Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
17 CFR 232.11 - Definition of terms used in part 232.
2010-04-01
... effect by a person executing or issuing it. If data are stored in a computer or similar device, any... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Definition of terms used in part 232. 232.11 Section 232.11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 232.702 Section 232.702 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Contract Funding 232.702 Policy. Fixed-price...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Milk. 58.232 Section 58.232 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections....232 Milk. Raw milk shall meet the requirements as outlined in §§ 58.132 through 58.138 and, unless...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Background. 23.2 Section 23.2 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.2 Background. It is... potential threats to the privacy of individuals to whom such data relates, policy guidelines for Federally...
2010-10-01
... hazard of death or injury to persons, or has caused death or injury, a penalty not to exceed $100,000 per... 49 Transportation 4 2010-10-01 2010-10-01 false Penalties. 232.11 Section 232.11 Transportation...-TRAIN DEVICES General § 232.11 Penalties. (a) Any person (including but not limited to a railroad; any...
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
48 CFR 1553.232 - Contract financing.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract financing. 1553.232 Section 1553.232 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS FORMS Prescription of Forms 1553.232 Contract financing. ...
49 CFR 232.13 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 232.13 Section 232.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... EQUIPMENT; END-OF-TRAIN DEVICES General § 232.13 Preemptive effect. (a) Under 49 U.S.C. 20106, issuance of...
8 CFR 232.3 - Arriving aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Arriving aliens. 232.3 Section 232.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DETENTION OF ALIENS FOR PHYSICAL AND MENTAL EXAMINATION § 232.3 Arriving aliens. When a district director has reasonable grounds...
24 CFR 232.560 - Interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 232.560 Section 232... Equipment Eligible Security Instruments § 232.560 Interest rate. (a) The loan shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA
46 CFR 232.4 - Balance sheet accounts.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Balance sheet accounts. 232.4 Section 232.4 Shipping... ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Balance Sheet § 232.4 Balance sheet accounts. (a.... (b) Purpose of balance sheet accounts. The balance sheet accounts are intended to disclose the...
27 CFR 20.232 - Reconsignment in transit.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Reconsignment in transit. 20.232 Section 20.232 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... and Disposition of Specially Denatured Spirits § 20.232 Reconsignment in transit. (a) Reconsignment...
Production of 231Pa and 232U by irradiation of 230Th/232Th mixtures
International Nuclear Information System (INIS)
Kluge, E.; Lieser, K.H.
1981-01-01
The production of 231 Pa and of 232 U by irradiating a 230 Th/ 232 Th mixture (containing 12 mol per cent 230 Th) in form of ThO 2 at a thermal neutron flux of 6.9 x 10 13 cm -2 s -1 for 4 months was investigated. Pa, U and Th were separated and the chemical yields were determined. 2.6% of the 230 Th were transformed into 231 Pa and 0.13% into 232 U. These values are higher than those calculated for a thermal flux, but lower than those calculated for a flux ratio epithermal to thermal = 0.03. 231 Pa and 232 U were isolated in form of a protactinium solution and of U 3 O 8 with 94.9 and 89.1% chemical yields, respectively. Foreign activities were not detected. Thorium was recuperated and isolated as ThO 2 , with a chemical yield of 93.6%. (orig.)
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.2 Section 23.2 Agriculture Office... Administration. (a) Title V will be administered by the Administrators of the Extension Service and the... Act of 1914 and the Hatch Act (as amended), August 11, 1955, the administration of the programs shall...
48 CFR 53.232 - Contract financing (SF 1443).
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract financing (SF 1443). 53.232 Section 53.232 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.232 Contract financing (SF 1443). SF 1443 (JUL...
46 CFR 232.6 - Financial report filing requirement.
2010-10-01
... RELATED ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Income Statement § 232.6 Financial report filing requirement. (a) Reporting Frequency and Due Dates. The contractor shall file a semiannual... 46 Shipping 8 2010-10-01 2010-10-01 false Financial report filing requirement. 232.6 Section 232.6...
24 CFR 232.885 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 232.885 Section 232.885 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....885 Insurance benefits. (a) Method of payment. Payment of claim shall be made in the following manner...
20 CFR 410.232 - Withdrawal of a claim.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Withdrawal of a claim. 410.232 Section 410.232 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969... Claims and Evidence § 410.232 Withdrawal of a claim. (a) Before adjudication of claim. A claimant (or an...
24 CFR 232.805 - Insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 232.805 Section... FACILITIES Contract Rights and Obligations Premiums § 232.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...
27 CFR 31.232 - Wine bottling.
2010-04-01
.... The decanting of wine by caterers or other retail dealers for table or room service, banquets, and... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine bottling. 31.232... OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Miscellaneous § 31.232 Wine bottling. Each person...
49 CFR 232.305 - Single car air brake tests.
2010-10-01
... from a train or when placed on a shop or repair track, as defined in § 232.303(a); (2) A car is on a shop or repair track, as defined in § 232.303(a), for any reason and has not received a single car air... 49 Transportation 4 2010-10-01 2010-10-01 false Single car air brake tests. 232.305 Section 232...
History of 232-F, tritium extraction processing
International Nuclear Information System (INIS)
Blackburn, G.W.
1994-08-01
In 1950 the Atomic Energy Commission authorized the Savannah River Project principally for the production of tritium and plutonium-239 for use in thermonuclear weapons. 232-F was built as an interim facility in 1953--1954, at a cost of $3.9M. Tritium extraction operations began in October, 1955, after the reactor and separations startups. In July, 1957 a larger tritium facility began operation in 232-H. In 1958 the capacity of 232-H was doubled. Also, in 1957 a new task was assigned to Savannah River, the loading of tritium into reservoirs that would be actual components of thermonuclear weapons. This report describes the history of 232-F, the process for tritium extraction, and the lessons learned over the years that were eventually incorporated into the new Replacement Tritium Facility
Production of 232,233Pa in 6Li+232Th Collisions in the Classical Trajectory Approach
International Nuclear Information System (INIS)
Aleshin, V.P.
2000-01-01
The semiclassical model of nuclear reactions with loosely bound projectiles (V.P. Aleshin, B.I. Sidorenko, Acta Phys. Pol. B29, 325 (1998)) is refined and compared with experimental data of Rama Rao et al. on the excitation function for the production of 232,233 Pa in 6 Li+ 232 Th collisions at E = 30-50 MeV. The main contribution to the production of 232 Pa is the 2 neutron emission from excited states of 234 Pa formed in the ( 6 Li,α) reaction. The main source of 233 Pa is the ( 6 Li,αp) reaction followed by γ transitions from excited states of 233 Th to 233 Th (g.s.) which transforms to 233 Pa through β - decay. The ground state of 6 Li regarded as a combination of n+p+α is modeled with the K=2, l x =l y =0 hyperspherical function. The calculation underpredicts the excitation function of 232 Pa by a factor of 0.6 and overpredicts the excitation function of 233 Pa by a factor of 2.3, on the average. With the more realistic wave function of 6 Li both factors are expected to be closer to 1. (author)
48 CFR 232.102 - Description of contract financing methods.
2010-10-01
... financing methods. 232.102 Section 232.102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 232.102 Description of contract financing methods. (e)(2) Progress payments...
48 CFR 232.202-4 - Security for Government financing.
2010-10-01
... financing. 232.202-4 Section 232.202-4 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 232.202-4 Security for Government financing. (a)(2) When determining whether an offeror...
17 CFR 232.306 - Foreign language documents and symbols.
2010-04-01
... symbols. 232.306 Section 232.306 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 232.306 Foreign language documents and symbols. (a) All electronic filings and submissions must be in... words or letters in the English language rather than representative symbols, except that HTML documents...
48 CFR 2452.232-71 - Voucher submission (cost-reimbursement).
2010-10-01
...-reimbursement). 2452.232-71 Section 2452.232-71 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND... Clauses 2452.232-71 Voucher submission (cost-reimbursement). As prescribed in 2432.908(c)(2), insert a clause substantially the same as the following in all cost-reimbursement solicitations and contracts...
17 CFR 232.308 - Type size and font; legibility.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Type size and font; legibility. 232.308 Section 232.308 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 232.308 Type size and font; legibility. Provisions relating to type size, font and other legibility...
48 CFR 232.501-3 - Contract price.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract price. 232.501-3... 232.501-3 Contract price. (b) The contracting officer may approve progress payments when the contract price exceeds the funds obligated under the contract, provided the contract limits the Government's...
24 CFR 232.840 - Date of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 232.840 Section 232.840 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....840 Date of default. In computing loan insurance benefits, the date of default shall be considered as...
48 CFR 1552.232-74 - Payments-simplified acquisition procedures financing.
2010-10-01
... acquisition procedures financing. 1552.232-74 Section 1552.232-74 Federal Acquisition Regulations System... Provisions and Clauses 1552.232-74 Payments—simplified acquisition procedures financing. As prescribed in... acquisition procedures financing. Payments—Simplified Acquisition Procedures Financing (JUN 2006) Simplified...
International Nuclear Information System (INIS)
Miyake, Yasuo; Sugimura, Yukio; Yasujima, Tadahide.
1978-01-01
The concentration of thorium isotopes and the activity ratios of 230 Th/ 232 Th and 228 Th/ 232 Th in 500 l sea water samples collected in the Pacific Ocean were determined. Thorium isotopes were analyzed by alpha-ray spectrometry after separating them from other elements with an anion exchange resin. The average content of thorium ( 232 Th) of 0.9 ng l -1 was obtained in the open Pacific water. The average contents of 230 Th and 228 Th were 2.1 x 10 -2 pgl -1 and 1.2 agl -1 respectively. It was found that the ratios of 230 Th/ 232 Th and 228 Th/ 232 Th ranged respectively from 1.0 to 29, and from 0.4 to as high as 128. (author)
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
24 CFR 232.830 - Definition of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 232.830... Insurance § 232.830 Definition of default. (a) If the borrower fails to make any payments due under or... default for the purposes of this subpart. (b) The failure to perform any other covenant under the note or...
48 CFR 52.232-31 - Invitation To Propose Financing Terms.
2010-10-01
... Financing Terms. 52.232-31 Section 52.232-31 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.232-31 Invitation To Propose Financing Terms. As prescribed in 32.205(b) and 32.206, insert the following provision: Invitation To Propose Financing Terms (OCT 1995) (a) The offeror is invited to propose...
48 CFR 232.072-3 - Cash flow forecasts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cash flow forecasts. 232..., DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 232.072-3 Cash flow forecasts. (a... contractor to submit a cash flow forecast covering the duration of the contract. (b) A contractor's inability...
40 CFR 170.232 - Knowledge of labeling and site-specific information.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Knowledge of labeling and site-specific information. 170.232 Section 170.232 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.232 Knowledge...
29 CFR 500.232 - Consent findings and order.
2010-07-01
... Administrative Law Judge; and (4) A waiver of any right to challenge or contest the validity of the findings and... 29 Labor 3 2010-07-01 2010-07-01 false Consent findings and order. 500.232 Section 500.232 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS MIGRANT AND...
Calibration of 232U solution; Calibracion de una disolucion de 232U
Energy Technology Data Exchange (ETDEWEB)
Galan Valera, M P; Acena Berrenechea, M L
1988-07-01
A method for as certain the activity by alpha spectroscopy with semiconductor detectors, of a solution of 232U is presented. It consists of the comparison with a 233U solution activity previously measured in a gridded ionization chamber of 2{pi} geometry. The total measurement uncertainty is about + - 0,02. (Author) 9 refs.
75 FR 41877 - Insured Healthcare Facilities 232 Loan Application
2010-07-19
... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-65] Insured Healthcare Facilities 232 Loan Application AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice. SUMMARY... Proposal: Insured Healthcare Facilities 232 Loan Application. OMB Approval Number: 2502-New. Form Numbers...
75 FR 16821 - Insured Healthcare Facilities 232 Loan Application
2010-04-02
... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-23] Insured Healthcare Facilities 232 Loan Application AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice. SUMMARY...: Title of Proposal: Insured Healthcare Facilities 232 Loan Application. OMB Approval Number: 2502-New...
48 CFR 652.232-71 - Voucher Submission (Cost-Reimbursement).
2010-10-01
...-Reimbursement). 652.232-71 Section 652.232-71 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES... Voucher Submission (Cost-Reimbursement). As prescribed in 632.908(b), the contracting officer may insert a clause substantially the same as follows: Voucher Submission (Cost-Reimbursement) (AUG 1999) (a) General...
49 CFR 232.609 - Handling of defective equipment with ECP brake systems.
2010-10-01
... (ECP) Braking Systems § 232.609 Handling of defective equipment with ECP brake systems. (a) Ninety-five... systems. 232.609 Section 232.609 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRAKE SYSTEM SAFETY STANDARDS FOR FREIGHT...
48 CFR 52.232-10 - Payments Under Fixed-Price Architect-Engineer Contracts.
2010-10-01
... Architect-Engineer Contracts. 52.232-10 Section 52.232-10 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.232-10 Payments Under Fixed-Price Architect-Engineer Contracts. As prescribed in 32.111(c)(1), insert the following clause: Payments Under Fixed-Price Architect-Engineer Contracts (APR...
The preparation of Th-232 target by molecular plating method
International Nuclear Information System (INIS)
Yang Chunli; Wu Junde; Su Shuxin; Yang Jingling
2010-01-01
In order to measure the reaction cross-section of 232 Th(α,2n) 234 U, the preparation of uniform and adherent Th-232 targets on Al foils of thickness 2-8 μm fixed on target frame by molecular plating technique from isopropanol was described. The substrate of electrolytic cell was reconstructed and the optimum acidity for the deposition of thorium were investigated. Through deposition yield analysis, the target thickness of 100- 200μg/cm 2 was determined. The α-spectrometry for the Th-232 targets shows a good energy resolution. (authors)
48 CFR 232.070 - Responsibilities.
2010-10-01
... DoD contract financing, including DoD contract financing policies and important related procedures... operations. Refer specific cases involving financing policy or important procedural issues to OUSD(AT&L)DPAP... OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 232.070 Responsibilities. (a) The...
42 CFR 455.232 - Medicaid integrity audit program contractor functions.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Medicaid integrity audit program contractor functions. 455.232 Section 455.232 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS PROGRAM INTEGRITY: MEDICAID Medicaid...
International Nuclear Information System (INIS)
Arruda Neto, J.D.T.; Rigolon, W.; Herdade, S.B.; Riette, H.L.
1983-11-01
The bremsstrahlung-induced fission cross section of 232 Th was measured in the energy region of the Giant Dipole Resonance. The data analysis, performed in terms of the bremsstrahlung spectrum calculated in the Davies-Bethe-Maximon approximation, suggested that the photofission cross section measured at Livermore is correct, and that the (γ,f) data from Saclay are highly questionable. (Author) [pt
International Nuclear Information System (INIS)
Singh, M.; Pradeep Kumar; Singh, Y.; Varshney, A.K.; Gupta, D.K.
2014-01-01
We undertake the present work to treat 232 Th with a soft rotor formula used recently by C. Bihari et. al for γ-band and modified by J.B. Gupta et. al. It describes energy in terms of moment of inertia and softness parameter
Gamma-spectrometric determination of {sup 232}U in uranium-bearing materials
Energy Technology Data Exchange (ETDEWEB)
Zsigrai, Jozsef [European Commission, Joint Research Centre (JRC), Institute for Transuranium Elements (ITU), 76125 Karlsruhe, P.O. Box 2340 (Germany); Nguyen, Tam Cong [Centre for Energy Research of the Hungarian Academy of Sciences (EK), 1525 Budapest 114, P.O. Box 49 (Hungary); Berlizov, Andrey [European Commission, Joint Research Centre (JRC), Institute for Transuranium Elements (ITU), 76125 Karlsruhe, P.O. Box 2340 (Germany)
2015-09-15
The {sup 232}U content of various uranium-bearing items was measured using low-background gamma spectrometry. The method is independent of the measurement geometry, sample form and chemical composition. Since {sup 232}U is an artificially produced isotope, it carries information about previous irradiation of the material, which is relevant for nuclear forensics, nuclear safeguards and for nuclear reactor operations. A correlation between the {sup 232}U content and {sup 235}U enrichment of the investigated samples has been established, which is consistent with theoretical predictions. It is also shown how the correlation of the mass ratio {sup 232}U/{sup 235}U vs. {sup 235}U content can be used to distinguish materials contaminated with reprocessed uranium from materials made of reprocessed uranium.
Mass distributions in monoenergetic-neutron-induced fission of 232Th
International Nuclear Information System (INIS)
Glendenin, L.E.; Gindler, J.E.; Ahmad, I.; Henderson, D.J.; Meadows, J.W.
1980-01-01
Fission product yields for 38 masses were determined for the fission of 232 Th with essentially monoenergetic neutrons of 2.0, 3.0, 4.0, 5.9, 6.4, 6.9, 7.6, and 8.0 MeV. Fission product activities were measured by Ge(Li) γ-ray spectrometry of irradiated 232 Th foils and by chemical separation of the fission product elements followed by β counting. The mass yield data for 232 Th(n,f ) show a sensitive increase of fission yields in the near-symmetric mass region (valley) with increasing incident neutron energy E/sub n/ and a pronounced dip in yield at the onset of second-chance fission just above the neutron binding energy (at approx. 6 MeV) where the excitation energy is lowered by competition with neutron evaporation prior to fission. The effect of second-chance fission is also seen in the yields of asymmetric peak products. A distinct third peak is observed at symmetry in the valley of the mass distribution, and enhanced yields are observed in the asymmetric peaks at masses associated with even Z (proton pairing effect). The fission yeilds of 232 Th(n,f ) are compared with those of 238 U(n,f ) and 232 Th
Dreiseitel, Jiří
2012-01-01
Práce je věnována problematice konstrukce převodníku Ethernet na RS-232 za pomocí jednočipového mikrokontroléru. Cílem je seznámit čtenáře se síťovou technologií Ethernet a technologií pro sériový přenos založený na protokolu RS-232 a zároveň s technologií vestavěných systémů pro konstrukci zařízení. Součástí práce je kompletní návrh převodníku Ethernet na RS-232 včetně návrhu a implementace firmware v jazyce C za využití LwIP TCP/IP stacku. Převodník je postaven na základě vývojového kitu ST...
48 CFR 52.232-26 - Prompt payment for fixed-price architect-engineer contracts.
2010-10-01
...-price architect-engineer contracts. 52.232-26 Section 52.232-26 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.232-26 Prompt payment for fixed-price architect-engineer contracts...-Engineer Contracts (OCT 2008) Notwithstanding any other payment terms in this contract, the Government will...
2010-07-01
... TERMS OF CONSUMER CREDIT EXTENDED TO SERVICE MEMBERS AND DEPENDENTS § 232.7 Preemption. (a) Inconsistent..., including any State usury law, to the extent such law, rule or regulation is inconsistent with this part...) Different treatment under State law of covered borrowers is prohibited. States may not: (1) Authorize...
Calibration of uranium 232 solution
International Nuclear Information System (INIS)
Galan, M.P.; Acena, M.L.
1988-01-01
A method for acertainning the activity by alpha spectroscopy with semiconductor detectors, of a solution of Uranium-232 is presented. It consists of the comparison with a Uranium-233 solution activity previously measured in a gridded ionization chamber of 2 π geometry. The total measurement uncertainty is about +- 0,02. (Author)
International Nuclear Information System (INIS)
Galan Valera, M. P.; Acena Berrenechea, M. L.
1988-01-01
A method for as certain the activity by alpha spectroscopy with semiconductor detectors, of a solution of 232U is presented. It consists of the comparison with a 233U solution activity previously measured in a gridded ionization chamber of 2π geometry. The total measurement uncertainty is about + - 0,02. (Author) 9 refs
Electrodisintegration of 232Th by neutron emission
International Nuclear Information System (INIS)
Terremoto, L.A.A.
1986-01-01
The one neutron decay of the giant electric quadrupole resonance was studied by means of electrodisintegration and photodisintegration reactions. The separation of the multipole components of the photonuclear cross section σ γ,n (E) in 232 90 Th was also performed. The 232 Th(e,n) 231 Th cross section and the 232 Th(B,n) 231 Th bremsstrahlung yield were measured in the incident electron energy range 8-60 MeV and 25-60 MeV, respectively. These measurements have been performed using the electron beam of the Linear Accelerator of the IFUSP and the experimental technique of activation analysis. The virtual photon spectra corrected for nuclear finite size in the analysis of the experimental data obtained in order to separate the multipole components of the photonuclear cross section, was used. An electric dipole component σ EL γ,n (E) that exhausts (60+-7)% of the El sum rule (integrated uσ to 16,5 MeV) was shown. This result is in agreement with the one Obtained in experiments where monoenergetic photons were used. An electric quadrupole component σ E2 γ,n (E) whose value corresponds to (32+-6)% of the E2 sum rule, was also obtained. (author) [pt
24 CFR 232.625 - Discrimination prohibited.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Special Requirements § 232.625 Discrimination prohibited. Any contract or...
International Nuclear Information System (INIS)
Ammerich, Marc; Frot, Patricia; Gambini, Denis-Jean; Gauron, Christine; Moureaux, Patrick; Herbelet, Gilbert; Lahaye, Thierry; Pihet, Pascal; Rannou, Alain; Vial, Eric
2013-12-01
This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Thorium-232
43 CFR 17.232 - Postsecondary education.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Postsecondary education. 17.232 Section 17... Postsecondary education. This section applies to postsecondary education and activities, including postsecondary vocational education programs or activities, that receive Federal financial assistance and to recipients that...
24 CFR 232.605 - Contract requirements.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Form of Contract § 232.605 Contract requirements. (a) The contract between the...
24 CFR 232.865 - Election by lender.
2010-04-01
... FACILITIES Contract Rights and Obligations Rights and Duties of Lender Under the Contract of Insurance § 232.865 Election by lender. Where a real estate mortgage, or other security instrument has been used to...
33 CFR 110.232 - Southeast Alaska.
2010-07-01
... explosives anchorage. (5) A wooden vessel must: (i) Be fitted with a radar reflector screen of metal of sufficient size to permit target indication on the radar screen of commercial type radar; or (ii) Have steel... 110.232 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES...
