashalidis I.

    2012-04-01

    Full Text Available The activity concentration of 238U and 234U has been determined in groundwater samples of hot springs and deep wells from the region of Northern Greece. The analysis was performed by alpha spectroscopy after pre-concentration and separation of uranium by cation exchange (Chelex 100 resin and finally its electro-deposition on stainless steel discs. The uranium concentration in deep wells and springs varies strongly between 0.15 and 7.66 μg l−1. Generally the springs present higher uranium concentration than the deep wells, except of the Apol-lonia spring, which has shown the lowest value of 0.15 mg l−1. 238U and 234U activity concentration ranged between 1.8–95.3 mBq l−1 and 1.7–160.1 mBq l−1, respectively. The obtained isotopic ratio 234U/238U varies between 0.95 and 1.74 which means that the two isotopes are not in radioactive equilibrium. The highest 234U/238U activity ratio values correspond to the Langada springs, indicating most probably old-type waters. On the other hand, ground waters from wells with relatively low uranium activity concentration and low 234U/238U isotopic ratios, point to the presence of younger waters with a stronger contribution of a local recharge component to the groundwater.

  16. Migration behavior of naturally occurring radionuclides at the Nopal I uranium deposit, Chihuahua, Mexico

    Science.gov (United States)

    Prikryl, James D.; Pickett, David A.; Murphy, William M.; Pearcy, English C.

    1997-04-01

    Oxidation of pyrite at the Nopal I uranium deposit, Peña Blanca district, Chihuahua, Mexico has resulted in the formation of Fe-oxides/hydroxides. Anomalous U concentrations (i.e. several hundred to several thousand ppm) measured in goethite, hematite, and amorphous Fe-oxyhydroxides in a major fracture that crosscuts the deposit and the absence of U minerals in the fracture suggest that U was retained during secondary mineral growth or sorbed on mineral surfaces. Mobilization and transport of U away from the deposit is suggested by decreasing U concentrations in fracture-infilling materials and in goethite and hematite with distance from the deposit. Greater than unity {234U}/{238U} activity ratios measured in fracture-infilling materials indicate relatively recent ( < 1 Ma) U uptake from fluids that carried excess 234U. Systematic decreases in {234U}/{238U} activity ratios of fracture materials with distance from the deposit suggest a multistage mobilization process, such as remobilization of U from 234U-enriched infill minerals or differential or diminished transport of U-bearing solutions containing excess 234U.

  17. Sexual victimization: incidence, knowledge and resource use among a population of college women.

    Science.gov (United States)

    Nasta, Aarti; Shah, Brijen; Brahmanandam, Shoma; Richman, Katherine; Wittels, Kathleen; Allsworth, Jenifer; Boardman, Lori

    2005-04-01

    To assess the incidence of sexual victimization among a convenience sample of college women and evaluate both victims and non-victims' knowledge and use of available on and off campus resources. Written questionnaire distributed to students in lobbies of two campus libraries and large computing center A private northeastern university Upper-class undergraduate women (sophomores, juniors and seniors) Respondents (n=234) were asked to complete demographic information, report instances of sexual victimization (including rape, sexual coercion and unwanted sexual contact) that occurred during the 1999-2000 academic year and indicate whether they would or did use either university and/or outside resources available to sexual assault victims. Of the women who participated, 38% (90/234) affirmed one or more episodes of sexual victimization, with 6% (14/234) reporting a completed rape and 4% (9/234) an attempted rape. Drug or alcohol-related impairment leading to unwanted sexual activity was reported by 15% (35/234) of women. Utilization of available on- and off-campus resources was uncommon among victims (22% and 6%, respectively); 12% contacted health services, while only 4% reported an event to university security. Victims cited fear, embarrassment and guilt, as well as lack of confidentiality, as the most common reasons for failure to use resources. Increasing campus awareness of sexual victimization and removing barriers to access for victims should remain university goals.

  18. The uranium behaviour during rock-water interaction in the granites from the Itu complex (Sao Paulo, Brazil): a laboratory study

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Helen S.B. da; Marques, Leila S.; Kawauchi, Roberto K., E-mail: leila@iag.usp.br, E-mail: keiji@iag.usp.br [Instituto de Astronomia, Geofisica e Ciencias Atmosfericas. Universidade de Sao Paulo (USP), SP (Brazil)

    2011-07-01

    In order to elucidate the mechanisms involved in the process of uranium leaching due to the rock-water interaction in the granitic rocks from Itu Complex (Sao Paulo, Brazil), an experimental arrangement was developed and built. About 2.5kg of crushed rock fragments from Cabreuva and Indaiatuba Intrusions were maintained at room temperature within a glass flask filled with circulating water. The percolating water was removed periodically (from 10 to 30 days) for uranium analysis and then replaced by an equal volume of fresh water. Alpha spectrometry was used to determine the activity concentrations of {sup 234}U and {sup 238}U, and {sup 234}U/{sup 238}U activity ratios, of the waters as well as of the granites. The results for both samples showed that most of the uranium is leached in the first days after the contact between rock and water. The {sup 234}U/{sup 238}U activity ratios were significantly greater than unity, indicating radioactive disequilibrium between those isotopes, probably due to alpha recoil. Although the uranium activity concentrations in the water samples diminished with the increasing of time, it was not observed considerable variations of the {sup 234}U/{sup 238}U activity ratios. It was also noticed that, the amount of leached uranium as well as the {sup 234}U/{sup 238}U activity ratios are characteristics of each sample submitted to leaching, reflecting the differences of the granite facies mineralogy.(author)

  19. Analogue studies in the alligator rivers region. In-situ measurement of uranium series nuclides with SHRIMP

    Energy Technology Data Exchange (ETDEWEB)

    Nagano, Tetsushi; Yanase, Nobuyuki; Ohnuki, Toshihiko [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Tsutomu; Isobe, Hiroshi; Williams, I.S.; Zaw, M.; Payne, T.E.; Airey, P.L.