12 CFR 232.4 - Specific exceptions for obtaining and using medical information.
2010-01-01
... organization works through mortgage lenders and requires mortgage lenders to obtain medical information about... determines that it needs additional information regarding the consumer's circumstances, the creditor may... medical information. 232.4 Section 232.4 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF...
Crosstalk XVI, basic data communication and RS-232C
International Nuclear Information System (INIS)
Hwang, Hui Yung
1988-10-01
This book is divided into three parts, which deals with compatible software of data communication with IBM PC XT/AT. The first part consists of an introduction to crosstalk XVI, getting start for user, crosstalk practice, call with crosstalk, terminal feature, switch of communication parameter, terminal emulation, capturing data, transmission of text file answer mode, file transfer, command file and script file, command summary and examples. The second part deals with basic personal computer communication, RS-232C and explanation of communication control : RS-232C interface, transmission device and interrupt controller 8259.
Study of the sensitivity of integral parameters related to 232 Thorium cross sections
International Nuclear Information System (INIS)
Guimaraes, L.N.F.; Menezes, A.
1986-01-01
The THOR critical assembly is used to test 232 Th basic nuclear data from ENDL-78, ENDF/B-IV, INDL-83, JENDL-1 and JENDL-2. The FORSS and UNISENS systems are used to calculate integral parameters and sensitivity profiles. The results show that 232 Th from JENDL-2 is superior to the others, with ENDL-78 showing the worst performance. The discrepancies can be credited to the different evaluations for the 232 Thorium scattering cross section. (Author) [pt
D ampersand D Characterization of the 232-F Old Tritium Facility at the Savannah River Site
International Nuclear Information System (INIS)
Scallon, K.L.; England, J.L.
1995-01-01
The 232-F ''Old Tritium Facility'' operated in the 1950s as the first tritium production facility at the Savannah River Site (SRS). In 1957, the 232-F operation ceased with tritium production turned over to a larger, technologically improved facility at SRS. The 232-F Facility was abandoned in 1958 and the process areas have remained contaminated with radiological, hazardous and mixed constituents. Decontamination and decommissioning (D ampersand D) of the 232-F Facility is scheduled to occur in the years 1995-1996. This paper presents the D ampersand D characterization efforts for the 232-F Facility
Binary and ternary photofission of thorium 232
Energy Technology Data Exchange (ETDEWEB)
Titterton, E W; Brinkley, T A
1950-05-01
Work by Titterton and Goward (1949) has shown that uranium undergoes photofission into three charged fragments. Experiments have been conducted to determine whether a similar process takes place in the photofission of thorium. Some difficulties were encountered in loading plates with /sup 232/Th atoms, but this was finally accomplished by means of a technique described in detail. Plates loaded by this method were irradiated with a continuous spectrum of ..gamma.. rays of maximum energy 24 MeV from the (Atomic Energy Research Establishment) Synchrotron. Three irradiations, of 100, 150, and 180 r, were made and the resulting plates showed a fission density of 2.5 x 10/sup 4//cc at the 150 r level. In an examination involving 2500 binary photofissions, 5 cases of ternary fission involving the emission of a long range light fragment, probably an ..cap alpha..-particle, were observed. These events are described. A number-range curve was determined for the photofission tracks and is compared with a similar curve for tracks formed by the slow neutron fission of /sup 235/U in a D/sub 1/ emulsion under conditions of similar emulsion sensitivity. It appears that the energy release in the photofission of /sup 232/Th is smaller than that in the slow neutron fission of /sup 235/U. The data indicate that 124 MeV is the mean kinetic energy released in the photofission of /sup 232/Th.
2010-10-01
... Contractor to the Government under this contract shall bear simple interest from the date due until paid... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Interest. 52.232-17... Interest. As prescribed in 32.611(a) and (b), insert the following clause: INTEREST (OCT 2010) (a) Except...
Uptake and distribution of 232U in peas and barley
International Nuclear Information System (INIS)
Schreckhise, R.G.; Cline, J.F.
1980-01-01
The uptake of 232 U from soil and its distribution in peas and barley were examined under conditions which isolated root uptake from deposition on aboveground plant parts. Aboveground plant parts were harvested at maturity and analyzed for 232 U content by alpha-energy-analysis. The ratio of concentration (CR) of 232 U in the dry barley seeds to dry soil was 1.6 x 10 -4 while the CR values of the stem/leaf to dry soil fraction was 3.6 x 10 -3 . The Cr values for the pea seed, stem/pod and leaf components were 5.4 x 10 -4 , 3.3 x 10 -3 and 1.7 x 10 -2 , respectively. This indicates that the CR values used in certain radiological dose-assessment models may be high by about a factor of 100 when evaluating the consumption of seeds of legumes or cereal grains by man. (author)
Molecular characteristic and pathogenicity of Indonesian H5N1 clade 2.3.2 viruses
Directory of Open Access Journals (Sweden)
Dharmayanti NLPI
2013-06-01
Full Text Available The outbreak of disease in late 2012 in Indonesia caused high duck mortality. The agent of the disease was identified as H5N1 clade 2.3.2. The disease caused economic loss to the Indonesian duck farmer. The clade 2.3.2 of H5N1 virus has not previously been identified, so this study was conducted to characterize 4 of H5N1 clade 2.3.2 viruses by DNA sequencing in eight genes segment virus namely HA, NA, NS, M, PB1, PB2, PA and NP. The pathogenicity test of clade 2.3.2 viruses in ducks was compared to clade 2.1.3 viruses which predominat circulating in Indonesia. Results of phylogenetic tree analysis showed that the four of clade 2.3.2 viruses isolated in 2012 was the new introduced virus from abroad. Further analysis showed eight genes were in one group with the clade 2.3.2 viruses, especially those from VietNam and did not belong to Indonesia viruses group. The pathogenicity test in ducks showed that virus H5N1 clade 2.3.2 and clade 2.1.3 have similar clinical symptoms and pathogenicity and cause death in 75% of ducks on days 3-6 after infection.
230,232Th in milk, meat, and grain in Korea
International Nuclear Information System (INIS)
Lin, Xiujing; Choi, Minseok; Kim, Wan; Kang, Heedong; Doh, Sihhong; Kim, Dosung; Kim, Changkyu
2004-01-01
The concentrations of natural radioisotopes 230 Th and 232 Th in Korean foods were measured by the method of calcium oxalate co-precipitation in addition to the conventional anion-exchange method and alpha spectroscopic measurement. The 230 Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.14-2.45, pork 2.98-8.97, beef 1.94-9.80, chicken 1.22-13.0, rice 0.43-2.35, wheat 0.53-14.4, and soybeans, 8.44-91.6. The 232 Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.01-2.46, pork 0.28-9.32, beef 1.02-5.34, chicken 0.56-4.98, rice 0.32-2.54, wheat 0.53-20.0, and soybeans, 2.30-42.2. The annual internal dose of Th was also estimated. The annual internal dose of 230 Th and 232 Th in milk was about 0.006 μSv/yr and much lower than that of other countries because of the low intake of milk in Korea compared to other countries. The annual internal dose of 230 Th and 232 Th in the rice was about 0.043 μSv/yr and highest because rice is the staple food of Koreans. (author)
24 CFR 232.630 - Assurance of completion.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Special Requirements § 232.630 Assurance of completion. If the property upon...
24 CFR 232.565 - Maximum loan amount.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Eligible Security Instruments § 232.565 Maximum loan amount. The principal amount...
24 CFR 232.545 - Covenant against liens.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Eligible Security Instruments § 232.545 Covenant against liens. (a) The security...
46 CFR 232.1 - Purpose and applicability.
2010-10-01
... ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS § 232.1 Purpose and applicability. (a) Purpose. The purpose of this regulation is to establish uniform reporting requirements for the preparation of financial reports and submissions of information to the Maritime Administration. The Maritime Administration will...
17 CFR 232.313 - Identification of investment company type and series and/or class (or contract).
2010-04-01
... company type and series and/or class (or contract). 232.313 Section 232.313 Commodity and Securities... FILINGS Preparation of Electronic Submissions § 232.313 Identification of investment company type and... must indicate their investment company type, based on whether the registrant's last effective...
Nondestructive analysis for 232U and decay progeny in animal tissues
International Nuclear Information System (INIS)
Ballou, J.E.; Wogman, N.A.
1977-01-01
Direct determination of 232 U and its decay products in animal tissues appears to be feasible using an intrinsic Ge(Li) diode detector (for energies of 5-100 keV) and a NaI(Tl) anticoincidence-shielded Ge(Li) diode for higher-energy gamma photons. The detection sensitivity for 232 U and 228 Th is 0.03 and 0.01 nCi, respectively, using a 300-min counting time
24 CFR 232.590 - Eligibility of property.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Property Requirements § 232.590 Eligibility of property. (a) A loan to be...
2010-10-01
... Government Receipt of Electronic Funds Transfer Information. 52.232-35 Section 52.232-35 Federal Acquisition... of Office for Government Receipt of Electronic Funds Transfer Information (MAY 1999) (a) As provided... CONTRACT CLAUSES Text of Provisions and Clauses 52.232-35 Designation of Office for Government Receipt of...
Measurement of the neutron capture cross-section of 232Th using the neutron activation technique
International Nuclear Information System (INIS)
Naik, H.; Singh, Sarbjit; Goswami, A.; Manchanda, V.K.; Prajapati, P.M.; Surayanarayana, S.V.; Nayak, B.K.; Sharma, S.C.; Jagadeesan, K.C.; Thakare, S.V.; Raj, D.; Ganesan, S.; Mulik, V.K.; Sivashankar, B.S.; Mukherjee, S.
2011-01-01
The 232 Th(n, γ) reaction cross-section at average neutron energies of 3.7±0.3 MeV and 9.85±0.38 MeV from the 7 Li(p, n) reaction has been determined for the first time using activation and off-line γ -ray spectrometric technique. The 232 Th(n, 2n) reaction cross-section at the average neutron energy of 9.85±0.38 MeV has been also determined using the same technique. The experimentally determined 232 Th(n, γ) and 232 Th(n, 2n) reaction cross-sections were compared with the evaluated data of ENDF/B-VII, JENDL-4.0 and JEFF-3.1 and were found to be in good agreement. The present data along with literature data in a wide range of neutron energies were interpreted in terms of competition between different reaction channels including fission. The 232 Th(n, γ) and 232 Th(n, 2n) reaction cross-sections were also calculated theoretically using the TALYS 1.2 computer code and were found to be slightly higher than the experimental data. (orig.)
24 CFR 232.595 - Eligibility of title.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Title § 232.595 Eligibility of title. In order for the property which is to be...
2010-10-01
... subcontractor advance payments-DoD pilot mentor-protege program. 252.232-7005 Section 252.232-7005 Federal... subcontractor advance payments—DoD pilot mentor-protege program. As prescribed in 232.412-70(c), use the following clause: Reimbursement of Subcontractor Advance Payments—DoD Pilot Mentor-Protege Program (SEP 2001...
42 CFR 414.232 - Special payment rules for transcutaneous electrical nerve stimulators (TENS).
2010-10-01
... nerve stimulators (TENS). 414.232 Section 414.232 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... Special payment rules for transcutaneous electrical nerve stimulators (TENS). (a) General payment rule. Except as provided in paragraph (b) of this section, payment for TENS is made on a purchase basis with...
46 CFR 232.3 - Chart of accounts.
2010-10-01
... stated in any revision to generally accepted accounting principles, the meaning of the latter shall... UNIFORM FINANCIAL REPORTING REQUIREMENTS § 232.3 Chart of accounts. (a) Purpose of accounts. A contractor shall use this chart of accounts as a guide for preparing the financial statements and for other...
40 CFR 86.232-94 - Vehicle preconditioning.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Vehicle preconditioning. 86.232-94... (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES Emission Regulations for 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
27 CFR 24.232 - Gauge of spirits.
2010-04-01
... OF THE TREASURY LIQUORS WINE Spirits § 24.232 Gauge of spirits. (a) If the spirits to be used are in a spirits storage tank on bonded wine premises, or are received immediately prior to use from a distilled spirits plant not adjacent or contiguous to bonded wine premises, the proprietor shall determine...
Uptake and distribution of /sup 232/U in peas and barley
Energy Technology Data Exchange (ETDEWEB)
Schreckhise, R G; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)
1980-03-01
The uptake of /sup 232/U from soil and its distribution in peas and barley were examined under conditions which isolated root uptake from deposition on aboveground plant parts. Aboveground plant parts were harvested at maturity and analyzed for /sup 232/U content by alpha-energy-analysis. The ratio of concentration (CR) of /sup 232/U in the dry barley seeds to dry soil was 1.6 x 10/sup -4/ while the CR values of the stem/leaf to dry soil fraction was 3.6 x 10/sup -3/. The Cr values for the pea seed, stem/pod and leaf components were 5.4 x 10/sup -4/, 3.3 x 10/sup -3/ and 1.7 x 10/sup -2/, respectively. This indicates that the CR values used in certain radiological dose-assessment models may be high by about a factor of 100 when evaluating the consumption of seeds of legumes or cereal grains by man.
Energy Technology Data Exchange (ETDEWEB)
Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires
1965-07-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)
International Nuclear Information System (INIS)
Xie Shengkai; Guo Dongfa; Tan Jing; Zhang Yanhui; Huang Qiuhong; Gao Aiguo
2013-01-01
It is very important for the rapid and reliable determination of 230 Th/ 232 Th in the thorium-230 dating. A method of measuring 230 Th/ 232 Th in natural samples by high resolution inductively coupled plasma mass spectrometer (HR-ICP-MS) was developed on the base of our former work. The precise and accurate of natural 230 Th in geology samples is challenging, as the peak tailing to the high intensity of neighboring peak at 232 Th and the mass discrimination of the instrument. The peak tailing of 238 U to 236 U was used to decrease the peak tailing effect of 232 Th to 230 Th. The mass discrimination factor K between ture and measured isotope ratio was calculated after measuring different 230 Th/ 232 Th ratio solutions. Lab used standard samples was digested in mixed acids of HN0 3 -HF-HCI-HCl0 4 , and separated by the Bio-rad AG 1 × 8 Cl - resin. The measurement method of blank-standard-blank-sample procession was used to determinate the 230 Th/ 232 Th. The measured result of 230 Th/ 232 Th was at (7.29 ± 0.34) × 10 -6 , which agreed with the reference value of (7.33 ± 0.17) × 10 -6 . (authors)
24 CFR 232.610 - Certification of cost requirements.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Certification of cost requirements... ASSISTED LIVING FACILITIES Eligibility Requirements-Supplemental Loans To Finance Purchase and Installation of Fire Safety Equipment Cost Certification Requirements § 232.610 Certification of cost requirements...
24 CFR 232.850 - Notice of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 232.850 Section....850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined in... default. (b) The lender shall give notice in writing to the Commissioner of the failure of the borrower to...
Benchmark testing calculations for 232Th
International Nuclear Information System (INIS)
Liu Ping
2003-01-01
The cross sections of 232 Th from CNDC and JENDL-3.3 were processed with NJOY97.45 code in the ACE format for the continuous-energy Monte Carlo Code MCNP4C. The K eff values and central reaction rates based on CENDL-3.0, JENDL-3.3 and ENDF/B-6.2 were calculated using MCNP4C code for benchmark assembly, and the comparisons with experimental results are given. (author)
24 CFR 232.525 - Note and security form.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Eligible Security Instruments § 232.525 Note and security form. The lender shall...
24 CFR 232.510 - Commitment and commitment fee.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND... of Fire Safety Equipment Fees and Charges § 232.510 Commitment and commitment fee. (a) Issuance of...
24 CFR 232.570 - Endorsement of credit instrument.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Endorsement of credit instrument... of Fire Safety Equipment Eligible Security Instruments § 232.570 Endorsement of credit instrument. The Commissioner shall indicate his insurance of the loan by endorsing the credit instrument and...
NT-proBNP on Cobas h 232 in point-of-care testing
DEFF Research Database (Denmark)
Gils, Charlotte; Ramanathan, R.; Breindahl, T.
2015-01-01
Background. NT-proBNP may be useful for ruling out heart failure in primary health care. In this study we examined the analytical quality of NT-proBNP in primary health care on the Cobas h 232 point-of-care instrument compared with measurements performed in a hospital laboratory. Materials...... and methods. Blood samples requested for NT-proBNP were collected in primary health care (n = 95) and in a hospital laboratory (n = 107). NT-proBNP was measured on-site on Cobas h 232 instruments both in primary health care centres and at the hospital laboratory and all samples were also analyzed...... with a comparison method at the hospital. Precision, trueness, accuracy, and lot-variation were determined at different concentration levels and evaluated according to acceptance criteria. Furthermore user-friendliness was assessed by questionnaires. Results. For Cobas h 232 repeatability CV was 8...
Mrdakovic Popic, Jelena; Meland, Sondre; Salbu, Brit; Skipperud, Lindis
2014-05-01
Investigation of radionuclides (232Th and 238U) and trace elements (Cr, As and Pb) in soil from two legacy NORM (former mining sites) and one undisturbed naturally 232Th-rich site was conducted as a part of the ongoing environmental impact assessment in the Fen Complex area (Norway). The major objectives were to determine the radionuclide and trace element distribution and mobility in soils as well as to analyze possible differences between legacy NORM and surrounding undisturbed naturally 232Th-rich soils. Inhomogeneous soil distribution of radionuclides and trace elements was observed for each of the investigated sites. The concentration of 232Th was high (up to 1685 mg kg(-1), i.e., ∼7000 Bq kg(-1)) and exceeded the screening value for the radioactive waste material in Norway (1 Bq g(-1)). Based on the sequential extraction results, the majority of 232Th and trace elements were rather inert, irreversibly bound to soil. Uranium was found to be potentially more mobile, as it was associated with pH-sensitive soil phases, redox-sensitive amorphous soil phases and soil organic compounds. Comparison of the sequential extraction datasets from the three investigated sites revealed increased mobility of all analyzed elements at the legacy NORM sites in comparison with the undisturbed 232Th-rich site. Similarly, the distribution coefficients Kd (232Th) and Kd (238U) suggested elevated dissolution, mobility and transportation at the legacy NORM sites, especially at the decommissioned Nb-mining site (346 and 100 L kg(-1) for 232Th and 238U, respectively), while the higher sorption of radionuclides was demonstrated at the undisturbed 232Th-rich site (10,672 and 506 L kg(-1) for 232Th and 238U, respectively). In general, although the concentration ranges of radionuclides and trace elements were similarly wide both at the legacy NORM and at the undisturbed 232Th-rich sites, the results of soil sequential extractions together with Kd values supported the expected differences
Wortham, B. E.; Banner, J. L.; James, E.; Loewy, S. L.
2013-12-01
Speleothems, calcite deposits in caves, preserve a record of climate in their growth rate, isotope ratios and trace element concentrations. These variables must be tied to precise ages to produce pre-instrumental records of climate. The 238U-234U- 230Th disequilibrium method of dating can yield precise ages if the amount of 230Th from the decay of radiogenic 238U can be constrained. 230Th in a speleothem calcite growth layer has two potential sources - 1) decay of radioactive 238U since the time of growth of the calcite layer; and 2) initial detrital 230Th, incorporated along with detrital 232Th, into the calcite layer at the time it grew. Although the calcite lattice does not typically incorporate Th, samples can contain impurities with relatively high Th contents. Initial 230Th/232Th is commonly estimated by assuming a source with bulk-Earth U/Th values in a state of secular equilibrium in the 238U-decay chain. The uncertainty in this 230Th/232Th estimate is also assumed, typically at +/-100%. Both assumptions contribute to uncertainty in ages determined for young speleothems. If the amount of initial detrital 230Th can be better quantified for samples or sites, then U-series ages will have smaller uncertainties and more precisely define the time series of climate proxies. This study determined the initial 230Th/232Th of modern calcite to provide more precise dates for central Texas speleothems. Calcite was grown on glass-plate substrates placed under active drips in central Texas caves. The 230Th/232Th of this modern calcite was determined using thermal ionization mass spectrometry. Results show that: 1) initial 230Th/232Th ratios can be accurately determined in these young samples and 2) measuring 230Th/232Th reduces the uncertainties in previously-determined ages on stalagmites from under the same drips. For example, measured initial 230Th/232Th in calcite collected on substrates from different locations in the cave at Westcave Preserve are 15.3 × 0.67 ppm
Collection and evaluation of nuclear data of Th-232
International Nuclear Information System (INIS)
Osawa, Takaaki
1979-01-01
Present status of the requirement to and measurement and evaluation of the nuclear data of Th-232 is presented. The accuracy and energy range of the observed data at present are not enough to the demand from reactor engineering. The data of total cross-section are given in the energy range from 1.5 to 15 MeV from the data by Foster and Fasoli. The data by Uttley for the energy less than 1.5 MeV were accepted. Recently, Whalen and Kobayashi presented new data. Optical potential parameters were deduced. Re-normalization of the capture cross-sections of Th-232 was made on the basis of the evaluated values by Matsunobu and by Kanda. The values are a little smaller than the values in ENDF/B-4. Fission cross-sections were given by Henkel up to 9 MeV, and by Rago and Pankratov for the energy range above 9 MeV. Recently, Behrens presented new data for wide energy range. The accuracy of the measured cross-sections of inelastic scattering is not enough for reactor design. The accurate values of the cross-sections of (n, 2n) reaction of Th-232 have been demanded. Resonance parameters have been measured for wide energy range. In the energy range of thermal neutrons, the capture cross-section is about 7.4 barn. The characteristics of velocity dependence of the capture cross-section in this range should be investigated. (Kato, T.)
Studies on 232Th and 238U levels in marine algae collected from the coast of Niigata Prefecture
International Nuclear Information System (INIS)
Kato, Kenji; Tonouchi, Shigemasa; Maruta, Fumiyuki; Ebata, Hidekazu
2001-01-01
To evaluate the properties of algae to concentrate radioactive elements, 14 species of algae like Sargassum were collected in the Prefecture and analyzed for their 232 Th and 238 U levels with Yokogawa HP4500 ICP-MS apparatus. The places of collection included those near the water discharge of an atomic power station. Mean 232 Th and 238 U levels were found to be 120 and 260 ng/g dry wt, respectively, and Phaeophyta showed more than several times higher 238 U level than Chlorophyta and Rhodophyta. There was no clear difference in 232 Th levels. No difference between places of collection was observed in Sargassum 232 Th or 238 U level. Adsorption of 232 Th particle to and incorporation of soluble 238 U into algae body were suggested. Mean 232 Th and 238 U radioactivities were found 73 and 510 μBq/g wet wt, respectively, and the respective annual committed effective doses, 0.2 and 0.3 μSv, calculated from those values were confirmed to be enough lower than the annual public dose limit, 1 mSv. (K.H.)