    1999-03-01

    The SHRIMP analyses have been conducted for rock samples from the Koongarra secondary ore deposit to obtain activity ratios of {sup 234}U/{sup 238}U and isotopic ratios of {sup 207}Pb/{sup 206}Pb and {sup 204}Pb/{sup 206}Pb. Target minerals for the analyses were iron minerals and kaolinite, which are the main weathering products in this area. The activity ratios of {sup 234}U/{sup 238}U were obtained based on counts at masses of uranium metal. The {sup 234}U/{sup 238}U activity ratios based on counts of uranium oxides were not appropriate, because count rates of {sup 234}U{sup 16}O were interfered by those of {sup 238}U{sup 12}C molecule. The activity ratios of {sup 234}U/{sup 238}U were approximately unity for crystalline iron nodules. This fact suggested that the mean residence time of uranium within the iron nodules was at least 1 million years. On the other hand, slightly higher values than unity were obtained for kaolinite. Lead isotopes were investigated and a positive relationship was recognized between {sup 207}Pb/{sup 206}Pb and {sup 204}Pb/{sup 206}Pb isotope ratios. (author)

  20. Fission fragments mass distributions of nuclei populated by the multinucleon transfer channels of the {sup 18}O + {sup 232}Th reaction

    Energy Technology Data Exchange (ETDEWEB)

    Léguillon, R. [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan); Nishio, K., E-mail: nishio.katsuhisa@jaea.go.jp [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan); Hirose, K.; Makii, H.; Nishinaka, I.; Orlandi, R.; Tsukada, K. [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan); Smallcombe, J. [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan); TRIUMF, Vancouver, British Columbia V6T 2A3 (Canada); Chiba, S. [Laboratory for Advanced Nuclear Energy, Institute for Innovative Research, Tokyo Institute of Technology, N1-9, 2-12-1 Ookayama, Meguro, Tokyo 152-8550 (Japan); Aritomo, Y. [Faculty of Science and Engineering, Kindai University, Higashi-Osaka, 577-8502 (Japan); Ohtsuki, T. [Research Reactor Institute, Kyoto University, Kumatori-cho, Sennangun, Osaka 590-0494 (Japan); Tatsuzawa, R.; Takaki, N. [Graduate School of Engineering, Tokyo City University, Tokyo 158-8557 (Japan); Tamura, N.; Goto, S. [Graduate School of Science and Technology, Niigata University, Niigata 950-2181 (Japan); Tsekhanovich, I. [University of Bordeaux, 351 Cours de la Libration, 33405 Talence Cedex (France); Petrache, C.M. [Centre des Sciences Nucléaire et des Sciences de la Matière, Université Paris-Saclay, CNRS/IN2P3, 91406 Orsay (France); Andreyev, A.N. [Department of Physics, University of York, Heslington, York, YO10 5DD (United Kingdom); Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan)

    2016-10-10

    It is shown that the multinucleon transfer reactions is a powerful tool to study fission of exotic neutron-rich actinide nuclei, which cannot be accessed by particle-capture or heavy-ion fusion reactions. In this work, multinucleon transfer channels of the {sup 18}O + {sup 232}Th reaction are used to study fission of fourteen nuclei {sup 231,232,233,234}Th, {sup 232,233,234,235,236}Pa, and {sup 234,235,236,237,238}U. Identification of fissioning nuclei and of their excitation energy is performed on an event-by-event basis, through the measurement of outgoing ejectile particle in coincidence with fission fragments. Fission fragment mass distributions are measured for each transfer channel, in selected bins of excitation energy. In particular, the mass distributions of {sup 231,234}Th and {sup 234,235,236}Pa are measured for the first time. Predominantly asymmetric fission is observed at low excitation energies for all studied cases, with a gradual increase of the symmetric mode towards higher excitation energy. The experimental distributions are found to be in general agreement with predictions of the fluctuation–dissipation model.

  1. Fission fragments mass distributions of nuclei populated by the multinucleon transfer channels of the 18O+232Th reaction

    Directory of Open Access Journals (Sweden)

    R. Léguillon

    2016-10-01

    Full Text Available It is shown that the multinucleon transfer reactions is a powerful tool to study fission of exotic neutron-rich actinide nuclei, which cannot be accessed by particle-capture or heavy-ion fusion reactions. In this work, multinucleon transfer channels of the 18O+232Th reaction are used to study fission of fourteen nuclei 231,232,233,234Th, 232,233,234,235,236Pa, and 234,235,236,237,238U. Identification of fissioning nuclei and of their excitation energy is performed on an event-by-event basis, through the measurement of outgoing ejectile particle in coincidence with fission fragments. Fission fragment mass distributions are measured for each transfer channel, in selected bins of excitation energy. In particular, the mass distributions of 231,234Th and 234,235,236Pa are measured for the first time. Predominantly asymmetric fission is observed at low excitation energies for all studied cases, with a gradual increase of the symmetric mode towards higher excitation energy. The experimental distributions are found to be in general agreement with predictions of the fluctuation–dissipation model.

  2. Development of Fermented Taro as a Food Preservative Ingredient in Intermediate Moisture Products

    Science.gov (United States)

    2005-11-01

    peeled it is cut into approximately 2" x 2" x 2" pieces. The pieces of corm are then put through a meat grinder three times. The fermentation of the...100 AU/g 300AU/g (%) w/taro (%) Burrito (%) Burrito (%) *Meat mix 45.52 43.52 44.52 43.52 Tomato paste 16.96 16.25 16.96 16.25 Dehy. onion 0.78...Meat mix 45.52 40.0 40.0 34.0 Tomato paste 16.96 15.0 15.0 14.0 Dehy. onion 0.78 0.78 0.78 0.78 Chili powder 0.78 0.78 0.78 0.78 Dehy. pepper

  3. Tritium Facilities Modernization and Consolidation Project Process Waste Assessment (Project S-7726)

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, R.H. [Westinghouse Savannah River Company, AIKEN, SC (United States); Oji, L.N.

    1997-11-14

    Under the Tritium Facility Modernization {ampersand} Consolidation (TFM{ampersand}C) Project (S-7726) at the Savannah River Site (SS), all tritium processing operations in Building 232-H, with the exception of extraction and obsolete/abandoned systems, will be reestablished in Building 233-H. These operations include hydrogen isotopic separation, loading and unloading of tritium shipping and storage containers, tritium recovery from zeolite beds, and stripping of nitrogen flush gas to remove tritium prior to stack discharge. The scope of the TFM{ampersand}C Project also provides for a new replacement R&D tritium test manifold in 233-H, upgrading of the 233- H Purge Stripper and 233-H/234-H building HVAC, a new 234-H motor control center equipment building and relocating 232-H Materials Test Facility metallurgical laboratories (met labs), flow tester and life storage program environment chambers to 234-H.