24 CFR 232.620 - Determination of compliance by HHS.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND... of Fire Safety Equipment Special Requirements § 232.620 Determination of compliance by HHS. An...
Thorium-232 in human tissues: Metabolic parameters and radiation doses
International Nuclear Information System (INIS)
Stehney, A.F.
1994-01-01
Higher than environmental levels of 232 Th have been found in autopsy samples of lungs and other organs from four former employees of a Th refinery. Working periods of the subjects ranged from 3 to 24 years, and times from end of work to death ranged from 6 to 31 years. Concentrations of 232 Th in these samples and in tissues from two cases of non-occupational exposure were examined for compatibility with dosimetric models in Publication 30 of the International Commission on Radiological Protection (ICPP 1979a). The concentrations of 232 Th in the lungs of the Th workers relative to the concentrations in bone or liver were much higher than calculated from the model for class Y aerosols of Th and the exposure histories of the subjects, and concentrations in the pulmonary lymph nodes were much lower than calculated for three of the Th workers and both non-occupational cases. Least-squares fits to the measured concentrations showed that the biological half-times of Th in liver, spleen, and kidneys are similar to the half-time in bone instead of the factor of 10 less suggested in Publication 30, and the fractions translocated from body fluids were found to be about 0.03, 0.02, and 0.005, respectively, when the fraction to bone was held at the suggested value of 0.7. Fitted values of the respiratory parameters differed significantly between cases and the differences were ascribable to aerosol differences. Average inhalation rates calculated for individual Th workers ranged from 50 to 110 Bq 232 Th y -1 , and dose equivalents as high as 9.3 Sv to the lungs, 2.0 Sv to bone surfaces, and 1.1 Sv effective dose equivalent were calculated from the inhalation rates and fitted values of the metabolic parameters. The radiation doses were about the same when calculated from parameter values fitted with an assumed translocation fraction of 0.2 from body fluids to bone instead of 0.7
Neutron data evaluation of 232U
International Nuclear Information System (INIS)
Maslov, V.M.; Porodzinskij, Yu.V.; Tetereva, N.A.; Kagalenko, A.B.; Kornilov, N.V.; Baba, M.; Hasegawa, A.
2003-03-01
Consistent evaluation of 232 U measured data base is performed. Hauser-Feshbach- Moldauer theory, coupled channel model and double-humped fission barrier model are employed. Total, differential scattering, fission and (n,xn) data are consistently reproduced as a major constraint for inelastic scattering cross section estimate. The direct excitation of ground state and higher band levels is calculated within rigid rotator and soft (deformable) rotator model, respectively. Prompt fission neutron spectra data are described. Average resonance parameters are provided, which reproduce evaluated cross sections in the range of 10-150 keV. (author)
17 CFR 232.501 - Modular submissions and segmented filings.
2010-04-01
..., EDGAR will suspend the modular submission and notify the electronic filer by electronic mail. After six... COMMISSION REGULATION S-T-GENERAL RULES AND REGULATIONS FOR ELECTRONIC FILINGS Edgar Functions § 232.501 Modular submissions and segmented filings. An electronic filer may use the following procedures to submit...
Levels of 232Th activity in the South Adriatic Sea marine environment of Montenegro
International Nuclear Information System (INIS)
Antovic, N.M.
2010-01-01
232 Th activities in the South Adriatic Sea-water, surface sediment, mud with detritus, seagrass (Posidonia oceanica) samples, and the mullet (Mugilidae) species Mugil cephalus, as well as soil and sand from the Montenegrin Coast, were measured using the six-crystal spectrometer PRIPYAT-2M, which has relatively high detection efficiency and a good sensitivity, and allows a short acquisition time, and measuring samples of any shape, without preliminary preparation and calibration measurements for different sample geometries. An average 232 Th activity concentration in surface soil layer is found to be 40.33 Bq kg -1 , while in sand-4.7 Bq kg -1 . The absorbed dose rate in air due to 232 Th gamma radiation from surface soil layer ranged from 11.76 to 63.39 nGy h -1 , with a mean of 24.06 nGy h -1 . Corresponding average annual effective dose rate has been found to be 0.03 mSv y -1 . The absorbed dose rates due to the thorium gamma radiation in air at 1 m above sand surface on the Montenegrin beaches have been found to be from 0.41 to 9.08 nGy h -1 , while annual effective dose rates ranged from 0.0005 to 0.011 mSv y -1 . 232 Th activity concentration in seawater ranged from 0.06 to 0.22 Bq L -1 , as in the mullet (Mugil cephalus) whole individuals from 0.63 to 1.67 Bq kg -1 . Annual intake of 232 Th by human consumers of this fish species has been estimated to provide an effective dose of about 0.003 mSv y -1 . (author)
238U, 234U and 232Th in seawater
International Nuclear Information System (INIS)
Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.
1986-01-01
We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)
Proteogenomic mapping of Mycoplasma hyopneumoniae virulent strain 232.
Pendarvis, Ken; Padula, Matthew P; Tacchi, Jessica L; Petersen, Andrew C; Djordjevic, Steven P; Burgess, Shane C; Minion, F Chris
2014-07-08
Mycoplasma hyopneumoniae causes respiratory disease in swine and contributes to the porcine respiratory disease complex, a major disease problem in the swine industry. The M. hyopneumoniae strain 232 genome is one of the smallest and best annotated microbial genomes, containing only 728 annotated genes and 691 known proteins. Standard protein databases for mass spectrometry only allow for the identification of known and predicted proteins, which if incorrect can limit our understanding of the biological processes at work. Proteogenomic mapping is a methodology which allows the entire 6-frame genome translation of an organism to be used as a mass spectrometry database to help identify unknown proteins as well as correct and confirm existing annotations. This methodology will be employed to perform an in-depth analysis of the M. hyopneumoniae proteome. Proteomic analysis indicates 483 of 691 (70%) known M. hyopneumoniae strain 232 proteins are expressed under the culture conditions given in this study. Furthermore, 171 of 328 (52%) hypothetical proteins have been confirmed. Proteogenomic mapping resulted in the identification of previously unannotated genes gatC and rpmF and 5-prime extensions to genes mhp063, mhp073, and mhp451, all conserved and annotated in other M. hyopneumoniae strains and Mycoplasma species. Gene prediction with Prodigal, a prokaryotic gene predicting program, completely supports the new genomic coordinates calculated using proteogenomic mapping. Proteogenomic mapping showed that the protein coding genes of the M. hyopneumoniae strain 232 identified in this study are well annotated. Only 1.8% of mapped peptides did not correspond to genes defined by the current genome annotation. This study also illustrates how proteogenomic mapping can be an important tool to help confirm, correct and append known gene models when using a genome sequence as search space for peptide mass spectra. Using a gene prediction program which scans for a wide variety of
International Nuclear Information System (INIS)
Zal U'yun Wan Mahmood; Norfaizal Mohamed; Nita Salina Abu Bakar
2014-01-01
Preliminary results on the study of bioaccumulation, depuration and total dose rate of Th-232 in the whole body of Anabas testudineus are presented. The objective of this study was to evaluate the effect of Th-232 concentration activity on the laboratory bioaccumulation, depuration and total dose rate in Anabas testudineus. Anabas testudineus adults were exposed to different waterborne Th-232 levels: 0 BqL -1 (control), 50 BqL -1 and 100 BqL -1 for 30 day (uptake phase), followed by exposure to radionuclide-free water for 30 days (loss phase). Radionuclide concentration ratios between the whole body levels and water levels, percentage of Th-232 remaining in fish were calculated and total dose rates using ERICA Assessment Tool were also estimated. The results showed the increase of waterborne Th-232 concentration corresponded to a progressive increase of Th accumulation and total dose rate (internal and external) in the whole body of Anabas testudineus. Considering the ERICA dose rate screening value of 10 μGyh -1 , the findings can be concluded the estimated of total dose rate (< 5 μGyh -1 ) in Anabas testudineus is in order of small magnitude. Nevertheless, these preliminary results showed that the Anabas testudineus has a potential to accumulate thorium. (author)
Energy Technology Data Exchange (ETDEWEB)
Kato, Kenji; Tonouchi, Shigemasa; Maruta, Fumiyuki; Ebata, Hidekazu [Niigata Prefectural Inst. of Public Health and Environmental Sciences (Japan)
2001-12-01
To evaluate the properties of algae to concentrate radioactive elements, 14 species of algae like Sargassum were collected in the Prefecture and analyzed for their {sup 232}Th and {sup 238}U levels with Yokogawa HP4500 ICP-MS apparatus. The places of collection included those near the water discharge of an atomic power station. Mean {sup 232}Th and {sup 238}U levels were found to be 120 and 260 ng/g dry wt, respectively, and Phaeophyta showed more than several times higher {sup 238}U level than Chlorophyta and Rhodophyta. There was no clear difference in {sup 232}Th levels. No difference between places of collection was observed in Sargassum {sup 232}Th or {sup 238}U level. Adsorption of {sup 232}Th particle to and incorporation of soluble {sup 238}U into algae body were suggested. Mean {sup 232}Th and {sup 238}U radioactivities were found 73 and 510 {mu}Bq/g wet wt, respectively, and the respective annual committed effective doses, 0.2 and 0.3 {mu}Sv, calculated from those values were confirmed to be enough lower than the annual public dose limit, 1 mSv. (K.H.)
24 CFR 232.520 - Maximum fees and charges by lender.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND... of Fire Safety Equipment Fees and Charges § 232.520 Maximum fees and charges by lender. The lender...
Design and Construction Documents Associated with N232, Sustainability Base
Zornetzer, Steven F.; Schuler, Raymond F.; Grymes, Rosalind A.
2014-01-01
This request comprehensively covers documents associated with the design and construction of Sustainability Base, N232. The intent of this project specifically envisioned broad dissemination of these materials to others undertaking the design and construction of high-performing energy- and resource-efficient buildings in comparable climate zones.
2013-05-30
... Federal or State minimum wage, whichever is higher.'' The collection is also required by regulations for... legal federal or State minimum wage rate, whichever is highest unless special procedures apply to the... Collection for ETA Form 232, Domestic Agricultural In-Season Wage Report and ETA Form 232-A, Wage Survey...
Mass-yield distributions of fission products from 20, 32, and 45 MeV proton-induced fission of 232Th
Naik, H.; Goswami, A.; Kim, G. N.; Kim, K.; Suryanarayana, S. V.
2013-10-01
The yields of various fission products in the 19.6, 32.2, and 44.8 MeV proton-induced fission of 232Th have been determined by recoil catcher and an off-line γ-ray spectrometric technique using the BARC-TIFR Pelletron in India and MC-50 cyclotron in Korea. The mass-yield distributions were obtained from the fission product yield using the charge distribution corrections. The peak-to-valley (P/V) ratio of the present work and that of literature data for 232Th(p,f) and 238U(p,f) were obtained from the mass yield distribution. The present and the existing literature data for 232Th(p,f), 232Th(n,f), and 232Th( γ,f) at various energies were compared with those for 238U(p,f), 238U(n,f), and 238U( γ,f) to examine the probable nuclear structure effect. The role of Th-anomaly on the peak-to-valley ratio in proton-, neutron-, and photon-induced fission of 232Th was discussed with the similar data in 238U. On the other hand, the fine structure in the mass yield distributions of the fissioning systems at various excitation energies has been explained from the point of standard I and II asymmetric mode of fission besides the probable role of even-odd effect, A/ Z ratio, and fissility parameter.
28 CFR 2.32 - Parole to local or immigration detainers.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Parole to local or immigration detainers... § 2.32 Parole to local or immigration detainers. (a) When a State or local detainer is outstanding... wishes to parole a prisoner subject to a detainer filed by Federal immigration officials, the Commission...
24 CFR 232.825 - Pro rata refund of insurance premium.
2010-04-01
... ASSISTED LIVING FACILITIES Contract Rights and Obligations Premiums § 232.825 Pro rata refund of insurance premium. Upon termination of a loan insurance contract by a payment in full or by a voluntary termination... rata portion of the current annual loan insurance premium theretofore paid which is applicable to the...
International Nuclear Information System (INIS)
Sabam Parsaoran Situmorang; Harpasis Selamet Sanusi; June Mellawati
2011-01-01
This study had been carried out by collecting sample of the surficial sediments, sea water, seaweeds, anchovies (Stolephorus and Anchoa) and mussels (Codakia) from 4 locations in waters of Pulau Panjang and coastal of Lada Bay (as control/comparison site), Banten in June - July 2010. Natural radionuclides (Th) concentration in samples was measured using neutron activation analysis (NAA) method. The results showed that the total radionuclides concentration in sediment ( 238 U: 18.6160 - 35.0013 Bq/kg; 232 Th: 11.2020 - 35.6685 Bq/kg), seawater ( 238 U: undetected; 232 Th: 0.0790 - 0.1299 Bq/l), cultivation seaweeds ( 238 U: undetected; 232 Th: 3.6735 - 4.8345 Bq/kg), natural seaweeds ( 238 U: 3.6851 - 48.0430 Bq/kg; 232 Th: 3.9941 - 9.0788 Bq/kg), Stolephorus ( 238 U: undetected; 232 Th: 3.3078 Bq/kg) and Codakia ( 238 U: 6.8903 Bq/kg; 232 Th: 3.6023 Bq/kg) in Pulau Panjang, Banten around Suralaya coal power plant higher than control site that were around the Labuan coal power plant, namely in sediments ( 238 U: 10.4253 Bq/kg; 232 Th: 16.5952 Bq/kg), seawater( 238 U: undetected; 232 Th: 0.0671 Bq/l), cultivation seaweeds ( 238 U: undetected; 232 Th: 2.3005 Bq/kg), natural seaweeds ( 238 U: 19.5367 Bq/kg; 232 Th: 2.6729 Bq/kg) and Anchoa ( 238 U: undetected; 232 Th: 2.0603 Bq/kg). (author)
Design of RS232-powered controller for switched parasitic array antenna
CSIR Research Space (South Africa)
Mofolo, MOR
2013-09-01
Full Text Available It is often convenient to power up peripheral devices directly from the host device interface, without a need for additional and/or external power supply. In this paper we present a design of the RS232-powered controller for electronically...
Clark, Tara R.; Zhao, Jian-xin; Feng, Yue-xing; Done, Terry J.; Jupiter, Stacy; Lough, Janice; Pandolfi, John M.
2012-02-01
The main limiting factor in obtaining precise and accurate uranium-series (U-series) ages of corals that lived during the last few hundred years is the ability to constrain and correct for initial thorium-230 ( 230Th 0), which is proportionally much higher in younger samples. This is becoming particularly important in palaeoecological research where accurate chronologies, based on the 230Th chronometer, are required to pinpoint changes in coral community structure and the timing of mortality events in recent time (e.g. since European settlement of northern Australia in the 1850s). In this study, thermal ionisation mass spectrometry (TIMS) U-series dating of 43 samples of known ages collected from living Porites spp. from the far northern, central and southern inshore regions of the Great Barrier Reef (GBR) was performed to spatially constrain initial 230Th/ 232Th ( 230Th/ 232Th 0) variability. In these living Porites corals, the majority of 230Th/ 232Th 0 values fell within error of the conservative bulk Earth 230Th/ 232Th atomic value of 4.3 ± 4.3 × 10 -6 (2 σ) generally assumed for 230Th 0 corrections where the primary source is terrestrially derived. However, the results of this study demonstrate that the accuracy of 230Th ages can be further improved by using locally determined 230Th/ 232Th 0 values for correction, supporting the conclusion made by Shen et al. (2008) for the Western Pacific. Despite samples being taken from regions adjacent to contrasting levels of land modification, no significant differences were found in 230Th/ 232Th 0 between regions exposed to varying levels of sediment during river runoff events. Overall, 39 of the total 43 230Th/ 232Th 0 atomic values measured in samples from inshore reefs across the entire region show a normal distribution ranging from 3.5 ± 1.1 to 8.1 ± 1.1 × 10 -6, with a weighted mean of 5.76 ± 0.34 × 10 -6 (2 σ, MSWD = 8.1). Considering the scatter of the data, the weighted mean value with a more
International Nuclear Information System (INIS)
Feng, S.; Yang, Y.W.; Lu, X.X.; Liu, R.; Jiang, L.; Zhu, T.H.; Wang, M.; Qin, J.G.
2015-01-01
Highlights: • An integral experiment for 232 Th(n, 2n) reaction was carried out on the newly-established ThO 2 /depleted uranium cylinders. • 232 Th(n, 2n) reaction rate distribution was obtained in the assemblies with an uncertainty of about 7%. • Experiments were analyzed by MCNP code with ENDF/B-VI.8, ENDF/B-VII.0, JENDL-4.0 and CENDL-3.1 libraries. • Experimental results could be used to re-evaluate the cross sections of 232 Th(n, 2n) reaction. - Abstract: In order to verify the evaluated cross sections of 232 Th(n, 2n) reaction for the conceptual design of the thorium based subcritical blanket in the fusion–fission hybrid reactor, an integral experiment on thorium oxide/depleted uranium cylinders was carried out with D-T neutrons using the activation technique. 232 Th(n, 2n) reaction rate distribution was obtained at the central axis direction in the assemblies with an uncertainty of about 7%. Experiments were analyzed by using MCNP code with ENDF/B-VI.8, ENDF/B-VII.0, JENDL-4.0 and CENDL-3.1 libraries to validate the nuclear data libraries of 232 Th(n, 2n) reaction, the calculated results with JENDL-4.0 agree with the measurements the best with discrepancies within the experimental uncertainty. The average values of C/E for the three benchmark assemblies are 1.058, 1.044 and 0.980. Calculations with different evaluated libraries in the benchmark assemblies show a large discrepancy. The experimental results can be used to re-evaluate the cross sections of the 232 Th(n, 2n) reaction
Evaluation of cross sections of Th-232 and U-233
International Nuclear Information System (INIS)
Dias, A.M.
1978-01-01
The cross sections in multigroups of Th-232 and U-233 are evaluated by comparison of theoretical results and experimental data obtained through experiments on the fast reactors IBR-I, EBR-II, BR-I and AETR. The deviation between calculated values and experimental results is about 10%. They are therefore satisfatory for neutronic calculations [pt
Measurement of the 232Th-series activity in gas sockets
International Nuclear Information System (INIS)
Sutarman, I.
1995-01-01
The activity of 232 Th and its daughters in Th-based gas sockets is required for health risk assessment. By absolute measurement of the 228 Ac-and 212 Pb/ 208 Tl-activities, the total activity of the sockets can be assessed. It is governed by 228 Ra and 228 Th and the product age. (author) 1 fig.; 2 tabs
The computer-controlled GPIB-RS232 interface for data transmission
International Nuclear Information System (INIS)
Bai Xiaowei
1993-01-01
A kind of RS232-GPIB interface circuit is introduced, which provides communication between the serial system and the instrument with GPIB. Port P 1 of 8031 is used to select function mode as listener, talker or others. Under the control of a personal computer, the data communication is completed both in serial and the parallel modes
International Nuclear Information System (INIS)
Alnour, I.A.
2014-01-01
This work aimed to study the capability of INAA absolute method in determining the elemental concentration of 238 U and 232 Th in the rock samples. The INAA absolute method was implemented in PUSPATI TRIGA Mark II research reactor, Malaysian Nuclear Agency (NM). The accuracy of INAA absolute method was performed by analyzing the IAEA certified reference material (CRM) Soil-7. The analytical results showed the deviations between experimental and certified values were mostly less than 10 % with Z-score in most cases less than 1. In general, the results of analysed CRM Soil-7 show a good agreement between certified and experimental results which mean that the INAA absolute method can be used accurately for elemental analysis of uranium and thorium in various types of samples. The concentration of 238 U and 232 Th ranged from 1.77 to 24.25 and 0.88 to 95.50 ppm respectively. The highest value of 238 U and 232 Th was recorded for granite rock sample G17 of 238 U and sample G9 of 232 Th, whereas the lower value was 1.77 ppm of 238 U recorded in sandstone rock and 0.88 ppm of 232 Th for gabbro. Moreover, a comparison of the 238 U and 232 Th results obtained by the INAA absolute method shows an acceptable level of consistency with those obtained by the INAA relative method. (author)
Energy Technology Data Exchange (ETDEWEB)
Naik, H.; Goswami, A. [Bhabha Atomic Research Centre, Radiochemistry Division, Mumbai (India); Kim, G.N.; Kim, K. [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Suryanarayana, S.V. [Bhabha Atomic Research Centre, Nuclear Physics Division, Mumbai (India)
2013-10-15
The yields of various fission products in the 19.6, 32.2, and 44.8 MeV proton-induced fission of {sup 232}Th have been determined by recoil catcher and an off-line {gamma}-ray spectrometric technique using the BARC-TIFR Pelletron in India and MC-50 cyclotron in Korea. The mass-yield distributions were obtained from the fission product yield using the charge distribution corrections. The peak-to-valley (P/V) ratio of the present work and that of literature data for {sup 232}Th(p,f) and {sup 238}U(p,f) were obtained from the mass yield distribution. The present and the existing literature data for {sup 232}Th(p,f), {sup 232}Th(n,f), and {sup 232}Th({gamma},f) at various energies were compared with those for {sup 238}U(p,f), {sup 238}U(n,f), and {sup 238}U({gamma},f) to examine the probable nuclear structure effect. The role of Th-anomaly on the peak-to-valley ratio in proton-, neutron-, and photon-induced fission of {sup 232}Th was discussed with the similar data in {sup 238}U. On the other hand, the fine structure in the mass yield distributions of the fissioning systems at various excitation energies has been explained from the point of standard I and II asymmetric mode of fission besides the probable role of even-odd effect, A/Z ratio, and fissility parameter. (orig.)
232Th Mass Determination in a Uranium/Thorium Mixture for Safeguards Purposes
International Nuclear Information System (INIS)
Nangu, M.; Marumo, B.; Mbedzi, E.; Rasweswe, M.; Croft, S.; McElroy, R.; Chapman, J.; Bosko, A.
2015-01-01
In nuclear safeguards it is required that thorium content in safeguarded material should be quantified and reported as appropriate. As such the South African State System of Control and Accounting (SSAC) on discovering a number of safeguarded waste drums which contained considerable quantities of thorium decided to initiate a project to properly quantify their thorium content using a high purity germanium detector and In Situ Object Counting System (ISOCS) efficiency calibration software. These metal waste drums are contained inside overpacks which for health reasons cannot be opened and thus giving rise to the challenge of determining the exact fill heights and the density of the material. Fill heights determined using transmission sources and the material density calculated from them together with the geometry used for the overpacks could be used to further refine the ISOCS calibration geometry and thus improving the quantitative result. In order to have confidence on the ISOCS measurements, it was decided to also validate the ISOCS results through the preparation of similar density standards that would be used for the efficiency calibration in the determination of the 232Th activity in the material. In addition, MGAU v4.2, which was used to determine uranium enrichment in a measured material, also provides an approximate 232Th abundance relative to uranium content. ISOCS measurements of 232Th masses in waste drums were compared to MGAU results. Results of these studies are presented in this paper. (author)
2010-01-01
... applicants for benefits under the immigration laws and other aliens. 232.2 Section 232.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DETENTION OF ALIENS FOR PHYSICAL AND... immigration laws and other aliens. (a) General. When a medical examination is required of an alien who files...
49 CFR 232.503 - Process to introduce new brake system technology.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Process to introduce new brake system technology... Technology § 232.503 Process to introduce new brake system technology. (a) Pursuant to the procedures... brake system technology, prior to implementing the plan. (b) Each railroad shall complete a pre-revenue...
Mass distribution in 20Ne+232Th reaction
International Nuclear Information System (INIS)
Sodaye, Suparna; Tripathi, R.; Sudarshan, K.
2011-01-01
Mass distribution was measured in 20 Ne+ 232 Th reaction at E lab =145 MeV using recoil catcher technique followed by off-line gamma-ray spectrometry. Significant contribution from transfer fission was observed in the yield of comparatively neutron rich fission products. The variance of mass distribution for complete fusion fission, obtained by excluding neutron rich fission products, was observed to be consistent with the values reported in literature for similar reaction systems which showed a deviation from the systematics obtained using random neck rupture and liquid drop model. (author)
Concentration of 232Th, 230Th and 228Th in various tissues of Japanese subjects
International Nuclear Information System (INIS)
Takizawa, Y.; Qingmei, H.; Hisamatsu, S.; Abe, T.
1997-01-01
The concentration of 232 Th, 230 Th and 228 Th in various human tissues of Japanese subjects obtained at autopsies are reported. The tissue samples were weighed, spiked with 234 Th tracer and ashed by acid. The solution was dried on a hot-plate. Separation of thorium radionuclides was accomplished through cation-exchange resin chromatography and electrodeposition. The concentrations of thorium isotopes were measured by α-spectrometry. Thorium-232 and 230 Th concentrations were found to be highest in lung, followed by bone. The maximum concentration of 228 Th was in bone. The lowest concentrations of thorium isotopes were in muscle. (author)
25 CFR 1000.232 - When must DOI respond to a request for reconsideration?
2010-04-01
... INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.232 When must DOI respond to a request for...
International Nuclear Information System (INIS)
Simutkin, V.D.
2008-01-01
Conceptual analysis of accelerator-driven systems assumes extensive use of nuclear data on neutron-induced reactions at intermediate energies. In particular, information about the fission fragment yields from the 238 U(n,f) and 232 Th(n,f) reactions is of particular interest at neutron energies from 10 to 200 MeV. However, there is a lack of such data for both 238 U and 232 Th. Up to now, the intermediate energy measurements have been performed for 238 U only, and there are no data for the 232 Th(n,f) reaction. The aim of the work is to provide such data. Fission fragment mass distributions for the 232 Th(n,f) and 238 U(n,f) reactions have been measured for the incident neutron energies 32.8 MeV, 45.3 MeV and 59.9 MeV. The experiments have been performed at the neutron beam facility of the Universite Catholique de Louvain, Belgium. A multi-section Frisch-gridded ionization chamber has been used as a fission fragment detector. The data obtained have been interpreted in terms of the multimodal random neck-rupture model (MMRNRM). (authors)
34 CFR 75.232 - The cost analysis; basis for grant amount.
2010-07-01
... Secretary sets the amount of a new grant, the Secretary does a cost analysis of the project. The Secretary... objectives of the project with reasonable efficiency and economy under the budget in the application... 34 Education 1 2010-07-01 2010-07-01 false The cost analysis; basis for grant amount. 75.232...
Mobility of 232Th and 210Po in red mud.
Hegedűs, Miklós; Tóth-Bodrogi, Edit; Jónás, Jácint; Somlai, János; Kovács, Tibor
2018-04-01
The valorization of industrial by-products such as red mud became a tempting opportunity, but the understanding of the risks involved is required for the safe utilization of these products. One of the risks involved are the elevated levels of radionuclides (in the 100-1300 Bq/kg range for both the 238 U and 232 Th decay chains, but usually lower than 1000 Bq/kg, which is the recommended limit for excemption or clearance according to the EU BSS released in 2013) in red mud that can affect human health. There is no satisfactory answer for the utilization of red mud; the main current solution is still almost exclusively disposal into a landfill. For the safe utilization and deposition of red mud, it is important to be able to assess the leaching behaviour of radionuclides. Because there is no commonly accepted measurement protocol for testing the leaching of radionuclides in the EU a combined measurement protocol was made and tested based on heavy metal leaching methods. The leaching features of red mud were studied by methods compliant with the MSZ-21470-50 Hungarian standard, the CEN/TS 14429 standard and the Tessier sequential extraction method for 232 Th and 210 Po. The leached solutions were taken to radiochemical separation followed by spontaneous deposition for Po and electrodeposition for Th. The 332 ± 33 Bq/kg 232 Th content was minimally mobile, 1% became available for distilled water 1% and 6% for Lakanen-Erviö solution; the Tessier extraction showed minimal mobility in the first four steps, while more than 85% remained in the residue. The 210 Po measurements had a severe disturbing effect in many cases, probably due to large amounts of iron present in the red mud, from the 310 ± 12 Bq/kg by aqua regia digestion, distilled water mobilized 23%, while Lakanen-Erviö solution mobilized ∼13%. The proposed protocol is suitable for the analysis of Th and Po leaching behaviour. Copyright © 2018 Elsevier Ltd. All rights reserved.
(232)Th(d,4n)(230)Pa cross-section measurements at ARRONAX facility for the production of (230)U.
Duchemin, C; Guertin, A; Haddad, F; Michel, N; Métivier, V
2014-05-01
(226)Th (T1/2=31 min) is a promising therapeutic radionuclide since results, published in 2009, showed that it induces leukemia cells death and activates apoptosis pathways with higher efficiencies than (213)Bi. (226)Th can be obtained via the (230)U α decay. This study focuses on the (230)U production using the (232)Th(d,4n)(230)Pa(β-)(230)U reaction. Experimental cross sections for deuteron-induced reactions on (232)Th were measured from 30 down to 19 MeV using the stacked-foil technique with beams provided by the ARRONAX cyclotron. After irradiation, all foils (targets as well as monitors) were measured using a high-purity germanium detector. Our new (230)Pa cross-section values, as well as those of (232)Pa and (233)Pa contaminants created during the irradiation, were compared with previous measurements and with results given by the TALYS code. Experimentally, same trends were observed with slight differences in orders of magnitude mainly due to the nuclear data change. Improvements are ongoing about the TALYS code to better reproduce the data for deuteron-induced reactions on (232)Th. Using our cross-section data points from the (232)Th(d,4n)(230)Pa reaction, we have calculated the thick-target yield of (230)U, in Bq/μA·h. This value allows now to a full comparison between the different production routes, showing that the proton routes must be preferred. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Lancman, H.
1981-02-01
Intense proton beam currents from the Dynamitron at Brooklyn College have been used to generate gamma rays of variable energy from a number of (p,γ) resonances in various nuclei. Spectra of photofission fragments of 238 U and 232 Th have been measured with an average gamma ray energy resolution of approx. 300 eV. Structure in the photofission cross section of 232 Th was observed at approx. 6176 keV
49 CFR 232.217 - Train brake tests conducted using yard air.
2010-10-01
... reduction of brake pipe air pressure at the same, or slower, rate as an engineer's brake valve. (b) The yard... 49 Transportation 4 2010-10-01 2010-10-01 false Train brake tests conducted using yard air. 232... Train brake tests conducted using yard air. (a) When a train air brake system is tested from a yard air...
Concentration of E2 strength near the fission barrier of 232Th
International Nuclear Information System (INIS)
Arruda Neto, J.D.T.; Vannucci, M.F.B.M.; Herdade, S.B.; Vannucci, A.; Nascimento, I.C. do.
1981-08-01
The electrofission angular distribution of 232 Th, in the energy interval 5.5-7 MeV, was measured. The analysis of substantial amount of E2 fission strength is concentrated near the fission barrier, corresponding to (8 +- 2)% of one energy weighted sum rule unity. (Author) [pt
Evaluation of daily intake of 238U and 232Th in a Korean mixed diet sample using RNAA
International Nuclear Information System (INIS)
Chung, Yong Sam; Moon, Jong Hwa; Kim, Sun Ha; Park, Kwang Won; Kang, Sang Hoon; Cho, Seung Yeon
2000-01-01
To estimate the degree of intake of 238 U and 232 Th through daily diet, a Korean mixed diet sample was prepared after the investigation of the amount of consumption of the daily diet which corresponds to the age of 20 to 60 years. For the analysis of U and Th, the RNAA method was applied. Two standard reference materials were used for quality control and assurance and the analytical results were compared with a certified value. The determination of U and Th in the Korean mixed diet sample was carried out under the same analytical conditions and procedures with SRM. It is found that the concentration of U and Th in a Korean mixed diet was about 35.4 ppb and 3.4 ppb. From these results, the daily intake of 238 U and 232 Th by diet is evaluated to be 6.98 and 0.67 μg per day, respectively. Radioactivities related to the intake of 238 U and 232 Th were estimated to be about 86 mBq per person per day and the annual dose equivalents from 238 U and 232 Th revealed as 3.18 μSv and 0.29 μSv per person, respectively
K2-232 b: a transiting warm Saturn on an eccentric P = 11.2 d orbit around a V = 9.9 star
Brahm, R.; Espinoza, N.; Jordán, A.; Rojas, F.; Sarkis, P.; Díaz, M. R.; Rabus, M.; Drass, H.; Lachaume, R.; Soto, M. G.; Jenkins, J. S.; Jones, M. I.; Henning, Th; Pantoja, B.; Vučković, M.
2018-06-01
We report the discovery of K2-232 b using photometric data of the Kepler K2 satellite coupled with ground-based spectroscopic observations. K2-232 b has a mass of MP = 0.397 ± 0.037 MJ, a radius of RP = 1.00 ± 0.020 RJ, and a moderately low equilibrium temperature of Teq = 1030 ± 15 K due to its relatively large star-planet separation of a = 0.1036 au. K2-232 b orbits its bright (V = 9.9) late F-type host star in an eccentric orbit (e = 0.258 ± 0.025) every 11.2 d, and is one of only four well-characterized warm Jupiters having host stars brighter than V = 10. We estimate a heavy element content of 20 ± 7 M⊕ for K2-232 b, which is consistent with standard models of giant planet formation. The bright host star of K2-232 b makes this system a well-suited target for detailed follow-up observations that will aid in the study of the atmospheres and orbital evolution of giant planets at moderate separations from their host stars.
Alvarado, David M; Aferol, Hyuliya; McCall, Kevin; Huang, Jason B; Techy, Matthew; Buchan, Jillian; Cady, Janet; Gonzales, Patrick R; Dobbs, Matthew B; Gurnett, Christina A
2010-07-09
Clubfoot is a common musculoskeletal birth defect for which few causative genes have been identified. To identify the genes responsible for isolated clubfoot, we screened for genomic copy-number variants with the Affymetrix Genome-wide Human SNP Array 6.0. A recurrent chromosome 17q23.1q23.2 microduplication was identified in 3 of 66 probands with familial isolated clubfoot. The chromosome 17q23.1q23.2 microduplication segregated with autosomal-dominant clubfoot in all three families but with reduced penetrance. Mild short stature was common and one female had developmental hip dysplasia. Subtle skeletal abnormalities consisted of broad and shortened metatarsals and calcanei, small distal tibial epiphyses, and thickened ischia. Several skeletal features were opposite to those described in the reciprocal chromosome 17q23.1q23.2 microdeletion syndrome associated with developmental delay and cardiac and limb abnormalities. Of note, during our study, we also identified a microdeletion at the locus in a sibling pair with isolated clubfoot. The chromosome 17q23.1q23.2 region contains the T-box transcription factor TBX4, a likely target of the bicoid-related transcription factor PITX1 previously implicated in clubfoot etiology. Our result suggests that this chromosome 17q23.1q23.2 microduplication is a relatively common cause of familial isolated clubfoot and provides strong evidence linking clubfoot etiology to abnormal early limb development. Copyright 2010 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.
Mass distribution studies in 28Si + 232Th
International Nuclear Information System (INIS)
Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Pujari, P.K.
2014-01-01
Mass distribution is one of the important observables to understand the fusion-fission potential energy landscape. In the fission involving composite systems with Z ∼ 100, the fission barrier is lower and the saddle point is compact. Thus, apart from transfer induced fission,various non compound nucleus (NCN) fission processes like quasi-fission, pre-equilibrium fission and fast fission compete with the complete fusion fission (CFF). This would be further affected by the entrance channel parameters like choice of the target-projectile combination (mass asymmetry) and the projectile energy. Charge and mass distribution studies in such system would provide information about various fission processes such as complete fusion fission, non-compound nucleus fission and transfer induced fission, which would help in understanding the fusion-fission process in heavy ion collisions forming composite system in the heavy and trans-actinide region. In view of this, a systematic study of the charge and mass distribution in 28 Si+ 232 Th reaction was planned at beam energy close to and above the entrance channel Coulomb barrier. The experiments were carried out at the TIFR-LINAC booster facility. Self supporting foils of 232 Th were bombarded with 180 and 160 MeV 28 Si beam in a stack foil arrangement. The recoiling fission products were assayed radiochemically by off-line gamma-ray spectrometry. Results of charge distribution studies at E lab =180 MeV have been reported earlier. In the poster, the data on charge and mass distribution distribution will be presented.The results of the present studies will be compared with those from the reactions involving lighter and heavier composite systems
Torres-González, Pedro; Ortiz-Brizuela, Edgar; Cervera-Hernandez, Miguel Enrique; Bobadilla-Del Valle, Miriam; Martínez-Gamboa, Areli; Sifuentes-Osornio, José; Ponce-de-Leon, Alfredo
2016-10-01
We describe the outcomes and factors associated with OXA-232 producing carbapenem-resistant Enterobacteriaceae infections. A case-control-control study was performed; each case of infection by a carbapenem-resistant/OXA-232 (OXA-232-cases, n=27) was matched by isolation site, species, and date, with 2 cases of infection by carbapenem-susceptible/third-generation cephalosporin-susceptible (TGCS-controls, n=54) and 2 cases by carbapenem-susceptible/ESBL producing Enterobacteriaceae (ESBL-controls, n=54); 66% were urinary tract and 18.5% intra-abdominal infections. In the multivariable analysis with ESBL-controls, previous use β-lactam/β-lactamase antibiotics (OR 6.2; 95% CI 1.6-23.8) and, third-generation cephalosporins (OR 0.2; 95% CI 0.05-0.8) were associated with OXA-232 infection; with TGSC-controls previous use of β-lactam/β-lactamase antibiotics (OR 3.7; 95% 1.1-12.0) was associated. Among the OXA-232-cases, 29% received imipenem/cilastatin or meropenem, 11.1% ceftriaxone, 22.2% a carbapenem-based combination and 33.3% other antimicrobials as treatment. Previous β-lactam/β-lactamase antibiotics are associated with OXA-232 infections, and some may be treated with other active carbapenems or, in the absence of ESBL, third-generation cephalosporins. Copyright © 2016 Elsevier Inc. All rights reserved.
29 CFR 779.232 - Franchise or other arrangements which create a larger enterprise.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Franchise or other arrangements which create a larger... Apply; Enterprise Coverage Leased Departments, Franchise and Other Business Arrangements § 779.232 Franchise or other arrangements which create a larger enterprise. (a) In other instances, franchise...
CSER 95-003: Exemption from Criticality Alarm System requirement for 232-Z building
International Nuclear Information System (INIS)
Nirider, L.T.; Miller, E.M.
1995-01-01
This CSER establishes an exemption for 232-Z from the requirement for a Criticality Alarm System, because the formation of a critical configuration is not a credible event for any circumstance involving the cleaning out and removal of the Burning Hood and associated equipment
The status of 232Th and 233U for CENDL-3.0
International Nuclear Information System (INIS)
Liu Ping
2003-01-01
The new version CENDL-3.0 of China: Evaluated nuclear data library has been updated, and contains about 200 nuclides. Among them, the data of following nuclides have been newly evaluated or reevaluated: fissile nuclides 15, structure materials 18, light nuclides 3, fission products 116. The 232 Th and 233 U are newly evaluated
Energy Technology Data Exchange (ETDEWEB)
Simutkin, V.D. [Uppsala University, P.O Box 525, SE-751 20 Uppsala (Sweden)
2008-07-01
Conceptual analysis of accelerator-driven systems assumes extensive use of nuclear data on neutron-induced reactions at intermediate energies. In particular, information about the fission fragment yields from the {sup 238}U(n,f) and {sup 232}Th(n,f) reactions is of particular interest at neutron energies from 10 to 200 MeV. However, there is a lack of such data for both {sup 238}U and {sup 232}Th. Up to now, the intermediate energy measurements have been performed for {sup 238}U only, and there are no data for the {sup 232}Th(n,f) reaction. The aim of the work is to provide such data. Fission fragment mass distributions for the {sup 232}Th(n,f) and {sup 238}U(n,f) reactions have been measured for the incident neutron energies 32.8 MeV, 45.3 MeV and 59.9 MeV. The experiments have been performed at the neutron beam facility of the Universite Catholique de Louvain, Belgium. A multi-section Frisch-gridded ionization chamber has been used as a fission fragment detector. The data obtained have been interpreted in terms of the multimodal random neck-rupture model (MMRNRM). (authors)
International Nuclear Information System (INIS)
Khadijeh Rezaee Ebrahim Saraee; Elias Saion; Naghavi, K.
2009-01-01
The concentrations of 232 Th and 238 U were determined in 30 sediment samples, collected from the South China Sea bed of the east coast peninsular Malaysia. The samples were dried in an oven for 10 days at 65 C and stored in polyethylene bottles for future analysis. INAA used to analyse surficial sediments. The 232 Th and 238 U activities in surficial sediments determined. These activities increased from 14.02 to 30.17 Bq Kg -1 and from 47.49 to 113.69 Bq Kg -1 for 232 Th and 238 U , respectively. Results show diffuse distribution of 232 Th and 238 U actinides in studied area. The Th/Sc and U/Sc ratios of the suricial sediments have same distribution and the highest their values are in station EC12. The radioactive contamination of the investigated sector is compared with the results obtained of other coastal sediments of Malaysia. Results show activity contamination in coastal sediments of the South China Sea is lower than the Straits of Malacca and is the same with the Straits of Johor. (Author)
Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231
International Nuclear Information System (INIS)
Guillot, Ph.
1965-01-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through α,n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [fr
48 CFR 452.232-70 - Reimbursement for Bond Premiums-Fixed-Price Construction Contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reimbursement for Bond... Provisions and Clauses 452.232-70 Reimbursement for Bond Premiums—Fixed-Price Construction Contracts. As prescribed in 432.111, insert the following clause: Reimbursement for Bond Premiums—Fixed-Price Construction...
Emanation of 232U and its radioactive daughter products from respirable size particles
International Nuclear Information System (INIS)
Cuddihy, R.G.; Griffith, W.C.; Hoover, M.D.; Kanapilly, G.M.; Stalnaker, N.D.
1978-01-01
This study is to develop a model for the emanation of 232 U and its radioactive daughter products from particles of Th-U fuel material. The radiation doses to internal organs following inhalation of these particles can only be calculated by knowing the rate of emanation of the daughters from particles in the lung and the subsequent excretion or translocation of the daughters to other organs. The emanation mechanisms are recoil of the daughter nuclei from the particle during alpha decay of the parent, diffusion of inert gas daughters from the particle and dissolution of the particle itself in biological fluids. Experiments to evaluate these mechanisms will involve ThO 2 and UO 2 particles in the size range 0.1 to 1.0 μm MMAD uniformly labeled with 232 U. The influence of the material temperature history on emanation will be investigated by heat treating particles at 600 and 1400 0 C
Ramli, A Termizi; Hussein, A Wahab M A; Wood, A Khalik
2005-01-01
Concentrations of uranium-238 and thorium-232 in soil, water, grass, moss and oil-palm fruit samples collected from an area of high background radiation were determined using neutron activation analysis (NAA). U-238 concentration in soil ranged from 4.9 mg kg(-1) (58.8 Bq kg(-1)) to 40.4 mg kg(-1) (484.8 Bq kg(-1)), Th-232 concentration ranged from 14.9 mg kg(-1) (59.6 Bq kg(-1)) to 301.0 mg kg(-1) (1204 Bq kg(-1)). The concentration of U-238 in grass samples ranged from below the detection limit to 0.076 mg kg(-1) (912 mBq kg(-1)), and Th-232 ranged from 0.008 mg kg(-1) (32 mBq kg(-1)) to 0.343 mg kg(-1) (1.372 Bq kg(-1)). U-238 content in water samples ranged from 0.33 mg kg(-1) (4.0 Bq L(-1)) to 1.40 mg kg(-1) (16.8 Bq L(-1)), and Th-232 ranged from 0.19 mg kg(-1) (0.76 Bq L(-1)) to 0.66 mg kg(-1) (2.64 Bq L(-1)). It can be said that the concentrations of environmental U-238 and Th-232 in grass and water samples in the study area are insignificant. Mosses were found to be possible bio-radiological indicators due to their high absorption of the heavy radioelements from the environment.