  4. A simple method for the absolute determination of uranium enrichment by high-resolution {gamma} spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Korob, R.O. [Unidad de Actividad Radioquimica y Quimica de las Radiaciones, Comision Nacional de Energia Atomica, Centro Atomico Ezeiza, Presbitero Juan Gonzalez y Aragon No. 15 Partido de Ezeiza, Provincia de Buenos Aires (Argentina)]. E-mail: korob@cae.cnea.gov.ar; Blasiyh Nuno, G.A. [Unidad de Actividad Gestion de Residuos Radiactivos, Comision Nacional de Energia Atomica, Centro Atomico Ezeiza, Presbitero Juan Gonzalez y Aragon No. 15 Partido de Ezeiza, Provincia de Buenos Aires (Argentina)

    2006-05-15

    A simple method for the determination of uranium enrichment using high-resolution {gamma} spectrometry is presented in this paper. The method relies solely on the {gamma}-ray emission probabilities of {sup 235}U and {sup 234m}Pa, and an iterative procedure for the least squares fit of a polynomial to a set of experimentally determined data. To ensure the reliability of the {sup 234m}Pa {gamma}-ray emission probabilities employed, a new determination of these probabilities was carried out using a combination of {gamma} spectrometry and Cerenkov counting of a purified {sup 234}Th solution. Using these new data, a maximum difference of {approx}5% has been found between the experimental and declared uranium enrichment in a set of solid and liquid samples containing uranium compounds.

  5. Latitudinal distributions of particulate carbon export across the North Western Atlantic Ocean

    Science.gov (United States)

    Puigcorbé, Viena; Roca-Martí, Montserrat; Masqué, Pere; Benitez-Nelson, Claudia; Rutgers van der Loeff, Michiel; Bracher, Astrid; Moreau, Sebastien

    2017-11-01

    234Th-derived carbon export fluxes were measured in the Atlantic Ocean under the GEOTRACES framework to evaluate basin-scale export variability. Here, we present the results from the northern half of the GA02 transect, spanning from the equator to 64°N. As a result of limited site-specific C/234Th ratio measurements, we further combined our data with previous work to develop a basin wide C/234Th ratio depth curve. While the magnitude of organic carbon fluxes varied depending on the C/234Th ratio used, latitudinal trends were similar, with sizeable and variable organic carbon export fluxes occurring at high latitudes and low to negligible fluxes occurring in oligotrophic waters. Our results agree with previous studies, except at the boundaries between domains, where fluxes were relatively enhanced. Three different models were used to obtain satellite-derived net primary production (NPP). In general, NPP estimates had similar trends along the transect, but there were significant differences in the absolute magnitude depending on the model used. Nevertheless, organic carbon export efficiencies were generally models from Dunne et al. (2005) (D05), Laws et al. (2011) (L11) and Henson et al. (2011) (H11) were also compared to our 234Th-derived carbon exports fluxes. D05 and L11 provided estimates closest to values obtained with the 234Th approach (within a 3-fold difference), but with no clear trends. The H11 model, on the other hand, consistently provided lower export estimates. The large increase in export data in the Atlantic Ocean derived from the GEOTRACES Program, combined with satellite observations and modeling efforts continue to improve the estimates of carbon export in this ocean basin and therefore reduce uncertainty in the global carbon budget. However, our results also suggest that tuning export models and including biological parameters at a regional scale is necessary for improving satellite-modeling efforts and providing export estimates that are more

  6. Uranium comminution age tested by the eolian deposits on the Chinese Loess Plateau

    Science.gov (United States)

    Li, Le; Liu, Xiangjun; Li, Tao; Li, Laifeng; Zhao, Liang; Ji, Junfeng; Chen, Jun; Li, Gaojun

    2017-06-01

    The 234U/238U ratio of fine particles can record the time since their separation from bed rock because of the disruption of uranium series equilibrium introduced by the recoil of daughter 234Th nuclei (precursor of 234U) out of particle surfaces during the decay of 238U. Application of the uranium comminution age method, which has great potential in tracing production and transportation of sediments is however complicated by the weathering dissolution of 234U depleted particle surfaces, the difficulty in determining the fraction of recoiled nuclei, and the precipitation of exogenetic 234U. Here we minimize these complications by using a newly developed precise size separation using electroformed sieve, and a chemical protocol that involves reductive and oxidative leaching. Eolian deposits collected from the Chinese Loess Plateau (CLP) were used to test the validity of our method. Possible effects of weathering dissolution were also evaluated by comparing samples with different weathering intensities. The results show decreasing 234U/238U ratios in fine eolian particles with increasing sedimentation age, agreeing well with the theoretical prediction of the comminution age model. This successful application of the uranium comminution age approach to the eolian deposits on the CLP is also aided by a stable dust source, the low weathering intensity, the lack of consolidation, and the well-defined age model of the deposits. A transportation time of 242 ± 18 ka was calculated for the eolian deposits, which indicates a long residence time, and thus extensive mixing, of the dust particles in source regions, partly explaining the stable and homogeneous composition of the eolian dust over glacial-interglacial cycles.

  7. Particulate organic carbon export across the Antarctic Circumpolar Current at 10°E: Differences between north and south of the Antarctic Polar Front

    Science.gov (United States)

    Puigcorbé, Viena; Roca-Martí, Montserrat; Masqué, Pere; Benitez-Nelson, Claudia R.; Rutgers v. d. Loeff, Michiel; Laglera, Luis M.; Bracher, Astrid; Cheah, Wee; Strass, Volker H.; Hoppema, Mario; Santos-Echeandía, Juan; Hunt, Brian P. V.; Pakhomov, Evgeny A.; Klaas, Christine

    2017-04-01

    The vertical distribution of 234Th was measured along the 10°E meridian between 44°S and 53°S in the Antarctic Circumpolar Current (ACC) during the austral summer of 2012. The overarching goal of this work was to estimate particulate organic carbon (POC) export across three fronts: the Sub-Antarctic Front (SAF), the Antarctic Polar Front (APF) and the Southern Polar Front (SPF). Steady state export fluxes of 234Th in the upper 100 m ranged from 1600 to 2600 dpm m-2 d-1, decreasing with increasing latitude. Using large particle (>53 μm) C/234Th ratios, the 234Th-derived POC fluxes at 100 m ranged from 25 to 41 mmol C m-2 d-1. Observed C/234Th ratios decreased with increasing depth north of the APF while south of the APF, ratios remained similar or even increased with depth. These changes in C/234Th ratios are likely due to differences in the food web. Indeed, satellite images, together with macronutrients and dissolved iron concentrations suggest two different planktonic community structures north and south of the APF. Our results indicate that higher ratios of POC flux at 100 m to primary production occurred in nanophytoplankton dominated surface waters, where primary production rates were lower. Satellite images prior to the expedition suggest that the higher export efficiencies obtained in the northern half of the transect may be the result of the decoupling between production and export (Buesseler 1998). Transfer efficiencies to 400 m, i.e. the fraction of exported POC that reached 400 m, were found to be higher south of the APF, where diatoms were dominant and salps largely abundant. This suggests different remineralization pathways of sinking particles, influencing the transfer efficiency of exported POC to depth.

  8. An Mcm10 Mutant Defective in ssDNA Binding Shows Defects in DNA Replication Initiation.

    Science.gov (United States)

    Perez-Arnaiz, Patricia; Kaplan, Daniel L

    2016-11-20

    Mcm10 is an essential protein that functions to initiate DNA replication after the formation of the replication fork helicase. In this manuscript, we identified a budding yeast Mcm10 mutant (Mcm10-m2,3,4) that is defective in DNA binding in vitro. Moreover, this Mcm10-m2,3,4 mutant does not stimulate the phosphorylation of Mcm2 by Dbf4-dependent kinase (DDK) in vitro. When we expressed wild-type levels of mcm10-m2,3,4 in budding yeast cells, we observed a severe growth defect and a substantially decreased DNA replication. We also observed a substantially reduced replication protein A- chromatin immunoprecipitation signal at origins of replication, reduced levels of DDK-phosphorylated Mcm2, and diminished Go, Ichi, Ni, and San (GINS) association with Mcm2-7 in vivo. mcm5-bob1 bypasses the growth defect conferred by DDK-phosphodead Mcm2 in budding yeast. However, the growth defect observed by expressing mcm10-m2,3,4 is not bypassed by the mcm5-bob1 mutation. Furthermore, origin melting and GINS association with Mcm2-7 are substantially decreased for cells expressing mcm10-m2,3,4 in the mcm5-bob1 background. Thus, the origin melting and GINS-Mcm2-7 interaction defects we observed for mcm10-m2,3,4 are not explained by decreased Mcm2 phosphorylation by DDK, since the defects persist in an mcm5-bob1 background. These data suggest that DNA binding by Mcm10 is essential for the initiation of DNA replication. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Thermography Control of Heat Insulation and Tightness of Buildings,

    Science.gov (United States)

    1980-11-01

    Fan 5 mm asbestos cement panel ( eternite) 8 mm air space 2" x 6" wood bolt 3.2 mm panel, asbestos-cellulose-cement (Internit) 3 120 mm rockwool ...panel, bulk density 50 kg/m 2" x 4" radiator support Vapor barrier, plastic foil 13 mm gypsum panel 10 mm particle board 40 mm rockwool panel -- 6- - ! T...34,...................I’ ." .f ’ 1 ’k"oM bulk density 1,600 kg/m 3 30 MM ,,, l,,loig s,-,,: ....... 6o ’ 10 mm particle board 10m....... 40 mm rockwool panel, bulk

  10. Surfaces de del Pezzo sans point rationnel sur un corps de dimension cohomologique un

    OpenAIRE

    Colliot-Thelene, Jean-Louis; Madore, David A.

    2003-01-01

    For each integer d=2,3,4, there exists a field F with cohomological dimension 1 and a del Pezzo surface of degree d over F having no rational point. Proofs use the theorem of Merkur'ev and Suslin, the Riemann-Roch theorem on a surface and Rost's degree formula. ----- Pour chaque entier d=2,3,4, il existe un corps F de dimension cohomologique 1 et une surface de del Pezzo de degre d sur F sans point rationnel. Les demonstrations utilisent le theoreme de Merkur'ev et Suslin, le theoreme de Riem...

  11. Synergistic and Additive Properties of the Beta-Globin Locus Control Region (LCR) Revealed by 5′HS3 Deletion Mutations: Implication for LCR Chromatin Architecture

    OpenAIRE

    Fang, Xiangdong; Sun, Jin; Xiang, Ping; Yu, Man; Navas, Patrick A.; Peterson, Kenneth R.; Stamatoyannopoulos, George; Li, Qiliang

    2005-01-01

    Deletion of the 234-bp core element of the DNase I hypersensitive site 3 (5′HS3) of the locus control region (LCR) in the context of a human beta-globin locus yeast artificial chromosome (β-YAC) results in profound effects on globin gene expression in transgenic mice. In contrast, deletion of a 2.3-kb 5′HS3 region, which includes the 234-bp core sequence, has a much milder phenotype. Here we report the effects of these deletions on chromatin structure in the beta-globin locus of adult erythro...

  12. Multifunctional Materials Held in Boston, Massachusetts on November 29- December 1 1989. Materials Research Proceedings. Volume 175

    Science.gov (United States)

    1991-02-01

    the influence of heat and pressure. During this process, volat 1les were evaporated and the porous structure was densified by stntering. Figure 2...34 2"CH1-(.CH2CH1_- I I I 1 - X \\CH / CH2 CH3 0, R’-N CH3 0 2 ’ R= P-NAn-PVA NO2 F D N02 1 NaHCO3 ................ CH3O\\ R’ PVA CHH3 2N’C ---DN02...carbonate. The potassium carboxylate end groups of the oligomer were then acidified by neutralizing with aqueous HCl to a slightly acidic pH. The carboxyl

  13. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  14. Determination of 210Pb, 210Po, 226Ra, 228Ra and uranium isotopes in drinking water in order to comply with the requirements of the EU ‘Drinking Water Directive.

    Science.gov (United States)

    Vasile, M; Loots, H; Jacobs, K; Verheyen, L; Sneyers, L; Verrezen, F; Bruggeman, M

    2016-03-01

    The European Union published in 2013 a new Drinking Water Directive with stricter requirements for measuring natural radioactivity. In order to adhere to this, a method for sequential separation of 210Pb, 210Po, 238U and 234U in drinking water was applied using UTEVA® and Sr resins. Polonium-210, 238U and 234U were quantified using alpha-particle spectrometry and 210Pb using liquid scintillation counting. Radium-226 and 228Ra were determined using 3M Empore Radium RAD Disks, and their quantification was done using a Quantulus™ 1220 liquid scintillation counter.

  15. Copper and manganese in loggerhead turtles (Caretta caretta tissues in the Mediterranean

    Directory of Open Access Journals (Sweden)

    Z.K. ANTONIOU

    2004-06-01

    Full Text Available The natural radionuclides 238U ,234Th, 40K and the main man-made 137Cs, have been studied inMytilus galloprovincialis (Lamarck, 1819 sampled in the Thermaikos gulf – North Aegean Sea, considered as a bioindicator for radiological assessment in the Mediterranean. The ratio 234U/238U has also been determined. In terms of 137Cs, the activity concentrations in seawater from the studied area have been measured as well, and the concentration factors of 137Cs in Mytilus galloprovincialis are given as a parameter of the organism response to radioactive pollution.