48 CFR 52.232-33 - Payment by Electronic Funds Transfer-Central Contractor Registration.
2010-10-01
... Government under this contract shall be made by electronic funds transfer (EFT), except as provided in... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Payment by Electronic... CONTRACT CLAUSES Text of Provisions and Clauses 52.232-33 Payment by Electronic Funds Transfer—Central...
Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu
International Nuclear Information System (INIS)
Smith, A.B.; Guenther, P.T.
1982-01-01
Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu
International Nuclear Information System (INIS)
Aquino, Reginaldo R.; Pecequilo, Brigitte R.S.
2009-01-01
The natural radioactivity in superficial beach sand samples of 7 beaches of Great Vitoria, metropolitan region of the State of Espirito Santo, southeast Brazil, was determined from the 226 Ra, 232 Th and 4 0 K contents. The assessed beaches were Manguinhos, Camburi, Praia do Canto, Curva da Jurema, Itapua, Setibao and Areia Preta. Three samples of each beach were sealed in standard 100 mL polyethylene flasks and stored in order to obtain secular equilibrium in the 238 U and 232 Th series. All samples were measured by high resolution gamma spectrometry and the spectra were analyzed with the WinnerGamma software. The 232 Th concentration was determined from the average concentrations of 228 Ac, 212 Pb and 212 Bi and the 226 Ra concentration was determined from the average concentrations of 214 Pb and 214 Bi. Preliminary results show concentrations varying from 9 Bq.kg -1 to 6035 Bq.kg -1 for 232 Th, from 4 Bq.kg -1 to 575 Bq.kg -1 for 226 Ra and from 13 Bq.kg -1 to 142 Bq.kg -1 for 40 K. Areia Preta beach shows the highest values for 232 Th, while the highest value for 226 Ra was observed for Camburi beach. High values of 40 K were observed for Curva da Jurema beach. (author)
International Nuclear Information System (INIS)
Dean, L.N.
1994-02-01
Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D ampersand D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project
Energy Technology Data Exchange (ETDEWEB)
Dean, L.N. [Advanced Sciences, Inc., (United States)
1994-02-01
Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D&D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project.
226Ra, 232Th and 40K analysis in water samples from Assiut, Egypt
International Nuclear Information System (INIS)
El-Gamal, H.; Abdel Mageed, A.I.; El-Attar, A.L; Abdel Hamid, M.
2013-01-01
The activity concentrations of 226 Ra, 232 Th and 40 K were determined in water samples, using 2”x 2” NaI(Tl) scintillation detector. Water activity ranges from 0.07 to 0.59 Bq L−1 for 226 Ra, 0.05 to 0.37 Bq L−1 for 232 Th and 3.25 to 8.72 Bq L−1 for 40 K with mean values of 2.64, 2.22 and 119.50 Bq L−1, respectively. As far as the measured gamma radionuclides is concerned, the mean annual effective doses for all analyzed samples of water are in the range of 0.02–0.08, 0.03-0.17 and 0.03-0.10 mSv yr -1 for infants, children and adults, respectively, all being lower than the reference level of the committed effective dose recommended by the WHO.
Development of Indian cross section data files for Th-232 and U-233 and integral validation studies
International Nuclear Information System (INIS)
Ganesan, S.
1988-01-01
This paper presents an overview of the tasks performed towards the development of Indian cross section data files for Th-232 and U-233. Discrepancies in various neutron induced reaction cross sections in various available evaluated data files have been obtained by processing the basic data into multigroup form and intercomparison of the latter. Interesting results of integral validation studies for capture, fission and (n,2n) cross sections for Th-232 by analyses of selected integral measurements are presented. In the resonance range, energy regions where significant differences in the calculated self-shielding factors for Th-232 occur have been identified by a comparison of self-shielded multigroup cross sections derived from two recent evaluated data files, viz., ENDF/B-V (Rev.2) and JENDL-2, for several dilutions and temperatures. For U-233, the three different basic data files ENDF/B-IV, JENDL-2 and ENDL-84 were intercompared. Interesting observations on the predictional capability of these files for the criticality of the spherical metal U-233 system are given. The current status of Indian data file is presented. (author) 62 ref
High resolution photofission measurements in 238U and 232Th. Final report
International Nuclear Information System (INIS)
Lancman, H.
1985-12-01
A novel technique for measuring the photofission cross section with very high photon energy resolution has been developed. The photons are obtained from selected resonances in the (p,γ) reaction on various light nuclei. The photon energy resolution approaches 200 eV in favorable cases. The photon energy spread at each (p,γ) resonance is approx.20 keV on the average. Measurements of the photo-fission cross sections of 232 Th and 238 U have been carried out in the energy range from 5.8 to 12 MeV. Intermediate structure has been found in both nuclei at excitation energies around 6 MeV. Various properties of this structure, such as average areas of resonances, their spacing, width, and the underlying bakground, as well as the experimental fission probability averaged over the intermediate structure have been found to agree with theoretical predictions based on a double-humped fission barrier. In the case of 232 Th, the feature of this barrier, a rather high first hump and a deep secondary well, are quite different from those predicted by current theoretial barrier calculations. 13 refs., 4 figs., 3 tabs
17 CFR 232.105 - Limitation on use of HTML documents and hypertext links.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Limitation on use of HTML... Requirements § 232.105 Limitation on use of HTML documents and hypertext links. (a) Electronic filers must... exhibits to Form N-SAR in HTML. (b) Electronic filers may not include in any HTML document hypertext links...
PC interfacing using Centronics, RS232 and game ports
An, Pei
1998-01-01
The main links with your PC and the outside world are the centronic port, used for connecting the printer, the RS232 port, used for the mouse, and the games port for a joystick. This book explores how these input/output (I/O) ports can be put to use through a range of other interfacing applications. This is especially useful for laptop and palmtop PCs which cannot be fitted with internal I/O cards. A novel approach is taken by this book, combining the hardware through which the ports can be explored, and the software programming needed to carry out a range of experiments.Circuits are p
Determination of 232Th, 230Th and 228Th in liquid effluents from uranium mining
International Nuclear Information System (INIS)
Godoy, Jose Marcus de Oliveira
1979-10-01
A liquid scintillator αlpha spectrometer was built for the determination of Th- 228 , Th- 230 and Th- 232 in liquid effluents from Uranium mines and mills. The resolution of the αlpha spectrometer was found to be 200-300 KeV, when the scintillator was 8% T0P0, 0,77% scintimix-4 (91% PP0 and 9% Dimetil-P0P0P) and 10% of naphthalene in toluene. Aliquat-336 in xylene (30% v/v) was used to separate the thorium isotopes from other interfering radionuclides (U- 238 , U- 234 , Ra- 226 , Po- 210 ). Under the extraction experimental conditions, the detection limits were 1,2 pCi/1 for Th- 232 , 1,2 pCi/1 for Th- 230 and 0,9 pCi/1 for Th- 228 , for 1000 minutes of counting time. (author)
Extension of the Th-232 burnup chain in the WIMSD/4 program library
International Nuclear Information System (INIS)
Caldeira, A.D.
1991-07-01
The Th-232 burnup chain was extended through U-236, in the WIMSD/4 program library. The evolution of the values of k i nf and U-235 number density, as function of time, for the modified TRX1 problem, calculated with the new library, shows an improvement in the results when compared with LEOPARD program. (author)
Energy Technology Data Exchange (ETDEWEB)
Misdaq, M.A.; Elamyn, H.; Erramli, H. [Cadi Ayyad Univ., Nuclear Physics and Techniques Lab., Faculty of Sciences Semlalia, Marrakech (Morocco)
2008-04-15
Uranium ({sup 238}U) and thorium ({sup 232}Th) concentrations were measured in different foods widely consumed in Morocco by using C.R.-39 and L.R.-115 type II solid state nuclear track detectors (S.S.N.T.D.). Data obtained were compared to those obtained by using isotope dilution mass spectrometry (I.D.M.S.). Total daily intakes of {sup 238}U and {sup 232}Th for a typical food basket were estimated to be 1.3 {+-} 0.1 mBq d{sup -1} and 0.98 {+-} 0.08 mBq d{sup -1}, 1.4 {+-} 0.1 mBq d{sup -1} and 1.06 {+-} 0.08 mBq d{sup -1}, 1.7 {+-} 0.1 mBq d{sup -1} and 1.26 {+-} 0.08 mBq d{sup -1} and 2.0 {+-} 0.1 mBq d{sup -1} and 1.5 {+-} 0.1 Bq d{sup -1} for the 2-7 years, 7-12 years, 12-17 years and adult's age groups, respectively. Alpha-activities due to annual {sup 238}U and {sup 232}Th intakes from the ingestion of the studied foodstuffs were determined in different organs and tissues of the human body of members of the public by using the ICRP gastrointestinal tract and systemic part models for these radionuclides. Committed equivalent doses due to annual intakes of {sup 238}U and {sup 232}Th were evaluated in the human body organs and tissues for different age groups of the Moroccan population by exploiting data obtained for alpha-doses deposited by 1 Bq of {sup 238}U and 1 Bq of {sup 232}Th in the considered human organs and tissues. The influence of the mass of the target tissue and activities due to {sup 238}U and {sup 232}Th on the committed equivalent doses due to annual intakes of these radionuclides in the organs and tissues of the human body was studied. (authors)
Distribution of Th-232 and Th-228 in Santos and Sao Vicente Estuary, Sao Paulo, Brazil
Energy Technology Data Exchange (ETDEWEB)
Silva, P.S.C.; Mazzilli, B.P.; Favaro, D.I.T. [Instituto de Pesquisas Energeticas e Nucleares, Av. Lineu Prestes, 2242, Caixa Postal 05508-000, Cidade Universitaria, Sao Paulo (Brazil)]. e-mail: Pscsilva@ipen.br
2004-07-01
In the last decades considerable attention has been given to technologically enhanced natural occurring radioactive material (TENORM). Within this frame, of particular concern is the phosphate fertilizer industry. Santos Basin, located in Southwest Brazil, Sao Paulo State, comprising Santos and Sao Vicente estuarine system, is considered the most important industrial region of the country. Among the industrial activities present, phosphate fertilizer plants are responsible for the production of 69 millions tons of phosphogypsum waste, which is stockpiled in the surrounding environment. This waste concentrates radionuclides of the natural series originally present in the phosphate rock used as raw material. This study aims to evaluate the environmental impact of such activities in the sediments of the estuarine system. {sup 232} Th and {sup 228} Th concentrations in Santos and San Vicente estuary sediments were determined by Neutron activation analysis and Gamma spectrometry, respectively. {sup 232} Th concentration ranged from 6.5 to 198 Bq kg{sup -1} with mean value of 57 {+-} 39 Bq kg{sup -1}, for 42 samples. {sup 228} Th content varied from 12 to 110 Bq kg{sup -1} with a mean value of 74 {+-} 23 Bq kg{sup -1}, for 18 samples. It can be seen that the amount of {sup 232} Th is higher in the rivers close to the phosphogypsum piles, at least five points were identified as being affected by anthropogenic factor. (Author)
Distribution of Th-232 and Th-228 in Santos and Sao Vicente Estuary, Sao Paulo, Brazil
International Nuclear Information System (INIS)
Silva, P.S.C.; Mazzilli, B.P.; Favaro, D.I.T.
2004-01-01
In the last decades considerable attention has been given to technologically enhanced natural occurring radioactive material (TENORM). Within this frame, of particular concern is the phosphate fertilizer industry. Santos Basin, located in Southwest Brazil, Sao Paulo State, comprising Santos and Sao Vicente estuarine system, is considered the most important industrial region of the country. Among the industrial activities present, phosphate fertilizer plants are responsible for the production of 69 millions tons of phosphogypsum waste, which is stockpiled in the surrounding environment. This waste concentrates radionuclides of the natural series originally present in the phosphate rock used as raw material. This study aims to evaluate the environmental impact of such activities in the sediments of the estuarine system. 232 Th and 228 Th concentrations in Santos and San Vicente estuary sediments were determined by Neutron activation analysis and Gamma spectrometry, respectively. 232 Th concentration ranged from 6.5 to 198 Bq kg -1 with mean value of 57 ± 39 Bq kg -1 , for 42 samples. 228 Th content varied from 12 to 110 Bq kg -1 with a mean value of 74 ± 23 Bq kg -1 , for 18 samples. It can be seen that the amount of 232 Th is higher in the rivers close to the phosphogypsum piles, at least five points were identified as being affected by anthropogenic factor. (Author)
International Nuclear Information System (INIS)
Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.
2017-01-01
The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide
Activity concentrations of 226Ra, 232Th and 40K in brands of fertilisers used in Nigeria
International Nuclear Information System (INIS)
Jibiri, N. N.; Fasae, K. P.
2012-01-01
The activity concentration of naturally occurring radionuclides 40 K, 226 Ra and 232 Th have been measured in different brands of fertiliser samples sold to farmers in retail markets in six commercial cities in southwestern Nigeria. Gamma ray spectroscopy was employed in the measurements of these radionuclides. The results of measurements showed that the average activity concentration of 40 K in the nitrogen, phosphorus and potassium fertilisers across the cities varied from 3972.0 ±416.9 to 5089.3 ±111.3 Bq kg -1 , 9.9 ±7.3 to 450.6 ±14.3 Bq kg -1 for 226 Ra, while for 232 Th it varied from less than lower limit of detection to 15.1 ±2.8 Bq kg -1 . The activity concentrations of 40 K, 226 Ra and 232 Th in single super phosphate (SSP) fertilisers and phosphate rocks were also determined. However, high activity concentrations of 226 Ra were obtained in the SSP fertiliser and phosphate rocks and in particular, two brands of fertilisers from ITL/TAK and F and C companies. The values of the activity concentration of the radionuclides in the brands of fertilisers used in Nigeria are within the range of values reported in several other countries except 40 K. (authors)
Directory of Open Access Journals (Sweden)
R. Léguillon
2016-10-01
Full Text Available It is shown that the multinucleon transfer reactions is a powerful tool to study fission of exotic neutron-rich actinide nuclei, which cannot be accessed by particle-capture or heavy-ion fusion reactions. In this work, multinucleon transfer channels of the 18O+232Th reaction are used to study fission of fourteen nuclei 231,232,233,234Th, 232,233,234,235,236Pa, and 234,235,236,237,238U. Identification of fissioning nuclei and of their excitation energy is performed on an event-by-event basis, through the measurement of outgoing ejectile particle in coincidence with fission fragments. Fission fragment mass distributions are measured for each transfer channel, in selected bins of excitation energy. In particular, the mass distributions of 231,234Th and 234,235,236Pa are measured for the first time. Predominantly asymmetric fission is observed at low excitation energies for all studied cases, with a gradual increase of the symmetric mode towards higher excitation energy. The experimental distributions are found to be in general agreement with predictions of the fluctuation–dissipation model.
Directory of Open Access Journals (Sweden)
Chiba Satoshi
2013-03-01
Full Text Available A dispersive coupled-channel optical model potential (DCCOMP that couples the ground-state rotational and low-lying vibrational bands of 238U and 232Th nuclei is studied. The derived DCCOMP couples almost all excited levels below 1 MeV of excitation energy of the corresponding even-even actinides. The ground state, octupole, beta, gamma, and non-axial bands are coupled. The first two isobar analogue states (IAS populated in the quasi-elastic (p,n reaction are also coupled in the proton induced calculation, making the potential approximately Lane consistent. The coupled-channel potential is based on a soft-rotor description of the target nucleus structure, where dynamic vibrations are considered as perturbations of the rigid rotor underlying structure. Matrix elements required to use the proposed structure model in Tamura coupled-channel scheme are derived. Calculated ratio R(U238/Th232 of the total cross-section difference to the averaged σT for 238U and 232Th nuclei is shown to be in excellent agreement with measured data.
Probabilities of symmetric and asymmetric fission in the proton bombardment of Th{sup 232}
Energy Technology Data Exchange (ETDEWEB)
Bowles, B J [Atomic Energy Research Establishment, Chemistry Div., Harwell (United Kingdom); Brown, F; Butler, J P
1957-08-01
The ratio of symmetric to asymmetric fission in the proton bombardment of Th{sup 232} does not rise steadily with increasing proton energy; a periodic decrease in superposed upon the over-all increase. This is attributed to the changing pattern of various fission reactions, (p,f), (p,nf), etc. (author)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Grymes, Rosalind A.; Martin, Rodney Alexander; Dianati, Soheila
2016-01-01
These files contain more precise and accurate representations of the architectural, mechanical, electrical, plumbing, and site information pertaining to Sustainability Base, aka Collaborative Support Facility, aka N232. These supersede the 'bid' drawings released in STI 8112 previously. They are useful for NASA researchers and collaborators in modeling the performance characteristics of the facility. Otherwise, they do not contain new data.
Thermodynamically accessible titanium clusters TiN, N = 2-32.
Lazauskas, Tomas; Sokol, Alexey A; Buckeridge, John; Catlow, C Richard A; Escher, Susanne G E T; Farrow, Matthew R; Mora-Fonz, David; Blum, Volker W; Phaahla, Tshegofatso M; Chauke, Hasani R; Ngoepe, Phuti E; Woodley, Scott M
2018-05-10
We have performed a genetic algorithm search on the tight-binding interatomic potential energy surface (PES) for small TiN (N = 2-32) clusters. The low energy candidate clusters were further refined using density functional theory (DFT) calculations with the PBEsol exchange-correlation functional and evaluated with the PBEsol0 hybrid functional. The resulting clusters were analysed in terms of their structural features, growth mechanism and surface area. The results suggest a growth mechanism that is based on forming coordination centres by interpenetrating icosahedra, icositetrahedra and Frank-Kasper polyhedra. We identify centres of coordination, which act as centres of bulk nucleation in medium sized clusters and determine the morphological features of the cluster.
Energy Technology Data Exchange (ETDEWEB)
Oliveira, L.S.R.; Amorim, A.S.; Balthar, M.C.V.; Vilela, P.RT.; Santos, A. [Instituto de Defesa, Química, Biológica, Radiológica e Nuclear (IDQBRN), Rio de Janeiro, RJ (Brazil); Cardoso, D.O.; Izidoro, A.C.A.C. [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil); Pelegrineli, S.Q.; Silva, L.B.; Silva, S.L. [MAXIM Treinamento e Assessoria, Rio de Janeiro, RJ (Brazil); Santos, F.R.; Ribeiro, C.A.M.; Silva, D.C., E-mail: lucianosantarita@gmail.com, E-mail: domingosoliveiralvr71@gmail.com, E-mail: samuelfisica@yahoo.com.br [Universidade Estácio de Sá, Rio de Janeiro, RJ (Brazil)
2017-07-01
The identification of the occurrence of Th-232 in open environments using portable radiological identifiers (IRP) with scintillators, discriminating the environmental condition and NORM is important for the operational teams of the Institute of Chemical, Biological, Radiological and Nuclear Defense (IDQBRN) of the Army. The qualitative analysis by gamma energy spectrometry for the energies of Th-232 and its daughter radioisotopes, given the resolution that characterizes the scintillation crystals (NaI (Tl) - 7.5% and LaBr{sub 3} (Ce) - 2.9%) makes it possible to identify them. The purpose is to perform a qualitative analysis of the reliability of the response of these IRPs to the measurements of Th-232 generally found in the environment and in samples extracted from points where the thorium concentration is highest. The results show that the identification of this radionuclide by the IRP in the samples with the highest natural occurrence is achieved by measuring the energies of the daughter isotopes Ac-228, Tl-208, Bi-212 and Pb-212 allowing the discrimination of soils with natural occurrence of Th -232 and NORM. These measurements will be based on the procedures used by the operational teams in the field actions aimed at reducing exposure to this radiation, both for individuals occupationally exposed and for the population.
Production of 11Li in the (11B,11Li) reaction on 232Th
International Nuclear Information System (INIS)
Scott, D.K.; Buenerd, M.; Hendrie, D.L.; KeKelis, G.; Mahoney, J.; Menchaca-Rocha, A.; Olmer, C.
1975-01-01
Production of the neutron-rich nucleus 11 Li in the bombardment of 232 Th by 11 B at 114 MeV suggests that multinucleon transfer reactions induced by neutron excess heavy ions on heavy targets present a feasible method of measuring the mass excess of exotic light nuclei in the limit of stability
Neutron radiative capture cross section of 232Th in the energy range 0.1 to 1.2 MeV
International Nuclear Information System (INIS)
Jain, H.M.; Kailas, S.
1987-01-01
Recently reported neutron radiative capture cross section of 232 Th measurements in the energy range 0.1 to 1.2 MeV are compared with the calculations based on the statistical model Hauser-Feshbach theory using the spherical optical model transmission coefficients and simple Fermi gas level density formula. The calculations are in good agreement with the recent experimental data, reproducing both the absolute magnitude and the shape exhibited by the excitation function. The results of this comparative study can be used for improving the evaluation of the neutron radiative capture cross section of 232 Th. 16 refs., 3 tables, 4 figures. (author)
Neutron radiative capture cross section of 232Th in the energy range 0.1 to 1.2 MeV
International Nuclear Information System (INIS)
Jain, H.M.; Kailas, S.