  16. Hydroxyzine induced pancytopenia and petechial rashes: a rare complication

    Directory of Open Access Journals (Sweden)

    Ihsan Ates

    2016-09-01

    Full Text Available Hydroxyzine is used as an additional treatment both in symptomatic treatment of anxiety and stress caused by psychoneurosis and in organic diseases which anxiety appeared. It is used to treat pruritis caused by histamine and such allergic cases like chronic urticaria because of antihistaminic effect, atopic and contact dermatitis. In this case report, that widespread milimetric petechial rashes in all body and deep pancytopnia development is seen in a patient using hydroxyzine tablet because of pruritis at joints is disscussed. [J Contemp Med 2016; 6(3.000: 234-234

  17. Methods for obtaining sorption data from uranium-series disequilibria

    Energy Technology Data Exchange (ETDEWEB)

    Finnegan, D.L.; Bryant, E.A.

    1987-12-01

    Two possible methods have been identified for obtaining in situ retardation factors from measurements of uranium-series disequilibria at Yucca Mountain. The first method would make use of the enhanced {sup 234}U/{sup 238}U ratio in groundwater to derive a signature for exchangeable uranium sorbed on the rock; the exchangeable uranium would be leached and assayed. The second method would use the ratio of {sup 222}Rn to {sup 234}U in solution, corrected for weathering, to infer the retardation factor for uranium. Similar methods could be applied to thorium and radium.

  18. Drug: D00775 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00775 Drug Riluzole (JAN/USAN/INN); Rilutek (TN) C8H5F3N2OS 234.0075 234.1983 D007...nervous system and sensory organs 11 Agents affecting central nervous system 119 Miscellaneous 1190 Miscellaneous D00775 Riluz...Other nervous system drugs N07XX02 Riluzole D00775 Riluzole (JAN/USAN/INN) USP drug classification [BR:br083...02] Central Nervous System Agents Central Nervous System, Other Riluzole D00775 Riluzole (JAN/USAN/INN) CAS:

  19. Gclust Server: 89266 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 89266 DPTM_GSPATP00009171001 Cluster Sequences Related Sequences(234) 565 no annota...tion 1 1.00e-60 0.0 11.11 0.0 0.0 0.0 0.0 Show 89266 Cluster ID 89266 Sequence ID DPTM_GSPATP00009171001 Link to clus...ter sequences Cluster Sequences Link to related sequences Related Sequences(234) Sequence length 56...5 Representative annotation no annotation Number of Sequences 1 Homologs 1 Cluste....0 Number of Sequences for each species DPTM: 1 Species not appearing in this cluster ATH: 0 OSA: 0 PoTR: 0

  20. Impact of Structural Damping Nonlinearity in Transonic Limit Cycle Oscillations (LCO)

    Science.gov (United States)

    2005-09-01

    respect to t, 31 = sgn(y𔃼 - y•) during slip (2-34a) and 1F31-1 < .s 1/ tD during stick. (2-34b) Note in particular from Eq. (2-32)-(2-34) that the...Specifically, when t=0 and t-= At x(t,+,) = x, = x. + aAt + bAt2 + cAt 3 (2-27a) i(t) = vo = a (2-27b) .*(tQ5 ) = v, = a + 2bAt + 3cAt 2 (2-27c) Equation (2

  1. DNA double strand breaks as predictor of efficacy of the alpha-particle emitter Ac-225 and the electron emitter Lu-177 for somatostatin receptor targeted radiotherapy.

    Directory of Open Access Journals (Sweden)

    Franziska Graf

    Full Text Available RATIONALE: Key biologic effects of the alpha-particle emitter Actinium-225 in comparison to the beta-particle emitter Lutetium-177 labeled somatostatin-analogue DOTATOC in vitro and in vivo were studied to evaluate the significance of γH2AX-foci formation. METHODS: To determine the relative biological effectiveness (RBE between the two isotopes (as - biological consequence of different ionisation-densities along a particle-track, somatostatin expressing AR42J cells were incubated with Ac-225-DOTATOC and Lu-177-DOTATOC up to 48 h and viability was analyzed using the MTT assay. DNA double strand breaks (DSB were quantified by immunofluorescence staining of γH2AX-foci. Cell cycle was analyzed by flow cytometry. In vivo uptake of both radiolabeled somatostatin-analogues into subcutaneously growing AR42J tumors and the number of cells displaying γH2AX-foci were measured. Therapeutic efficacy was assayed by monitoring tumor growth after treatment with activities estimated from in vitro cytotoxicity. RESULTS: Ac-225-DOTATOC resulted in ED50 values of 14 kBq/ml after 48 h, whereas Lu-177-DOTATOC displayed ED50 values of 10 MBq/ml. The number of DSB grew with increasing concentration of Ac-225-DOTATOC and similarly with Lu-177-DOTATOC when applying a factor of 700-fold higher activity compared to Ac-225. Already 24 h after incubation with 2.5-10 kBq/ml, Ac-225-DOTATOC cell-cycle studies showed up to a 60% increase in the percentage of tumor cells in G2/M phase. After 72 h an apoptotic subG1 peak was also detectable. Tumor uptake for both radio peptides at 48 h was identical (7.5%ID/g, though the overall number of cells with γH2AX-foci was higher in tumors treated with 48 kBq Ac-225-DOTATOC compared to tumors treated with 30 MBq Lu-177-DOTATOC (35% vs. 21%. Tumors with a volume of 0.34 ml reached delayed exponential tumor growth after 25 days (44 kBq Ac-225-DOTATOC and after 21 days (34 MBq Lu-177-DOTATOC. CONCLUSION: γH2AX-foci formation, triggered

  2. Study of the production of residual evaporation nuclei issued from the spallation reaction of uranium-238 by 1 GeV protons; Etude de la production de noyaux residuels d'evaporation issus de la reaction de spallation de l'uranium-238 par des protons a 1 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Taieb, J

    2000-10-01

    The spallation reaction by high energy protons is one of the envisaged nuclear reactions for production of exotic nuclei. We have measured the production of more than 300 different evaporation residues issued by the spallation reaction of Uranium-238 by 1 GeV protons. We used the reverse kinematics technique in order to produce the relativistic nuclei and therefore to be able to detect those nuclides within a very short time, shorter in most cases than the radioactive disintegration period. The achieved nuclear charge and mass resolution are excellent. They allow a good accuracy on the values of the measured cross-sections (10 to 15%). We have observed for the first time the nuclide Actinium-235 obtained consequently to the loss of 3 protons by the projectile. The measured isotopic distribution are strongly influenced by the mechanism of fission which leads to a strong reduction of the production of the heavy neutron deficient isotopes. We have compared our results to some other measurements achieved with radio-chemical methods at a similar energy. We observed a systematic disagreement of about 40%. Some comparison with the available systematics show that those are presently not able to reproduce the data with a reasonable precision. We could also measure the recoil momentum distribution for each studied isotopes. We show that Goldhaber's model agrees very well with the experiment in case. of 'cold' channels where the evaporation of particles never occurs. On the other hand, when the produced pre-fragment is excited the data show that Goldhaber's model does not reproduce.the data showing the limitation of such an approach. We finally tried to reproduce the measurement of evaporation residue cross-section thanks to the coupling of intra-nuclear cascade and statistical evaporation codes. The influence of the fission process is rather important is the system p+U; we therefore had to account for the dynamical aspect of the fission. We also showed