1987-03-01
Recently reported neutron radiative capture cross section of Th-232 measurements in the energy range 0.1 to 1.2 MeV are compared with the calculations based on the statistical model Hauser-Feshbach theory using the spherical optical model transmission coefficients and simple Fermi gas level density formula. The calculations are in good agreement with the recent experimental data, reproducing both the absolute magnitude and the shape exhibited by the excitation function. The results of this comparative study can be used for improving the evaluation of the neutron radiative capture cross section of Th-232. (author)
International Nuclear Information System (INIS)
Lee, Yong-Deok; Lee, Young-Ouk; Park, Joo-Hwan
2007-01-01
In recent years, several studies of neutron induced reaction on thorium were carried out in the framework of an IAEA coordinate research project involving a US contribution. The importance of Th-232 is for an innovative fuel cycle concept based on thorium fuel. Thorium fuels are also considered in accelerator driven system (ADS) to produce the power and radioactive waste transmutation. Therefore, the accurate neutron cross section for fission is crucially important for the design of various reactor systems. On December 2006, the ENDF/B-VII involving the new evaluation of actinides for Th-U fuel cycle was released. From the current environmental change, increasing oil price, air pollution by carbon dioxide, drain of oil resource, increasing demand of electricity, and energy independence, nuclear power is slowly to start to be reconsidered recently and it might be an alternative proposal as a production facility of energy and a reuse of resources. Even though it produces the nuclear wastes, it has an advantage in the emission of greenhouse gases. Therefore, new concept of nuclear technology to be developed for power production is subject to the condition of increased safety, reduction of nuclear wastes, resistance to nuclear material proliferation, Thorium fuel cycle is the most feasible option to satisfy the condition. Specially, thorium reserves are much larger than those of uranium
International Nuclear Information System (INIS)
Tomazini da Conceicao, Fabiano; Bonotto, Daniel Marcos; Jimenez-Rueda, Jairo Roberto; Frutuoso Roveda, Jose Arnaldo
2009-01-01
The common use of phosphate fertilizers NPK and amendments in sugar cane crops in Brazilian agriculture may increase the 226 Ra, 232 Th and 40 K activity concentrations in soils and their availability for plants and human food chain. Thus, the main aim of this study was to evaluate the distribution of 226 Ra, 232 Th and 40 K in soils and sugar cane crops in the Corumbatai river basin, Sao Paulo State, Brazil. The gamma spectrometry was utilized to measure the 226 Ra, 232 Th and 40 K activity concentration in all samples. The soil-to-sugar cane transfer factors (TF) were quantified using the ratio between the radionuclide activity concentration in sugar cane and its activity concentration in soil. The results show that, although radionuclides incorporated in phosphate fertilizers and amendments are annually added in the sugar cane crops, if utilized in accordance with the recommended rates, their use does not lead to hazards levels in soils. The soil-to-sugar cane transfer of radionuclides occurred in the following order 40 K> 226 Ra> 232 Th. Therefore, under these conditions, radionuclides intake through consumption of sugar is not hazardous to human health.
Prototype of A/Duck/Sukoharjo/Bbvw-1428-9/2012 subtipe H5N1 clade 2.3.2 as vaccine on local duck
Directory of Open Access Journals (Sweden)
Risa Indriani
2014-06-01
Full Text Available A/Duck/Sukoharjo/Bbvw-1428-9/2012 virus subtipe H5N1 clade 2.3.2 as seed vaccine on local duck. AI H5N1 clade 2.3.2 vaccine containing 256 HAU per dose was formulated using adjuvant ISA 71VG Montanide ™. Six groups of one day old local duck were used in this study. Three groups (10 ducks per group were vaccinated and 3 groups (9 duck per group were served control. Vaccination was conducted when the duck were three weeks old of age using single dose. Three weeks after vaccination when the duck were challenged either with HPAI H5N1 clade 2.3.2, or HPAI H5N1 clade 2.1.3 virus at dose 106 EID50/ 0.1 ml by drops intranasaly. Result showed that vaccination produced 100% protection compared to unvaccinated ducks againt HPAI subtipe H5N1 clade 2.3.2, and 100% protection againt HPAI H5N1 clade 2.1.3 (A/ck/wj/Subang-29/2007 and A/ck/wj/Smi-Part/2006, while unvaccinated ducks showed virus shedding on day 3 post infection.
Seismic analysis of safety class 1 incinerator glovebox in building 232-Z 200 W Area
International Nuclear Information System (INIS)
Ocoma, E.C.
1994-09-01
This report documents the seismic evaluation for the existing safety class 1 incinerator glovebox in 232Z Building. The glovebox is no longer in use and most of the internal mechanical equipment have been removed. However, the insulation firebricks are still in the glovebox for proper disposal
Energy Technology Data Exchange (ETDEWEB)
Lan, Chang-lin; Qiu, Yi-jia; Wang, Qiang; Zhang, Zheng-wei; Zhang, Qian; Tan, Jun-cai; Fang, Kai-hong [Lanzhou University, School of Nuclear Science and Technology, Lanzhou (China); Lai, Cai-feng [China Academy of Engineering Physics, Institute of Nuclear Physics and Chemistry, Mianyang (China)
2017-06-15
The fission cross sections of {sup 232}Th(n,f){sup 131m,g}Sn, {sup 232}Th(n,f){sup 131}Sb, {sup 232}Th(n,f){sup 131m,g}Te, {sup 232}Th(n,f){sup 131}I fission reactions induced by 14 MeV neutrons were measured precisely with the neutron activation technique. The neutron flux was monitored by accompanying α particle in the irradiation and the neutron energies were determined by the cross section ratio of {sup 90}Zr(n,2n){sup 89}Zr to {sup 93}Nb(n,2n){sup 92m}Nb reaction. The values of the cross sections of {sup 232}Th(n,f){sup 131m,g}Sn were analyzed, and the cross sections of {sup 232}Th(n,f){sup 131}Sb were deduced to be 6.5±0.7, 6.3±0.6, 6.1±0.6 mb at 14.1±0.3, 14.5±0.3 and 14.8±0.3 MeV, respectively. The values of the cross sections of {sup 232}Th(n,f){sup 131g}Te were deduced to be 1.8 ± 0.1, 1.5 ± 0.1 and 1.4±0.1 mb at 14.1±0.3, 14.5±0.3 and 14.8±0.3 MeV, respectively. The values of the cross sections of {sup 232}Th(n,f){sup 131}I were given as 1.8±0.2, 1.6±0.2, 1.5±0.1 mb at 14.1±0.3, 14.5±0.3 and 14.8±0.3 MeV, respectively. (orig.)
Mechanism of 232U production in MTR fuel evolution of activity in reprocessed uranium
International Nuclear Information System (INIS)
Harbonnier, G.; Lelievre, B.; Fanjas, Y.; Naccache, S.J.P.
1993-01-01
The use of reprocessed uranium for research reactor fuel fabrication implies to keep operators safe from the hard gamma rays emitted by 232 U daughter products. CERCA has carried out, with the help of French CEA and COGEMA, a detailed study to determine the evolution of the radiation dose rate associated with the use of this material. (author)
International Nuclear Information System (INIS)
US Department of Energy Nevada Operations Office
1999-01-01
This Corrective Action Decision Document/Closure Report (CADD/CR) has been prepared for Corrective Action Unit (CAU) 232, Area 25 Sewage Lagoons, in accordance with the Federal Facility Agreement and Consent Order. Located at the Nevada Test Site in Nevada, approximately 65 miles northwest of Las Vegas, CAU 232 is comprised of Corrective Action Site 25-03-01, Sewage Lagoon. This CADD/CR identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's (DOE/NV's) recommendation that no corrective action is deemed necessary for CAU 232. The Corrective Action Decision Document and Closure Report have been combined into one report because sample data collected during the July 1999 corrective action investigation (CAI) activities disclosed no evidence of contamination at the site. Contaminants of potential concern (COPCs) addressed during the CAI included total volatile organic compounds, total semivolatile organic compounds, total Resource Conservation and Recovery Act metals, total pesticides, total herbicides, total petroleum hydrocarbons (gasoline and diesel/oil range), polychlorinated biphenyls, isotopic uranium, isotopic plutonium, strontium-90, and gamma-emitting radionuclides. The data confirmed that none of the COPCs identified exceeded preliminary action levels outlined in the CAIP; therefore, no corrective actions were necessary for CAU 232. After the CAI, best management practice activities were completed and included installation of a fence and signs to limit access to the lagoons, cementing Manhole No. 2 and the diverter box, and closing off influent and effluent ends of the sewage lagoon piping. As a result of the CAI, the DOE/NV recommended that: (1) no further actions were required; (2) no Corrective Action Plan would be required; and (3) no use restrictions were required to be placed on the CAU
The Distributions of the Radionuclides Ra-226, Th-232 and K-40 in Various Parts of The Alfalfa Plant
International Nuclear Information System (INIS)
Salahel Din, K.; Harb, S.; Abbady, A.; Saad, N.
2011-01-01
The distribution of naturally occurring Ra-226, Th-232 and K-40 in different part of alfalfa plant from two different soils of Qena (South Valley University and Qena governorate farms) was studied under natural field conditions. Sixty two samples (alfalfa plant and its soil) were taken from nine sites inside farms. The samples were analyzed for their Ra-226, Th-232 and K-40 activity concentrations using gamma ray spectrometer consists of 3 x 3 NaI (Tl). The daily intakes of these radioisotopes by calves, milking cattle and sheep were calculated by multiplying concentrations in alfalfa and the daily consumption rates of these plants.
P-wave assignment of 232Th neutron resonances
International Nuclear Information System (INIS)
Corvi, F.; Pasquariello, G.; Veen, T. van der
1978-01-01
A method of p-wave assignment which exploits the parity dependence of the primary capture γ-ray spectrum was applied to the 232 Th resonance. The yield of capture γ-rays above 4.4 MeV from a 6 mm thick metallic thorium disk was measured in the neutron energy range 20-2200 eV and compared to a similar run with γ-rays in the range 3.7 - 4.4 MeV. A total of 58 resonances showing an enhancement of the high energy γ-ray yield were assigned as p-waves. Assuming that their reduced neutron widths follow a Porter-Thomas distribution, their average value and then the p-wave strength function S 1 were estimated with a maximum likelihood method. The results are: average neutron width=3.4(+0.8 or -0.6)meV; S 1 = 2.0 (+0.5 or -0.4).10 -4
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
USB and RS232 voltage datalogger
Directory of Open Access Journals (Sweden)
Lorenzo Hernández Tabares
2011-01-01
Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 st1:*{behavior:url(#ieooui } /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} The design and construction of a PIC microcontroller based datalogger with USB 2.0 and RS232 interfaces is presented. The datalogger has one 0 to +10VDC analogue input, 10bits ADC, Real Time Clock, 4k sample room on the microcontroller’s program flash memory and an external DC power supply. This paper proposes a cheap variant to construct such device widely used in meteorological and environmental instrumentation among others. The prototype was attached to an Ultraviolet Photometric O3 Analyzer for recording the environmental (tropospheric ozone concentration in a control station at the Havana city. Key words: datalogger, USB, enviromental ozone
International Nuclear Information System (INIS)
Shi Chengying; Li Tiantuo; Zhu Wenkai; Zhang Quanhu
1999-01-01
The author discusses the construction of distant total distributed measuring and controlling system based on RS-232 communication. The merits of this system are simple construction, reliable performance, big communication distance, and wide covering range. The system fits in with application in radiation environment. The author also discusses the system's hardware equipment and communication protocol
International Nuclear Information System (INIS)
Fonseca, Leandro M.; Pecequilo, Brigitte R.S.
2015-01-01
The titanium dioxide used as the white pigment in paints is produced from the processing of ilmenite minerals. As monazite, the main ilmenite radioactive contaminant, contains 1 to 20% thorium dioxide and also some uranium traces, so, eventually, wall paints can contain radioactivity. Activity concentrations of the naturally occurring radionuclides 226 Ra, 232 Th and 40 K were determined in 15 Brazilian economic wall paints samples, by high resolution gamma-ray spectrometry. The activities concentrations in the studied samples ranged from 1.3 ± 0.2 Bq/kg to 23.4 ± 0.7 Bq/kg for 226 Ra; from 2.5 ± 0.4 Bq/kg to 45.8 ± 1.5 Bq/kg for 232 Th and from 5.8 ± 2.1 Bq/kg to 157 ± 22 Bq/kg for 40 K. The radium equivalent index, calculated from the 226 Ra, 232 Th and 40 K concentrations, varied from 1.30 Bq/kg up to 95.9 Bq/kg, below the value of 370 Bq/kg recommended by OECD for a safety use in residential building applications. (author)
Estimation of radionuclide concentration of 238U, 226Ra, 232Th in air in Wuhan city
International Nuclear Information System (INIS)
Shi Jinhua; Chen Changhua
1989-01-01
The concentrations of 238 U, 226 Ra and 232 Th in air in Wuhan area were estimated by assuming that they originate from resuspended particles of soil and investigating the dust content in air and the concentrations of these radionuclides in soil. 60 soil samples were collected from April to October, 1984, and 7346 air dust samples during 1981-1985. The estimated mean air concentrations of 238 U, 226 Ra and 232 Th were 24.0 x 10 -9 , 18.9 x 10 -9 and 28.7 x 10 -9 , Bq/L, respectively. Their highest values were observed of 30.4 x 10 -9 , 23.9 x 10 -9 and 36.2 x 10 -9 Bq/L in 1983. Seasonal change of the concentrations was clear as shown in the data of 1984 and 1985, which was related to the meterological conditions. Among the 6 districts of Wuhan city, the highest concentration was in Qingshan and the lowest in Wuchang
Sugimori, Daisuke; Watanabe, Mika; Utsue, Tomohiro
2013-01-01
The lipids (fats and oils) degradation capabilities of soil microorganisms were investigated for possible application in treatment of lipids-contaminated wastewater. We isolated a strain of the bacterium Raoultella planticola strain 232-2 that is capable of efficiently catabolizing lipids under acidic conditions such as in grease traps in restaurants and food processing plants. The strain 232-2 efficiently catabolized a mixture (mixed lipids) of commercial vegetable oil, lard, and beef tallow (1:1:1, w/w/w) at 20-35 °C, pH 3-9, and 1,000-5,000 ppm lipid content. Highly effective degradation rate was observed at 35 °C and pH 4.0, and the 24-h degradation rate was 62.5 ± 10.5 % for 3,000 ppm mixed lipids. The 24-h degradation rate for 3,000 ppm commercial vegetable oil, lard, beef tallow, mixed lipids, and oleic acid was 71.8 %, 58.7 %, 56.1 %, 55.3 ± 8.5 %, and 91.9 % at pH 4 and 30 °C, respectively. R. planticola NBRC14939 (type strain) was also able to efficiently catabolize the lipids after repeated subculturing. The composition of the culture medium strongly influenced the degradation efficiency, with yeast extract supporting more complete dissimilation than BactoPeptone or beef extract. The acid tolerance of strain 232-2 is proposed to result from neutralization of the culture medium by urease-mediated decomposition of urea to NH(3). The rate of lipids degradation increased with the rates of neutralization and cell growth. Efficient lipids degradation using strain 232-2 has been achieved in the batch treatment of a restaurant wastewater.
A Boy with an LCR3/4-Flanked 10q22.3q23.2 Microdeletion and Uncommon Phenotypic Features
Petrova, E.; Neuner, C.; Haaf, T.; Schmid, M.; Wirbelauer, J.; Jurkutat, A.; Wermke, K.; Nanda, I.; Kunstmann, E.
2014-01-01
The recurrent 10q22.3q23.2 deletion with breakpoints within low copy repeats 3 and 4 is a rare genomic disorder, reported in only 13 patients to date. The phenotype is rather uncharacteristic, which makes a clinical diagnosis difficult. A phenotypic feature described in almost all patients is a delay in speech development, albeit systematic studies are still pending. In this study, we report on a boy with an LCR3/4-flanked 10q22.3q23.2 deletion exhibiting an age-appropriate language development evaluated by a standardized test at an age of 2 years and 3 months. The boy was born with a cleft palate – a feature not present in any of the patients described before. Previously reported cases are reviewed, and the role of the BMPR1A gene is discussed. The phenotype of patients with an LCR3/4-flanked 10q22.3q23.2 deletion can be rather variable, so counseling the families regarding the prognosis of an affected child should be done with caution. Long-term studies of affected children are needed to delineate the natural history of this rare disorder. PMID:24550761
International Nuclear Information System (INIS)
Shiraishi, K.
1995-01-01
Thorium-232 and 238 U contents in four food groups were measured by inductively coupled plasma mass spectrometry (ICP-MS). Daily intakes of 232 Th and 238 U for Japanese were estimated to 2.22 mBq and 15.5 mBq per person, respectively. Furthermore, preliminary estimations were made for the effects of imported foods on internal exposures for Japanese. (author). 16 refs., 1 fig., 3 tabs
International Nuclear Information System (INIS)
Antovic, N.M.; Popovic, V.; Vukotic, P.
2011-01-01
A coincidence method for measuring 137 Cs, 40 K, 226 Ra and 232 Th decay products activity in soil, vegetation and fish samples, was applied to the six-crystal gamma-coincidence spectrometer PRIPYAT-2M. In this way, some problems appeared in simultaneous measurement of 137 Cs, 226 Ra and 232 Th by NaI(Tl) detectors and the PRIPYAT-2M spectrometer were solved. The obtained results were agreeable with the HPGe spectrometer ones. (author)
International Nuclear Information System (INIS)
Pessenda, L.C.R.; Nascimento Filho, V.F. do; Nadai, E.A. de; Barros Ferraz, E.S. de; Sao Paulo Univ., Piracicaba
1988-01-01
The natural radioactivity in Ra-226 and Th-232 in samples of natural phosphates, industrial gypsums (phosphogypsums) and surface soils of different regions was measured by γ-ray spectrometry. The majority of phosphates and gypsums examined showed significantly higher values than soils, mainly in relation to Ra-226 activity. The activity ranges found for phosphates, gypsums and soils were: 79.1 - 3180 Bq/kg, 56.3 - 986.6 Bq/kg, 8.8 - 54.3 Bq/kg for Ra-226 and 33.6 - 1450.3 Bq/kg; 17.4 - 130,1 Bq/kg, 9.8 - 108.9 Bq/kg for Th-232, respectively. (author) [pt
International Nuclear Information System (INIS)
Hancock, G.J.
2000-01-01
Thorium-series nuclides ( 228 Th and 232 Th) have been used to identify resuspended sediment in the Bega River estuary, south-eastern Australia. A non-conservative increase in concentration of suspended sediment of water in the vicinity of mid-estuary back-flow lagoons was associated with a decrease in the 228 Th/ 232 Th activity ratio (AR) of the suspended sediment. The lagoon sediment is characterized by a low estuarine 228 Th/ 232 Th signature, distinguishing it from freshwater suspended sediment recently delivered to the estuary, and identifying it as the likely source of the additional suspended sediment. Sediment-core 210 TPb profiles show that the lagoons are accumulating sediment, presumably during high river-flow events. However this study indicates that during intervening periods of low flow, 40% of sediment deposited in the lagoons is subsequently resuspended and exported to the lower estuary, and possibly to the ocean. The utility of the 228 Th/ 232 Th AR to quantify sediment resuspension in estuaries is likely to be estuary-dependent, and is controlled by the extent of scavenging of dissolved 228 Th by suspended particles. Copyright (2000) CSIRO Publishing
International Nuclear Information System (INIS)
Maxwell, Omeje; Wagiran, Husin; Ibrahim, Noorddin; Lee, Siak Kuan; Sabri, Soheil
2013-01-01
The study of activity concentration of 232 Th, 238 U and 40 K of rock samples from site one (S1L1–S1L11, 70 m) and site two (S2L1–S2L9, 60 m) boreholes in Dei-Dei and Kubwa was presented and the first time in the region to be compared. Activity concentrations were analysed using a high resolution co-axial HPGe gamma ray spectrometer system. The activity concentration ranges in site one borehole were from 45±1 to 98±6 Bq kg −1 for 232 Th, from 18±2 to 37±4 Bq kg −1 for 238 U and from 254 ±32 Bq kg −1 to 1195 ±151 Bq kg −1 for 40 K. The activity concentration ranges in site two borehole were from 32±3 to 84±7 Bq kg −1 for 232 Th, from 15±2 to 52±5 Bq kg −1 for 238 U and from 119±15 to 705±94 for 40 K Bq kg −1 . Significantly higher concentration of 232 Th and 238 U occurs in samples collected from S1L7, S1L11 and S2L1 layers. These zones experienced granitic intrusions produced by denudation and tectonism. 40 K in rock samples of S1L4 and S2L4 activity concentrations is close; it could be that biotite granitic intrusion that is inferred as the formation in that layer reflects the same activity of potassium in rock's radioactivity measurement. The area requires further investigation of soil geochemistry and activity concentration of radionuclides in groundwater. - Highlights: • Activity concentration of 238 U, 232 Th and 40 K was noted high. • The two boreholes show significant different concentrations of 238 U, 232 Th and 40 K. • The Th/U ratio was high in both, but distinctly higher in first borehole. • 232 Th was increasing with depth in site one almost 100%. • The radiological monitoring on groundwater is recommended
Energy Technology Data Exchange (ETDEWEB)
Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J., E-mail: biologofabiano10@gmail.com [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)
2017-07-01
The natural radioactive isotopes come from the radioactive series of the {sup 238}U (Uranium Series), the {sup 235}U (Actinium Series) and the {sup 232}Th (Thorium Series) series, or they can occur in isolation as is the case with the {sup 40}K. Primordial radionuclides such as {sup 40}K, {sup 232}Th, {sup 235}U and {sup 238}U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of {sup 40}K, {sup 226}Ra and {sup 228}Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of {sup 40}K, {sup 226}Ra and {sup 228}Ra were 12, 15 and 20 Bq kg{sup -1}, respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide.
Energy Technology Data Exchange (ETDEWEB)
Sen, Sujoy, E-mail: sujoy@igcar.gov.in [Core Design Group, IGCAR, Kalpakkam (India); Prasad, Rajeev Ranjan; Bagchi, Subhrojit [Core Design Group, IGCAR, Kalpakkam (India); Mohanakrishnan, P. [MCNS, Manipal University, Manipal (India); Arul, A. John; Puthiyavinayagam, P. [Core Design Group, IGCAR, Kalpakkam (India)
2015-11-15
Highlights: • Nuclear data processing for multigroup neutron transport calculation. • Discrete ordinate and Monte Carlo neutron transport. • Breeding of Thorium in Fast Reactor. • Minimization of U{sup 232} in U{sup 233}. • Fuel burn up using Neutron Diffusion. - Abstract: Presence of U{sup 232} in U{sup 233} bred in thorium blanket of fast reactor is a major concern in fuel reprocessing. The former's daughter products being hard gamma emitter and the isotope itself having substantial half life, its presence beyond 10 ppm makes fuel recycle complicated and expensive. In this study possibility of decreasing U{sup 232} production in a typical FBR blanket by means of spectrum modification is examined. SS, depleted B{sub 4}C, SiC, Mo and W regions were introduced between core and radial blanket and evolution of isotopes were studied to arrive at an optimal configuration that satisfies requirements of breeding U{sup 233} and lowering U{sup 232}concentration. SS, B{sub 4}C, SiC, Mo and W are known to be high temperature material with appropriate stability in harsh fast reactor environment. Study has shown that introducing two SS reflector rows can achieve the required low value of U{sup 232}concentration without greatly compromising the U{sup 233}production.