  3. Domain-General and Domain-Specific Creative-Thinking Tests: Effects of Gender and Item Content on Test Performance

    Science.gov (United States)

    Hong, Eunsook; Peng, Yun; O'Neil, Harold F., Jr.; Wu, Junbin

    2013-01-01

    The study examined the effects of gender and item content of domain-general and domain-specific creative-thinking tests on four subscale scores of creative-thinking (fluency, flexibility, originality, and elaboration). Chinese tenth-grade students (234 males and 244 females) participated in the study. Domain-general creative thinking was measured…

  4. EST Table: FS911502 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available eritance modifier 19 [Culex quinquefasciatus] gb|EDS39679.1| sensitized chromosome inheritance...FS911502 E_FL_fufe_23G14_F_0 11/12/09 n.h 10/09/28 35 %/234 aa ref|XP_001842174.1| sensitized chromosome inh

  5. Simple Relationships for Estimating Procurement Cost of U.S. Navy Ship Categories.

    Science.gov (United States)

    1982-03-01

    SSN-589 SCORPION 290 SSN-590 SCULPIN 234 SSN-591 SHARK 273 SSN-592 SNOOK 230 SSN-594 PERMIT 395 SSN-595 PLUNGER 331 SSN-596 BARB 333 SSN-603 POLLACK...SUNFISH 282 SSN-651 QUEENFISH 281 SSN-652 PUFFER 324 SSN-653 RAY 279 SSN-662 GURNARD 333 SSN-663 HAMMERHEAD 235 SSN-664 SEA DEVIL 247 SSN-665 GUITARRO

  6. Assessment of Sexual Violence against Female Students in Wolaita Sodo University, Southern Ethiopia

    Science.gov (United States)

    Tora, Abebayehu

    2013-01-01

    Studies indicate that girls and women encounter sexual violence in their day-to-day social life in all cultures and societies. This study aimed to determine the prevalence of sexual violence against female students in Wolaita Sodo University; 374 female students provided responses to self-administered questionnaire. The study revealed 23.4% (95%…

  7. finite element model for predicting residual stresses in shielded

    African Journals Online (AJOL)

    eobe

    *Corresponding author, Tel: +234-803-563-5419. FINITE ELEMENT MODEL FOR PREDICTING RESIDUAL STRESSES IN. SHIELDED MANUAL METAL ARC WELDING OF MILD STEEL PLATES. SHIELDED MANUAL METAL ARC WELDING OF MILD STEEL PLATES. I. U. Musa1,*, M. O. Afolayan. O. Afolayan2 and I. M. ...

  8. African Journal for Physical Activity and Health Sciences - Vol 19 ...

    African Journals Online (AJOL)

    The health effects of welding on welders in the Capricorn District, Limpopo Province, South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ME Mokaba, RN Malema, OA Oduntan, TM Mothiba, 222-234 ...

  9. Effect of Surgical and Immunological Castration on Haematological ...

    African Journals Online (AJOL)

    olayemitoyin

    Keywords: Surgical castration, immunosterilization, dogs, GnRH vaccine, Testosterone, Luteinising hormone. ©Physiological Society of Nigeria. *Address for correspondence: ayisat_ajadi@yahoo.com Tel: +234-806-956-0868. Manuscript Accepted: .......... INTRODUCTION. Dog overpopulation remains a serious problem in.

  10. Microcirculatory Impairment Following Focal and Global Cerebral Ischemia in the Rat.

    Science.gov (United States)

    1982-02-08

    Measurement of local cerebral blood flow with iodo (I 4C) antipyrine. Am J Physiol 234:H59-H66, 1978 9. Simone JV, Vanderheiden J, Abildgaard CF: A...restrained rats. J CBF Metab 1:233- 236, 1981 25. de Gaetano G, Donati MB, Innocenti IR-D, et al: Defective ristocetin and bovine factor VIII-induced

  11. Acetylcholinesterase Chirality and Cellular Mechanisms of Organophosphonate Toxicity

    Science.gov (United States)

    1990-06-11

    containing- all Serperitarium, Salt Lake City, UT). N~ono-[ t2"l] iodo -(T-toxin (sior’iC1- the curooents excepit the luoropliore. The instrumental...that reported for aging of bovine erythrocvte AchE in aging occurred approximately 2-fold faster than when meas- tired in the presence of NaCI. Aging

  12. EST Table: FY753899 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 51 %/224 aa gnl|Amel|GB11154-PA 11/11/04 55 %/234 aa gi|91079562|ref|XP_966370.1| PREDICTED: similar to iodotyrosine dehalogenase 1, partial [Tribolium castaneum] BY930739 famL ...

  13. Great Lakes Research Review, 1982. Appendices.

    Science.gov (United States)

    1982-11-01

    Process Control and Upgrading of Effluent Filtration Operations 234 C 81-35 WTC Treatment of Blast Furnaces Scrubber Water 235 C 81-36/77 WTC...C.P.N. Removal System 154 C 243 WTC Removal of NH3 -NO3from Industrial Effluents 155 C 244 WTC Biological Nitrification of Industrial Wastes 156 C 244

  14. NIGERIAN VETERINARY JOURNAL

    African Journals Online (AJOL)

    ADEYEYE

    Department of Veterinary Pathology, College of Veterinary Medicine, Michael Okpara University of Agriculture,. Umudike, P.M.B 7267 Umuahia, Abia State, Nigeria. *Corresponding author: Email: docoleji@yahoo.com; Tel. No:+234 8034509991. SUMMARY. This study investigated comparatively the genetic influence on the ...

  15. The Estimation of Lake Naivasha Area Changes Using of Hydro ...

    African Journals Online (AJOL)

    Rwanda Journal, Series D, Volume 1, 2016, Life and Natural Sciences: Special issue II. The Estimation of ... The lakes act as the essential components of the hydrological cycle and local ecosystems. .... The bands combination, false color composite (2-3-4) used to detect the change in colors of the lake water body from the ...