Design of a general purpose (RS-232C) analog-to-digital data converter
International Nuclear Information System (INIS)
Ali, Q.
1995-01-01
The purpose of this project is to design a general purpose hardware that interfaces analog devices with any desirable computer supporting the RS-232 interface. The hardware incorporates bidirectional data transmission at 1,200 bps, 2,400 bps, 4800 bps, 9,600 bps, 19,200 pbs and 38400 bps. The communication / processing software has been written in C language that incorporates the idea of the potability of the software from one environment to the other. (author)
Energy Technology Data Exchange (ETDEWEB)
DOE/NV Operations Office
1999-05-01
This Corrective Action Investigation Plan (CAIP) has been developed in accordance with the Federal Facility Agreement and Consent Order (FFACO) (1996) that was agreed to by the US Department of Energy, Nevada Operations Office (DOE/NV); the State of Nevada Division of Environmental Protection (NDEP); and the US Department of Defense. The CAIP is a document that provides or references all of the specific information for investigation activities associated with Corrective Action Units (CAUs) or Corrective Action Sites (CASs). According to the FFACO, CASs are sites potentially requiring corrective action(s) and may include solid waste management units or individual disposal or release sites. A CAU consists of one or more CASs grouped together based on geography, technical similarity, or agency responsibility for the purpose of determining corrective actions. This CAIP contains the environmental sample collection objectives and criteria for conducting site investigation activities at CAU 232, Area 25 Sewage Lagoons. Corrective Action Unit 232 consists of CAS 25-03-01, Sewage Lagoon, located in Area 25 of the Nevada Test Site (NTS). The NTS is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1) (DOE/NV, 1996a). The Area 25 Sewage Lagoons (Figure 1-2) (IT, 1999b) are located approximately 0.3 mi south of the Test Cell 'C' (TCC) Facility and were used for the discharge of sanitary effluent from the TCC facility. For purposes of this discussion, this site will be referred to as either CAU 232 or the sewage lagoons.
What can be learnt from the channel analysis of the 232Th neutron fission cross section
International Nuclear Information System (INIS)
Abou Yehia, H.; Jary, J.; Trochon, J.; Boldeman, J.W.; Musgrove, A.R. de L.
1979-10-01
Channel analyses of the neutron fission cross section of 232 Th have been made in two laboratories. The calculated fission cross sections and fission fragment anisotropies are compared with the experimental data. Despite some differences in the methods used, the conclusions on the physical aspects of the fission process are very similar
International Nuclear Information System (INIS)
Shen Hua; Geng Junxia; Gao Size; Zhang Guoxin; Zhang Lan; Li Wenxin; Li Qingnuan; Wu Guozhong
2014-01-01
The electrochemical parameters on nickel plating on the copper have been studied using aqueous electroplating technique. And thorium is plated on the nickel flake using molecular plating technique. The better experimental parameters are obtained. According to these optimized parameters, the "2"3"2Th target which is suitable for Cyclone-30 accelerator is prepared. The proton beam with energy of 21 MeV bombed the "2"3"2Th target (total beam time 20 μAh). The results showed that the better range of plating current density of nickel plated on copper is l.30∼1.68 A/dm"2. The thickness of nickel plating layer can reach more than 10 μm. The current density is 3∼5 mA/cm"2, and the thickness of plated thorium layer is up to micrometer scale. The binding force of as-prepared "2"3"2Th target is very well. There is "2"3"0Pa appeared after the target is bombed by the proton beam. (authors)
International Nuclear Information System (INIS)
Durham, R.W.; Joshi, S.R.
1979-01-01
A method is described for the determination of 228 Th, 230 Th, and 232 Th in environmental samples from uranium mining and milling operations. The analytical procedure is based on the direct determination of 228 Th in the sample by high resolution γ-spectrometry followed by extraction and purification of the thorium fraction using high molecular weight amines and an anion-exchange technique, respectively, prior to α-spectrometry to determine isotopic ratios. The lowest level of detection for each thorium isotope is 0.01 pCi/g for solid samples and 20 pCi/l for aqueous samples. Replicate analyses of a typical mine waste stream gave a standard deviation of +-3% for 228 Th. Standard deviations of the 230 Th and 232 Th increased to +-11% apparently due to traces of 210 Po interfering in the α-spectrometry. (author)
Warnock, Geoffrey; Sommerauer, Michael; Mu, Linjing; Pla Gonzalez, Gloria; Geistlich, Susanne; Treyer, Valerie; Schibli, Roger; Buck, Alfred; Krämer, Stefanie D; Ametamey, Simon M
2018-06-01
Non-invasive imaging of metabotropic glutamate receptor 5 (mGlu 5 ) in the brain using PET is of interest in e.g., anxiety, depression, and Parkinson's disease. Widespread application of the most widely used mGlu 5 tracer, [ 11 C]ABP688, is limited by the short physical half-life of carbon-11. [ 18 F]PSS232 is a fluorinated analog with promising preclinical properties and high selectivity and specificity for mGlu 5 . In this first-in-man study, we evaluated the brain uptake pattern and kinetics of [ 18 F]PSS232 in healthy volunteers. [ 18 F]PSS232 PET was performed with ten healthy male volunteers aged 20-40 years. Seven of the subjects received a bolus injection and the remainder a bolus/infusion protocol. Cerebral blood flow was determined in seven subjects using [ 15 O]water PET. Arterial blood activity was measured using an online blood counter. Tracer kinetics were evaluated by compartment modeling and parametric maps were generated for both tracers. At 90 min post-injection, 59.2 ± 11.1% of total radioactivity in plasma corresponded to intact tracer. The regional first pass extraction fraction of [ 18 F]PSS232 ranged from 0.41 ± 0.06 to 0.55 ± 0.03 and brain distribution pattern matched that of [ 11 C]ABP688. Uptake kinetics followed a simple two-tissue compartment model. The volume of distribution of total tracer (V T , ml/cm 3 ) ranged from 1.18 ± 0.20 for white matter to 2.91 ± 0.51 for putamen. The respective mean distribution volume ratios (DVR) with cerebellum as the reference tissue were 0.88 ± 0.06 and 2.12 ± 0.10, respectively. The tissue/cerebellum ratios of a bolus/infusion protocol (30/70 dose ratio) were close to the DVR values. Brain uptake of [ 18 F]PSS232 matched the distribution of mGlu 5 and followed a two-tissue compartment model. The well-defined kinetics and the possibility to use reference tissue models, obviating the need for arterial blood sampling, make [ 18 F]PSS232 a promising fluorine-18 labeled
Investigation of the 232Th neutron cross-sections in resonance energy range
International Nuclear Information System (INIS)
Grigoriev, Yu.V.; Kitaev, V.Ya.; Sinitsa, V.V.; Zhuravlev, B.V.; Borzakov, S.B.; Faikov-Stanchik, H.; Ilchev, G.L.; Panteleev, Ts.Ts.; Kim, G.N.
2001-01-01
The alternative path in the development of atomic energy is the uranium-thorium cycle. In connection with this, the measurements of the 232 Th neutron capture and total cross-sections and its resonance self-shielding coefficients in resonance energy range are necessary because of their low accuracy. In this work, the results of the investigations of the thorium-232 neutron cross-sections are presented. The measurements have been carried out on the gamma-ray multisection liquid detector and neutron detector as a battery of boron counters on the 120 m flight path of the pulsed fast reactor IBR-30. As the filter samples were used the metallic disks of various thickness and diameter of 45 mm. Two plates from metallic thorium with thickness of 0.2 mm and with the square of 4.5x4.5 cm 2 were used as the radiator samples. The group neutron total and capture cross-sections within the accuracy of 2-7% in the energy range of (10 eV-10 keV) were obtained from the transmissions and the sum spectra of g-rays from the fourth multiplicity to the seventh one. The neutron capture group cross-sections of 238 U were used as the standard for obtaining of thorium ones. Analogous values were calculated on the GRUCON code with the ENDF/B-6, JENDL-3 evaluated data libraries. Within the limits of experimental errors an agreement between the experiment and calculation is observed, but in some groups the experimental values are larger than the calculated ones. (author)
Determination of specific concentrations of 40K, 238U and 232Th in mineral fertilizer samples
International Nuclear Information System (INIS)
Garcez, Ricardo W.D.; Lopes, Jose M.; Silva, Ademir X.
2015-01-01
The use of fertilizer is an established practice worldwide to promote agricultural productivity increased without increasing the planted area, resulting in native forests protection and increase of the food availability. Some kinds of fertilizer have in their chemical composition some radionuclides due the origin of its feedstock, such as 238 U, the 232 Th, and their descendants, beyond 40 K. Knowledge of the radioactivity levels in the environment is great importance to know the gamma radiation dose that the human being is exposed. For identification and quantitation of radionuclides, it was used gamma spectrometry where HPGe detector was used to obtain the spectra, and LabSOCS software for calculating the detection efficiency for each energy. The values of 232 Th specific concentrations ranged from 4.1 to 368.1 Bq.Kg -1 , the values of 238 U specific concentrations ranged from 16.0 to 647.7 Bq.Kg -1 and 40 K specific concentrations ranged from 19.1 to 12713 Bq.Kg -1 . Concentrations of values are consistent with those found in literature. (author)
International Nuclear Information System (INIS)
Jibiri, N.N.; Ajao, A.O.
2004-01-01
Samples of elephant grass collected at some pasturing farmlands across different locations in Ibadan metropolis were analyzed for their natural radioactivity concentrations due to 40 K, 238 U and 232 Th radionuclides. Radioactivity measurements were carried out using γ-ray spectroscopy. The average radioactivity concentration of 40 K was found to be 64.5±8.1 Bq kg -1 , 25.7±5.5 Bq kg -1 for 238 U and 33.4±3.9 Bq kg -1 for 232 Th. The radiological health implication to the population that may result from these values is found to be very low and almost insignificant. No artificial radionuclide, however, was detected in any of the samples, hence, measurements have been taken as representing baseline values of these radionuclides in the grass in the metropolis
Measurement of the 232Th neutron capture cross section in the region 5 keV-150 keV
International Nuclear Information System (INIS)
Lobo, Georges; Corvi, Franco; Schillebeeckx, Peter; Brusegan, Antonio; Mutti, Paolo; Janeva, Natalia
2002-01-01
The average capture cross-section of 232 Th has been measured at the 14.37 m flight path of GELINA, IRMM-Geel, in the energy range from 5 to 150 keV. The capture events were detected by two C 6 D 6 liquid scintillators and the neutron flux was measured with a 10 B-loaded ionisation chamber. The data, corrected with the pulse-height weighting technique, have been normalised to the well-isolated and nearly saturated 232 Th (n, γ) resonances at 21.8 eV and 23.5 eV. Below 15 keV neutron energy, we do not observe the discrepancies, up to 40%, with the evaluated ENDF/B-VI data as reported by Wisshak et al.. Between 5 and 80 keV our results are about 10% systematically above the ENDF/B-VI data and approach the evaluated data between 80 and 100 keV. (author)
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
International Nuclear Information System (INIS)
Rekha, A.K.; Anilkumar, S.; Narayani, K.; Babu, D.A.R.
2012-01-01
Radioactivity in the environment is mainly due to the naturally occurring radionuclides like uranium, thorium with their daughter products and potassium. Even though Gamma spectrometry is the most commonly used non destructive method for the quantification of these naturally occurring radionuclides, Neutron Activation Analysis (NAA), a well established analytical technique, can also be used. But the NAA technique is a time consuming process and needs proper standards, proper sample preparation etc. In this paper, the 232 Th and 238 U activity estimated using gamma ray spectrometry and NAA technique are compared. In the case of direct gamma spectrometry method, the samples were analysed after sealing in a 250 ml container. Whereas for the NAA, about 300 mg of each sample, after irradiation were subjected to gamma spectrometry. The 238 U and 232 Th activities (in Bq/kg) in samples were estimated after the proper efficiency correction and were compared. The estimated activities by these two methods are in good agreement. The variation in 238 U and 232 Th activity values are within ± 15% which are acceptable for environmental samples
Energy Technology Data Exchange (ETDEWEB)
Coombs, M.A.; Cuddihy, R.G. (Lovelace Biomedical and Environmental Research Inst., Albuquerque, NM (USA). Inhalation Toxicology Research Inst.)
1983-01-01
Emanation of /sup 232/U daughter products by nuclear recoil and inert gas diffusion from spherical, submicrometer particles of uranium oxide and thorium dioxide was studied. Monodisperse samples of particles containing 1% /sup 232/U and having physical diameters between 0.1 and 1 ..mu..m were used for the emanation measurements. Thorium-228 ions recoiling from the particles after alpha-decay of /sup 232/U were collected electrostatically on a recoil cathode. Radon-220 diffusing from the particles was swept by an airstream into a 4 l. chamber where the /sup 220/Rn daughters were collected on a second cathode. Mathematical models of radionuclide emanation from spherical particles were used to calculate the recoil range of /sup 228/Th and the diffusion coefficient of /sup 220/Rn in the particle matrix. A /sup 228/Th recoil range of 0.02 ..mu..m and a /sup 220/Rn diffusion coefficient of 3 x 10/sup -14/ cm/sup 2//sec were obtained in both uranium oxide and thorium dioxide particles.
Directory of Open Access Journals (Sweden)
Indriani R
2015-03-01
Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.
International Nuclear Information System (INIS)
Kandlbinder, R.; Geissler, V.; Schupfner, R.; Wolfbeis, O.; Zinka, B.
2009-01-01
Bone tissues of thirteen deceased persons were analyzed to determine the activity concentration of the radionuclides 228 Ra, 228 Th, 232 Th and 2 30 Th. The activity ratios enable to assess the post-mortem-interval PMI). The samples were prepared for analysis by incinerating and pulverizing. 228 Ra was directly detected by γ-spectrometry. 2 28 Th, 230 Th, 232 Th were detected by α-spectrometry after radiochemical purification and electrodeposition. It is shown that the method s principally suited to determine the PMI. A minimum of 300 g (wet weight) f human bone tissue is required for the analysis. Counting times are in the range of one to two weeks. (author)
Mass resolved angular distribution of fission products in 20Ne + 232Th reaction
International Nuclear Information System (INIS)
Tripathi, R.; Sodaye, S.; Sudarshan, K.; Kumar, Amit; Guin, R.
2011-01-01
Mass resolved angular distribution of fission products was measured in 20 Ne + 232 Th reaction at beam energy of 120 MeV. A preliminary analysis of the angular distribution data of fission products shows higher average anisotropy compared to that calculated using statistical theory. A signature of rise in anisotropy near symmetry, as reported in earlier studies in literature, is also seen. Further study is in progress to get more detailed information about the contribution from non-compound nucleus fission and dependence of angular anisotropy on asymmetry of mass division
Neutron induced fission cross sections for 232Th, 235,238U, 237Np, and 239Pu
International Nuclear Information System (INIS)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Hill, N.W.; Carlson, A.D.; Wasson, O.A.
1989-01-01
Neutron-induced fission cross section ratios for samples of 232 Th, 235,238 U, 237 Np and 239 Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence from 3 to 30 MeV. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.178 MeV. From 30 to 400 MeV cross section values were determined using the neutron fluence measured with a plastic scintillator. Cross section values of 232 Th, 235,238 U, 237 Np and 239 Pu were computed from the ratio data using the authors' values for 235 U(n,f). In addition to providing new results at high neutron energies, these data highlight several areas of deficiency in the evaluated nuclear data files and provide new information for the 235 U(n,f) standard
International Nuclear Information System (INIS)
Jha, S.K.; Gothankar, S.; Iongwai, P.S.; Kharbuli, B.; War, S.A.; Puranik, V.D.
2012-01-01
The concentration of naturally occurring radionuclides 232 Th, 238 U was determined using Instrumental Neutron Activation Analysis (INAA) in different food groups namely cereals, vegetables, leafy vegetables, roots and tubers cultivated and consumed by tribal population residing around the proposed uranium mine. The study area is a part of rural area K. P. Mawthabah (Domiasiat) in the west Khasi Hills District of Meghalaya, India located in the tropical region of high rainfall that remains steeped in tribal tradition without much outside influence. Agriculture by Jhum (slash and burn) cultivation and animal husbandry are the main occupation of the tribal populations. A total of 89 samples from locally grown food products were analyzed. The concentration of 238 U and 232 Th in the soil of the study area was found to vary 1.6–15.5 and 2.0–5.0 times respectively to the average mean value observed in India. The estimated daily dietary intake of 238 U and 232 Th were 2.0 μg d −1 (25 mBq d −1 ) and 3.4 μg d −1 (14 mBq d −1 ) is comparable with reported range 0.5–5.0 μg d −1 and 0.15–3.5 μg d −1 respectively for the Asian population. - Highlights: ► 232 Th, 238 U were determined using Instrumental Neutron Activation Analysis (INAA). ► Study area located in the tropical region of high rainfall that remains steeped in tribal tradition. ► Agriculture by Jhum (slash and burn) cultivation and animal husbandry are the main occupation of the tribal populations. ► The estimated daily intake of 232 Th and 238 U in high rainfall area was found to be 3.4 and 2.0 μg respectively.
International Nuclear Information System (INIS)
Leal, Luiz C.; Arbanas, Goran; Derrien, Herve; Wiarda, Dorothea
2008-01-01
Resonance-parameter covariance matrix (RPCM) evaluations in the resolved resonance region were done for 232Th, 233U, 235U, 238U, and 239Pu using the computer code SAMMY. The retroactive approach of the code SAMMY was used to generate the RPCMs for 233U, 235U. RPCMs for 232Th, 238U and 239Pu were generated together with the resonance parameter evaluations. The RPCMs were then converted in the ENDF format using the FILE32 representation. Alternatively, for computer storage reasons, the FILE32 was converted in the FILE33 cross section covariance matrix (CSCM). Both representations were processed using the computer code PUFF-IV. This paper describes the procedures used to generate the RPCM with SAMMY.
Directory of Open Access Journals (Sweden)
Aprilia Kusumastuti
2015-10-01
Full Text Available The aim of the study was to know avian influenza (AI infection in field by using serology test in threemarketing area of AI vaccines. Haemagglutination inhibition methode was used in this test. There werefour antigen strains of AI subtype H5N1 clade 2.1.3 (AIstrainA/Chicken/West Java/PWT-WIJ/2006, AIstrain A/Chicken/Garut/BBVW-223/2007, AI strain A/Chicken/West Java-Nagrak/30/2007, and AI strainA/Chicken/Pekalongan/BBVW-208/2007 and 2 antigen strains of AI subtype H5N1 clade 2.3.2 (AI strainA/duck/Sukoharjo/BBVW-1428-9/2012 and AI strain A/duck/Sleman/BBVW-1463-10/2012 was used inthis study for HI test. The result presents that 93,33% chicken farms in three marketing area of PT. SanbioLaboratories have positive antibody titre to AI subtype H5N1 clade 2.1.3. This titre may be obtained fromAI clade 2.1.3 vaccination. From 15 samples, 92,86% are positive to AI subtype H5N1 clade 2.3.2A/duck/Sukoharjo/BBVW-1428-9/2012 and 92,31% are positive to A/duck/Sleman/BBVW-1463-10/2012 evenwithout AI clade 2.3.2 vaccination. This antibody titre may be obtained from AI clade 2.1.3 vaccine crossprotection or field infection.
Simple and Robust Multipoint Data Acquisition Bus Built on Top of the Standard RS232 Interface
Directory of Open Access Journals (Sweden)
Alexey PAVLUCHENKO
2013-01-01
Full Text Available A small-scale wired sensor network architecture built on top of the standard RS232 serial link with the minimum additional non-standard hardware components is described. The presented network structure and associated protocol can be used to form a general purpose distributed data acquisition bus. Basic methods of data flow control and failure recovery suitable for the described architecture are proposed.
International Nuclear Information System (INIS)
1999-01-01
The Corrective Action Investigation Plan for Corrective Action Unit 232, Area 25 Sewage Lagoons, has been developed in accordance with the Federal Facility Agreement and Consent Order that was agreed to by the U.S. Department of Energy, Nevada Operations Office; the State of Nevada Division of Environmental Protection; and the U. S. Department of Defense. Corrective Action Unit 232 consists of Corrective Action Site 25-03-01, Sewage Lagoon. Corrective Action Unit 232, Area 25 Sewage Lagoons, received sanitary effluent from four buildings within the Test Cell ''C'' Facility from the mid-1960s through approximately 1996. The Test Cell ''C'' Facility was used to develop nuclear propulsion technology by conducting nuclear test reactor studies. Based on the site history collected to support the Data Quality Objectives process, contaminants of potential concern include volatile organic compounds, semivolatile organic compounds, Resource Conservation and Recovery Act metals, petroleum hydrocarbons, polychlorinated biphenyls, pesticides, herbicides, gamma emitting radionuclides, isotopic plutonium, isotopic uranium, and strontium-90. A detailed conceptual site model is presented in Section 3.0 and Appendix A of this Corrective Action Investigation Plan. The conceptual model serves as the basis for the sampling strategy. Under the Federal Facility Agreement and Consent Order, the Corrective Action Investigation Plan will be submitted to the Nevada Division of Environmental Protection for approval. Field work will be conducted following approval of the plan. The results of the field investigation will support a defensible evaluation of corrective action alternatives in the Corrective Action Decision Document
International Nuclear Information System (INIS)
Malheiro, Luciano H.; Saueia, Catia H.R.; Mazzilli, Barbara P.