  16. Domain Modeling: NP_003315.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_003315.2 chr12 Crystal Structure Analysis of the human Tub protein (isoform a) s...panning residues 289 through 561 p1s31a_ chr12/NP_003315.2/NP_003315.2_holo_176-442.pdb blast 207I,222Y,224Y,232K,234F,255P PGE 0 ...

  17. Universal Screening for Social-Emotional Competencies: A Study of the Reliability and Validity of the DESSA-Mini

    Science.gov (United States)

    Naglieri, Jack A.; LeBuffe, Paul; Shapiro, Valerie B.

    2011-01-01

    The purpose of this study was to examine the reliability of the eight-item Devereux Student Strengths Assessment (DESSA)-mini and its validity in relation to the 72-item version DESSA. The sample included teacher ratings for 1,234 children in kindergarten through eighth grade who comprised the standardization sample. The median alpha reliability…

  18. Radiation doses to normal tissues during craniospinal irradiation ...

    African Journals Online (AJOL)

    Mohamed Farouk Mostafa

    2011-10-15

    Oct 15, 2011 ... or cerebro-spinal metastasis identifies high risk patients.1. Reduced-dose (23.4 Gy) craniospinal irradiation (CSI) in combination with weekly vincristine, followed by a boosting of the dose to the posterior fossa up to 55.8 Gy followed by adjuvant systemic chemotherapy in the form of vincristine,. CCNU and ...

  19. A Review Of Laparoscopy At A Dedicated Assisted Reproductive ...

    African Journals Online (AJOL)

    Seventy eight (36.44%) patients had combined laparoscopy and hysteroscopy done. While 4 patients had laparoscopic tubal sterilization with Filshie clip, 1 patient each had laparoscopic ovarian cyst drainage and IUCD retrieval. The overall complication rate was 2.34%. Conclusion: Laparoscopy is a useful tool in trained ...

  20. Research in Electronics - JSEP.

    Science.gov (United States)

    1981-03-01

    H. Kim) ... ........... .. 65 3.5 Automated Systems for Computer Software Development (E. Horowitz) ..... .............. ... 66 3. 6 Multiple User...Program Redundancy, 11 Proc. 10th Hawaii Int’l Conf. on System Sciences, Jan. 1977, pp. 234-238. 3. 5 Autornated Systems for Computer Software Development E

  1. Cytotoxic potentials of thiocyanate administration on the liver of male ...

    African Journals Online (AJOL)

    Hence this study was performed to elucidate the consequence(s)of thiocyanate administration on the liver of adult male wistar rats. Twenty adult male wistar rats with an average weight of 234.5g were used. The rats were grouped into four (A, B, C & D) with five animals in each group. Group A represented the control and ...

  2. Mediating the Effect of Gratitude in the Relationship between Forgiveness and Life Satisfaction among University Students

    Science.gov (United States)

    Aricioglu, Ahu

    2016-01-01

    The purpose of this study was to examine the mediating effect of gratitude in the relationship between forgiveness and life satisfaction. A convenience sample of 396 (234 (59%) females, 162 (41%) males) university students was recruited from a University in Denizli, Turkey. The participants' ages ranged between 18 and 27 years, with an average of…

  3. Video and HTML: Testing Online Tutorial Formats with Biology Students

    Science.gov (United States)

    Craig, Cindy L.; Friehs, Curt G.

    2013-01-01

    This study compared two common types of online information literacy tutorials: a streaming media tutorial using animation and narration and a text-based tutorial with static images. Nine sections of an undergraduate biology lab class (234 students total) were instructed by a librarian on how to use the BIOSIS Previews database. Three sections…

  4. EST Table: FS809434 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS809434 E_FL_fmgV_29B23_F_0 10/09/28 50 %/234 aa gb|AAC36150.1| chymotrypsinogen-like protein [Plodia... interpunctella] gb|AAC36149.1| chymotrypsinogen-like protein [Plodia interpunctella] 10/

  5. Medieval Horse Stable; The Results of Multi Proxy Interdisciplinary Research

    Czech Academy of Sciences Publication Activity Database

    Dejmal, M.; Lisá, Lenka; Nývltová Fišáková, Miriam; Bajer, A.; Petr, Libor; Kočár, P.; Kočárová, R.; Nejman, L.; Rybníček, M.; Sůvová, Z.; Culp, R.; Vavrčík, H.

    2014-01-01

    Roč. 9, č. 3 (2014) E-ISSN 1932-6203 R&D Projects: GA ČR(CZ) GAP405/11/1729 Institutional support: RVO:67985831 ; RVO:68081758 Keywords : carbon isotopes * tail-hair * diet * sediments * turnover * Iceland * England * houses Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.234, year: 2014

  6. Notes on Process and Data Analysis in Electro-Coagulation—The Importance of Standardisation and Clarity.

    Czech Academy of Sciences Publication Activity Database

    Tito, Duarte Novaes; Krystyník, Pavel; Klusoň, Petr

    2016-01-01

    Roč. 104, JUN 2016 (2016), s. 22-28 ISSN 0255-2701 Institutional support: RVO:67985858 Keywords : electro-coagulation * water treatment * process efficacy Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.234, year: 2016

  7. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. S Sundaram. Articles written in Sadhana. Volume 38 Issue 2 April 2013 pp 211-234. Wear monitoring of single point cutting tool using acoustic emission techniques · P Kulandaivelu P Senthil Kumar S Sundaram · More Details Abstract Fulltext PDF. This paper examines the flank and crater wear ...

  8. MANUSCRIPT NUMBER: NVJ/10/02/08

    African Journals Online (AJOL)

    SALIS LAWAN

    DAMATURU ABATTOIR, YOBE STATE, NIGERIA. TIJJANI, A. O., MUSA*, H. I., ATSANDA, N. N. and MAMMAN, B. Department of Veterinary Public Health and Preventive Medicine. Faculty of Veterinary Medicine, University of Maiduguri, Maiduguri, Nigeria. *correspondence: E-mail: mhasanim @yahoo.com .Tel. +234 803 ...

  9. Using Implicit Bias Training to Improve Attitudes toward Women in STEM

    Science.gov (United States)

    Jackson, Sarah M.; Hillard, Amy L.; Schneider, Tamera R.

    2014-01-01

    Implicit biases can foster negative attitudes and lead to damaging stereotypical behaviors. Stereotypes can negatively affect the education, hiring, promotion, and retention of women in science, technology, engineering, and mathematics (STEM). This study evaluated the impact of diversity training on university faculty (N=234) by assessing changes…

  10. Disentangling the Interrelations between Hopelessness, Loneliness, and Suicidal Ideation.

    Science.gov (United States)

    Joiner, Thomas E.; Rudd, M. David

    1996-01-01

    Attempts to disentangle the interrelations between hopelessness, loneliness, and suicidal ideation by comparing two models of their relationships among 234 undergraduates, using a series of multiple regression/correlation equations. Discusses implications of findings for the nomological status of hopelessness and loneliness as correlates of…

  11. CARBON-DIOXIDE LASER-SURGERY OF ORAL LEUKOPLAKIA

    NARCIS (Netherlands)

    ROODENBURG, JLN; PANDERS, AK; VERMEY, A

    Oral leukoplakia is a precancerous lesion of the oral mucosa. The risk of malignant transformation depends on the clinical and histologic classification and the location of the lesion. For a nonhomogeneous leukoplakia, this risk is 23.4% to 38.0%. In the presence of epithelial dysplasia, the

  12. Interim Report on Feasibility of Improving Recreation Access and Related Water and Land Management in the Buffalo Metropolitan Area, New York.

    Science.gov (United States)

    1979-04-01

    the lake and, due to the poor water quality of the canal, further degrades lake waters. In the early history of Delaware Park, the lake was a great...horseshoe pits. and tennis or badminton net posts should be Installed so that they cam be removed quickly to allow proper functioning of the floodway. 46/234

  13. Dicty_cDB: Contig-U05103-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone CH261-138G10, WO... 36 7.0 2 ( DQ351036 ) Bhutanitis mansfieldi isolate FS-b-1589 cytochrom... 32 7.5 2...42094 ) Medicago truncatula clone mth2-34h6, complete seq... 36 7.8 3 ( DQ383994 ) Bhutanitis mansfieldi iso

  14. Incidence and management of bile leakage after partial liver resection

    NARCIS (Netherlands)

    Erdogan, D.; Busch, O. R. C.; van Delden, O. M.; Rauws, E. A. J.; Gouma, D. J.; van Gulik, T. M.

    2008-01-01

    Background/Aims: Bile leakage after partial liver resection still is a common complication and is associated with substantial morbidity and even mortality. Methods: A total of 234 consecutive liver resections without biliary reconstruction, performed between January 1992 and December 2004, were

  15. Curcumin and Its Carbocyclic Analogs: Structure-Activity in Relation to Antioxidant and Selected Biological Properties

    Directory of Open Access Journals (Sweden)

    H. P. Vasantha Rupasinghe

    2013-05-01

    Full Text Available Curcumin is the major phenolic compound present in turmeric (Curcuma longa L.. Curcumin and 15 novel analogs were investigated for their antioxidant and selected biological activities. Strong relationships between the structure and evaluated activity revealed that the compounds with specific functional groups and carbon skeleton had specific biological profiles. Among the compounds tested, the derivatives (E-2-(3,4-dimethoxybenzylidene-5-((E-3-(3,4-dimethoxyphenylacryloylcyclopentanone (3e, and (E-2-(4-hydroxy-3-methoxybenzylidene-5-((E-3-(4-hydroxy-3-methoxyphenylacryloyl-cyclopentanone (3d and the parent compound curcumin exhibited the strongest free radical scavenging and antioxidant capacity. Concerning the other biological activities studied the compound (E-2-(4-hydroxy-3-methoxybenzylidene-5-((E-3-(4-hydroxy-3-methoxy-phenyl-acryloylcyclopentanone (3d was the most potent angiotensin converting enzyme (ACE inhibitor, while the derivatives (E-2-(4-hydroxybenzylidene-6-((E-3-(4-hydroxyphenylacryloylcyclohexanone (2b, (E-2-(3,4-dimethoxybenzylidene-6-((E-3-(3,4-dimethoxyphenylacryloylcyclohexanone (2e and (E-2-(3,4-dimethoxybenzylidene-5-((E-3-(3,4-dimethoxyphenylacryloylcyclopentanone (3e exhibited strong tyrosinase inhibition. Moreover, (E-2-(3,4-dimethoxybenzylidene-6-((E-3-(3,4-dimethoxyphenyl-acryloylcyclohexanone (2e was also found to be the strongest human HIV-1 protease inhibitor in vitro among the tested compounds. Cytotoxicity studies using normal human lung cells revealed that the novel curcumin as well as its carbocyclic analogs are not toxic.

  16. Taalbeleid aan finansiële instellings | van Schouwenburg | Southern ...

    African Journals Online (AJOL)

    ... waarom kliënte nie in hulle moedertale bedien kan word nie. Uit die navorsing blyk dit dat daar egter 'n verskuiwing aan die plaasvind is waarvolgens die finansiële sektor nou aandag begin gee aan die implementering van veeltaligheid. Southern African Linguistics and Applied Language Studies 2005, 23(4): 335–347 ...

  17. characterisation of gastro- enteritis-associated adenoviruses in ...

    African Journals Online (AJOL)

    Setting. Gauteng, 1994-1996. Metfwds. A total of 234 paediatric diarrhoeal stool samples were screened for Ad using commercial enzyme-linked. iInmunosorbent assays (EUSAs). Adenoviral isolates were typed, where possibie, using restriction enzyme analysis. Results. Ad was detected in 23 (9.8%) specimens, of which 8.

  18. Functional redundancy and ecological innovation shape the circulation of tick-transmitted pathogens

    Czech Academy of Sciences Publication Activity Database

    Estrada-Peña, A.; de la Fuente, J.; Cabezas Cruz, Alejandro

    2017-01-01

    Roč. 7, MAY (2017), č. článku 234. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : communities * networks * tick-borne pathogens * ticks Subject RIV: EH - Ecology, Behaviour Impact factor: 4.300, year: 2016

  19. Direction des Publications

    African Journals Online (AJOL)

    Synthese

    3) Laboratoire de Mécanique, Structures et Energétique, ... This work consists in detecting two combined defects, simulated on gears using continuous wavelet ..... Vibration, Vol. 234, Issue 1, 2000, p.135-. 148. [15] A. Boulenger, C. Pachaud, Aide- mémoire, Surveillance des machines par analyse des vibrations, Ed. Dunod, ...

  20. Fitness and growth of the ephemeral mudflat species Cyperus fuscus in river and anthropogenic habitats in response to fluctuating water-levels

    Czech Academy of Sciences Publication Activity Database

    Böckelmann, J.; Tremetsberger, K.; Šumberová, Kateřina; Grausgruber, H.; Bernhardt, K.-G.

    2017-01-01

    Roč. 234, Sept 2017 (2017), s. 135-149 ISSN 0367-2530 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : soil seed bank * phenotypic plasticity * wetland vegetation Subject RIV: EF - Botanics Impact factor: 1.125, year: 2016