2013-01-01
Phosphogypsum (PG) can be classified as Technologically Enhanced Naturally Occurring Radioactive Material (TENORM), and it is obtained as a residue of the phosphate fertilizer industry. PG presents in its composition radionuclides of the natural U and Th series: mainly Ra-226, Ra-228, Th-232, Pb-210 and Po-210. The Brazilian producers stock the PG in dry stacks, posing risks to the surrounding environment. A possible solution to this problem is to reuse PG in agriculture; however, it is necessary to ensure that the radionuclides present in the PG will not be available to the agricultural products. This study is part of a research project sponsored by Fundacao de Amparo a Pesquisa do Estado de Sao Paulo (FAPESP - 2010-10587-0) entitled 'Availability of metals and radionuclides in tropical soils amended with phosphogypsum', and its objective is to evaluate the reliability of an optimal methodology to determine U-238 and Th-232 in samples of soils amended with PG through percolation with water. The methodology comprises a sequential radiochemical separation of the radionuclides present in the leachate. The UTEVA resin was used for the purification and separation of U-238 and Th-232, and the final activity concentrations were determined by alpha spectrometry. The precision and accuracy of the methodology were checked by measuring standard reference material. The results obtained for the relative error and relative standard deviation varied respectively from 2.34 % to 5.92 % and 6.10 % to 6.21 % for uranium, and from 0.42 % to 3.13 % and 9.68 % to 10.97 % for thorium. (author)
Energy Technology Data Exchange (ETDEWEB)
USDOE/NV
1999-05-01
The Corrective Action Investigation Plan for Corrective Action Unit 232, Area 25 Sewage Lagoons, has been developed in accordance with the Federal Facility Agreement and Consent Order that was agreed to by the U.S. Department of Energy, Nevada Operations Office; the State of Nevada Division of Environmental Protection; and the U. S. Department of Defense. Corrective Action Unit 232 consists of Corrective Action Site 25-03-01, Sewage Lagoon. Corrective Action Unit 232, Area 25 Sewage Lagoons, received sanitary effluent from four buildings within the Test Cell ''C'' Facility from the mid-1960s through approximately 1996. The Test Cell ''C'' Facility was used to develop nuclear propulsion technology by conducting nuclear test reactor studies. Based on the site history collected to support the Data Quality Objectives process, contaminants of potential concern include volatile organic compounds, semivolatile organic compounds, Resource Conservation and Recovery Act metals, petroleum hydrocarbons, polychlorinated biphenyls, pesticides, herbicides, gamma emitting radionuclides, isotopic plutonium, isotopic uranium, and strontium-90. A detailed conceptual site model is presented in Section 3.0 and Appendix A of this Corrective Action Investigation Plan. The conceptual model serves as the basis for the sampling strategy. Under the Federal Facility Agreement and Consent Order, the Corrective Action Investigation Plan will be submitted to the Nevada Division of Environmental Protection for approval. Field work will be conducted following approval of the plan. The results of the field investigation will support a defensible evaluation of corrective action alternatives in the Corrective Action Decision Document.
Pseudo-icosahedral Cr55Al232 -δ as a high-temperature protective material
Rosa, R.; Bhattacharya, S.; Pabla, J.; He, H.; Misuraca, J.; Nakajima, Y.; Bender, A. D.; Antonacci, A. K.; Adrip, W.; McNally, D. E.; Zebro, A.; Kamenov, P.; Geschwind, G.; Ghose, S.; Dooryhee, E.; Ibrahim, A.; Tritt, T. M.; Aronson, M. C.; Simonson, J. W.
2018-03-01
We report here a course of basic research into the potential suitability of a pseudo-icosahedral Cr aluminide as a material for high-temperature protective coatings. Cr55Al232 -δ [ δ =2.70 (6 ) ] exhibits high hardness at room temperature as well as low thermal conductivity and excellent oxidation resistance at 973 K, with an oxidation rate comparable to those of softer, denser benchmark materials. The origin of these promising properties can be traced to competing long-range and short-range symmetries within the pseudo-icosahedral crystal structure, suggesting new criteria for future materials research.
International Nuclear Information System (INIS)
Rosa, Mychelle M.L.; Taddei, Maria Helena T.; Silva, Marco A.; Ferreira, Marcelo T.
2011-01-01
Mushrooms are fungi which efficiently accumulate radionuclides, as verified by radiochemistry analyses of specimens collected in contaminated areas, specifically after the Chernobyl nuclear accident. Many studies have demonstrated that mushrooms can be used in monitoring of ecosystem contamination and quality. The present paper is part of a broader study conducted in the Pocos de Caldas plateau region in Minas Gerais, Brazil, investigating assimilation of natural Uranium and Thorium radionuclide series by mushrooms. This region has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. These anomalies are ore bodies containing Uranium and Thorium, the later being highly predominant. Many researchers have been conducted concerning radionuclide incorporation by agricultural products on the plateau. The present paper aims to determine 232 Th, 228 Th, and 228 Ra radionuclides in wild mushrooms collected at different locations in the plateau region. 228 Ra was determined by radiochemical separation using sulphate coprecipitation followed by beta radiometry. 232 Th and 228 Th were determined using anion exchange resin purification followed by alpha spectrometry. Higher values were obtained to 228 Th than to 232 Th. This is due to higher 228 Ra mobility, which decays to 228 Th. The accuracy of the analytical methods employed was evaluated using the reference sample IAEA Soil 327. These methods had high chemical recovery and high sensitivity. It was possible to confirm that mushrooms accumulate radionuclide and so can be used in environmental contamination and quality assessment. (author)
232Th(d,4n)230Pa cross-section measurements at ARRONAX facility
International Nuclear Information System (INIS)
Duchemin, C.; Guertin, A.; Metivier, V.; Haddad, F.
2015-01-01
Full text of publication follows. The ARRONAX cyclotron [Ref.1], acronym for 'Accelerator for Research in Radiochemistry and Oncology at Nantes Atlantique' is a new facility installed in Nantes, France. A dedicated program has been launched on production of innovative radionuclides for PET imaging and for β- and α- targeted radiotherapy using proton or α particle. Since the accelerator is also able to deliver deuteron beams up to 35 MeV, we have reconsidered the possibility to use them to produce medical isotopes. In this study, we have focused on cross section measurements using the stacked-foil technique [Ref. 2] of one isotope dedicated to alpha radio-immunotherapy (α RIT) [Ref.3], 226 Th which can be produced through different routes. It's of great interest since it has been found to be a more potent alpha particle emitter for leukemia therapies than Bi 213 [Ref.4]. Indeed, the 226 Th decay produced a cascade of four α particles with a cumulated energy of 27.7 MeV. An additional interest is the possible use of a radionuclide generator system 230 U/ 226 Th. 230 U could be produced directly via 231 Pa(p, 2n) 230 U, and indirectly via 230 Pa using proton or deuteron beams through 232 Th(p, 3n) 230 Pa → 230 U, 232 Th(d, 4n) 230 Pa → 230 U. Twelve data sets are published concerning the 230 Pa cross section induced by proton [Ref 5], only one by deuteron [Ref.6]. As sometimes deuteron induced reaction gives higher cross section values, it seems interesting to focus our study on their use as projectile on 232 Th target to produce 230 Pa. Contaminants created during irradiation are also measured since a good optimization of the process is supposed to find the best compromise between production yield and purity of the final product. Our new sets of data are compared with the existing data [Refs.5,6] on other existing production routes and with results given by TALYS code calculations [Ref.7]. References: 1] F. Haddad and al., Eur. J. Med. Mol
Retention and translocation of inhaled uranyl nitrate (233U and 232U) in rats
International Nuclear Information System (INIS)
Ballou, J.E.; Gies, R.A.; Wogman, N.A.
1978-01-01
The uranium-thorium breeder reactors proposed for nuclear power production, and other thorium fuel systems in conventional reactors, utilize fuels and fuel recycle process solutions that have not been evaluated for biological hazard. This project emphasizes studies of the metabolism of the oxide fuels and the nitrate solutions of the major radionuclides, following inhalation, ingestion, or cutaneous application in rodents. Preliminary data are reported for the clearance of inhaled 233 UO 2 (NO 3 ) 2 and 232 UO 2 (NO 3 ) 2 from the lung and their translocation to skeleton
Canbaz, Buket; Cam, N Füsun; Yaprak, Günseli; Candan, Osman
2010-09-01
The surveys of natural gamma-emitting radionuclides in rocks and soils from the Ezine plutonic area were conducted during 2007. Direct dose measurement using a survey meter was carried out simultaneously. The present study, which is part of the survey, analysed the activity concentrations of (238)U, (232)Th and (40)K in granitoid samples from all over the region by HPGe gamma spectrometry. The activity concentrations of (226)Ra ranged from 94 to 637 Bq kg(-1), those of (232)Th ranged from 120 to 601 Bq kg(-1)and those of (40)K ranged from 1074 to 1527 Bq kg(-1) in the analysed rock samples from different parts of the pluton. To evaluate the radiological hazard of the natural radioactivity in the samples, the absorbed dose rate (D), the annual effective dose rate, the radium equivalent activity (Ra(eq)) and the external (H(ex)) hazard index were calculated according to the UNSCEAR 2000 report. The thorium-to-uranium concentration ratios were also estimated.
Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am
International Nuclear Information System (INIS)
Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro
1984-01-01
Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)
Possible viscosity effects in neutron-induced fission of 232Th and 238U
International Nuclear Information System (INIS)
Gindler, J.E.; Glendenin, L.E.; Wilkins, B.D.
1979-01-01
Fission yields induced in the 238 U(n,f) and 232 Th(n,f) reactions were determined as a function of incident neutron energy (E/sub n/). The ratio of 115 Cd-to- 140 Ba yields as a function of E/sub n/ is analyzed by means of the equation Y 1 /Y 2 = exp[2(a 1 (E/sub n/+E 1 )/sup 1/2/ -2(a 2 (E/sub n/+E 2 )/sup 1/2/] to give values of a/sub i/, the level density parameter, and E/sub i/, the excitation energy for E/sub n/=0. The energies E/sub i/ are interpreted on the basis of the liquid drop model with shell and pairing corrections. Values are deduced for the energy dissipated by viscosity effects in the descent from the saddle point to the point where masses are fixed in the fissioning nucleus. These values are 1.7 MeV for 232 Th(n,f) and 4.8 MeV for 238 U(n,f). These values are consistent with the experimental observation that anti ν/sub p/ is approx. 0.6 neutron greater for 239 U fission than for 233 Th fission and that strong odd--even (nucleon pairing) effects are found in the fragment total kinetic energy distribution for 230 Th fission but not for 234 U fission. The low dissipation energy values together with the low values of pre-scission kinetic energy deduced by Guet, et al., [Nucl. Phys. A134 (1971)1] indicate a shorter path from the saddle point of the fissioning nucleus to scission than is generally assumed in theoretical calculations. 31 references
International Nuclear Information System (INIS)
Denyak, V.V.; Khvastunov, V.M.; Paschuk, S.A.; Schelin, H.R.
2013-01-01
Fission of the even-even nuclei 232 Th, 236,238 U and even-odd nuclei 233,235 U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of 236 U and 238 U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of 236 U. The measured cross section azimuthal asymmetry of the fission of 232 Th does not show any fragment mass dependence. In the even-odd nuclei 233 U and 235 U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)
Measurement of 238U, 232Th and 40K concentrations in different regions of Colombia
Rodríguez, W.; Lizarazo, C.; Cortés, M. L.; Rodríguez, S. A.; Mendoza, E. F.; Cristancho, F.
2012-02-01
Taking into account the wide variety of geological structures in Colombia, we took a collection of samples both from sand beaches and high mountains systems and determined their concentration of 238U, 232Th and 40K using a high resolution gamma spectrometry system. The results show a variation of these concentrations for the different samples that we associate with the soil type and the environmental conditions of the chosen regions. We also compare our results with other studies carried out in regions with similar geological conditions.
International Nuclear Information System (INIS)
Misdaq, M.A.; Mortassim, A.
2009-01-01
238 U and 232 Th concentrations as well as 222 Rn and 220 Rn α-activities per unit volume were measured in various natural honey samples collected from different regions in Morocco using CR-39 and LR-115 type II solid state nuclear track detectors (SSNTDs). These radionuclides were also measured in soils, plant flowers and nectar solutions corresponding to the honey samples studied. In addition, these radionuclides were measured in different imported honey samples. The measured 238 U, 232 Th, 222 Rn and 220 Rn concentrations ranged from (1.5 ± 0.1) mBq kg -1 to (10.6 ± 0.6) mBq kg -1 , (1.1 ± 0.1) mBq kg -1 to (4.2 ± 0.2) mBq kg -1 , (1.5 ± 0.1) Bq kg -1 to (10.6 ± 0.6) Bq kg -1 and (1.1 ± 0.1) Bq kg -1 to (4.2 ± 0.2) Bq kg -1 for the honey samples studied, respectively. Annual 238 U, 232 Th and 222 Rn intakes by Moroccan adults from the consumption of honey were assessed. The influence of the nature of soil and plant on the 238 U and 232 Th contents of the studied honey samples was investigated. These measurements were completed by an investigation of the 238 U and 232 Th transfer between soils and plant flowers and that between plant flowers and honey, and also by the investigation of the influence of pollution due to different material dusts on 238 U, 232 Th and 222 Rn in the honey samples studied. Committed equivalent doses due to the annual intake of 238 U, 232 Th and 222 Rn were evaluated in the organs of adult members of the Moroccan rural population from the ingestion of the honey samples. The maximum total committed effective dose due to 238 U, 232 Th and 222 Rn from the ingestion of natural honey by the Moroccan rural population was found to be equal to 0.64 μSνy -1 . (author)
Energy Technology Data Exchange (ETDEWEB)
Garcez, Ricardo W.D.; Lopes, Jose M.; Silva, Ademir X., E-mail: r.w.o.g@fisica.if.uff.br, E-mail: ademir@nuclear.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Domingues, Alessandro M.; Lima, Marco F. [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil)
2015-07-01
The use of fertilizer is an established practice worldwide to promote agricultural productivity increased without increasing the planted area, resulting in native forests protection and increase of the food availability. Some kinds of fertilizer have in their chemical composition some radionuclides due the origin of its feedstock, such as {sup 238}U, the {sup 232}Th, and their descendants, beyond {sup 40}K. Knowledge of the radioactivity levels in the environment is great importance to know the gamma radiation dose that the human being is exposed. For identification and quantitation of radionuclides, it was used gamma spectrometry where HPGe detector was used to obtain the spectra, and LabSOCS software for calculating the detection efficiency for each energy. The values of {sup 232}Th specific concentrations ranged from 4.1 to 368.1 Bq.Kg{sup -1}, the values of {sup 238}U specific concentrations ranged from 16.0 to 647.7 Bq.Kg{sup -1} and {sup 40}K specific concentrations ranged from 19.1 to 12713 Bq.Kg{sup -1}. Concentrations of values are consistent with those found in literature. (author)
American Society for Testing and Materials. Philadelphia
2005-01-01
1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.
Bangotra, Pargin; Mehra, Rohit; Kaur, Kirandeep; Jakhu, Rajan
2016-10-01
The activity concentration of 226 Ra (radium), 232 Th (thorium) and 40 K (potassium) has been measured in the soil samples collected from Mansa and Muktsar districts of Punjab (India) using NaI (Tikl) gamma detector. The concentration of three radionuclides ( 226 Ra, 232 Th and 40 K) in the studied area has been varied from 18±4 to 46±5, 53±7 to 98±8 and 248±54 to 756±110 Bq kg -1 , respectively. Radium equivalent activities (Ra eq ) have been calculated in soil samples for the assessment of the radiation hazards arising due to the use of these soil samples. The absorbed dose rate of 226 Ra, 232 Th and 40 K in studied area has been varied from 8 to 21, 33 to 61 and 9 to 25 nGy h -1 , respectively. The corresponding indoor and outdoor annual effective dose in studied area was 0.38 and 0.09 mSv, respectively. The external and internal hazard has been also calculated for the assessment of radiation hazards in the studied area. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Distribution of 226Ra, 232Th, and 40K in soils of Rio Grande do Norte (Brazil)
International Nuclear Information System (INIS)
Malanca, A.; Pessina, V.; Dallara, G.
1996-01-01
A survey programme aimed at studying the environmental radioactivity in the Brazilian state of Rio Grande do Norte was undertaken. Fifty-two soil samples, together with two rock and two uraniferrous ore samples were collected from the eastern and central regions of this state. Concentrations of radioelements in samples were determined by γ-ray spectrometry. The average concentrations of 226 Ra, 232 Th, and 40 K in the surveyed soils were 29.2 ± 19.5 (SD), 47.8 ± 37.3, and 704 ± 437 Bq kg -1 , respectively. Higher values were found in the rock samples. The distributions of 226 Ra and 232 Th were fitted by log-normal curves. Radiological measurements carried out with a portable scintillometer at the sampled sites revealed an average absorbed dose rate of 55 ± 27 (SD) nGy h -1 . Computed dose rates obtained through the Beck formula ranged from 15-179 nGy h -1 , with a mean value of 72.6 ± 38.7 (SD) nGy h -1 , and their distribution fitted a log-normal curve. An annual average effective dose equivalent of 552 μSν (range: 117-1361 μSν) was estimated for 51 sites in Rio Grande do Norte. (author)
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
Study on the formation of fission isomer via 232Th + α reaction
International Nuclear Information System (INIS)
Vianna, D.M.
1982-01-01
The formation of fission isomer through 232 Th+α reaction is studied using the distance-recoil method, employing policarbonate MAKROFOL detector. The total isomeric half-life measured has the value T 1/2 = 0.23 ± 0.03 ns and an ratio of formation of isomeric fission relative to prompt fission(σ i /σ p =0.75x10 -5 ). According to the energy of incident particle (Eα = 28 MeV), the cross-sections presented in the literature and the low value found for the total isomeric half-life, we attribute these half-life value to the 234 U isomer (even-even nucleus). The results were compared with those existent in the literature (La69, E170, Re70, Wo70, Po70, Br71) for this isomer. (author) [pt
238 U, 232 Th and 40 K in wheat flour samples of Iraq markets
Directory of Open Access Journals (Sweden)
Ali Abid Abojassim
2015-05-01
Full Text Available Introduction. Wheat flour is a nutritious type of food that is widely consumed by various age groups in Iraq. This study investigates the presence of long-lived gamma emitters in different type of wheat flour in Iraqi market. Materials and methods. Uranium (238 U, Thorium (232 Th and Potassium (40 K specific activity in (Bq/kg were measured in (12 different types of wheat flours that are available in Iraqi markets. The gamma spectrometry method with a NaI(Tl detector has been used for radiometric measurements. Also in this study we have calculated the internal hazard index, radium equivalent and absorbed dose rate in all samples. Results and discussion. It is found that the specific activity in wheat flour samples were varied from (1.086±0.0866 Bq/kg to (12.532±2.026 Bq/kg with an average (6.6025 Bq/kg for 238 U, For 232 Th From (0.126±0.066 Bq/kg to (4.298±0.388 Bq/kg with an average (1.9465Bq/kg and for 40 K from (41.842±5.875 Bq/kg to (264.729±3.843 Bq/kg with an average (133.097 Bq/kg. Also, it is found that the radium equivalent and the internal hazard index in wheat flour samples ranged from (3.4031 Bq/kg to (35.1523 Bq/kg with an average (19.6346 Bq/kg and from (0.0091 to (0.1219 with an average (0.0708 respectively. Conclusion. This study prove that the natural radioactivity and radiation hazard indices were lower than the safe.
DEMOLITION OF HANFORD'S 232-Z WASTE INCINERATION FACILITY
International Nuclear Information System (INIS)
LLOYD, E.R.
2006-01-01
The 232-Z Plutonium Incinerator Facility was a small, highly alpha-contaminated, building situated between three active buildings located in an operating nuclear complex. Approximately 500 personnel worked within 250 meters (800 ft) of the structure and expectations were that the project would neither impact plant operations nor result in any restrictions when demolition was complete. Precision demolition and tight controls best describe the project. The team used standard open-air demolition techniques to take the facility to slab-on-grade. Several techniques were key to controlling contamination and confining it to the demolition area: spraying fixatives before demolition began; using misting systems, frequently applying fixatives, and using a methodical demolition sequence and debris load-out process. Detailed air modeling was done before demolition to determine necessary facility source-term levels, establish radiological boundaries, and confirm the adequacy of the proposed demolition approach. By only removing the major source term in equipment, HEPA filters, gloveboxes, and the like, and leaving fixed contamination on the walls, ceilings and floors, the project showed considerable savings and reduced worker hazards and exposure. The ability to perform this demolition safely and without the spread of contamination provides confidence that similar operations can be performed successfully. By removing the major source terms, fixing the remaining contamination in the building, and using controlled demolition and contamination control techniques, similar structures can be demolished cost effectively and safely
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Proton induced fission of {sup 232}Th at intermediate energies
Energy Technology Data Exchange (ETDEWEB)
Gikal, K. B., E-mail: kgikal@mail.ru; Kozulin, E. M.; Bogachev, A. A. [JINR, Flerov Laboratory of Nuclear Reactions (Russian Federation); Burtebaev, N. T.; Edomskiy, A. V. [Institute of Nuclear Physics of Ministry of Energy of the Republic of Kazakhstan (Kazakhstan); Itkis, I. M.; Itkis, M. G.; Knyazhev, G. N. [JINR, Flerov Laboratory of Nuclear Reactions (Russian Federation); Kovalchuk, K. V.; Kvochkina, T. N. [Institute of Nuclear Physics of Ministry of Energy of the Republic of Kazakhstan (Kazakhstan); Piasecki, E. [Heavy Ion Laboratory of Warsaw University (Poland); Rubchenya, V. A. [University of Jyväskylä, Department of Physics (Finland); Sahiev, S. K. [Institute of Nuclear Physics of Ministry of Energy of the Republic of Kazakhstan (Kazakhstan); Trzaska, W. H. [University of Jyväskylä, Department of Physics (Finland); Vardaci, E. [INFN Napoli, Dipartimento di Scienze Fisiche dell’Università di Napoli (Italy)
2016-12-15
The mass-energy distributions and cross sections of proton-induced fission of {sup 232}Th have been measured at the proton energies of 7, 10, 13, 20, 40, and 55 MeV. Experiments were carried out at the proton beam of the K-130 cyclotron of the JYFL Accelerator Laboratory of the University of Jyväskylä and U-150m cyclotron of the Institute of Nuclear Physics, Ministry of Energy of the Republic of Kazakhstan. The yields of fission fragments in the mass range A = 60–170 a.m.u. have been measured up to the level of 10−4%. The three humped shape of the mass distribution up has been observed at higher proton energies. The contribution of the symmetric component grows up with increasing proton incident energy; although even at 55 MeV of proton energy the shoulders in the mass energy distribution clearly indicate the asymmetric fission peaks. Evolution of shell structure was observed in the fission fragment mass distributions even at high excitation energy.
International Nuclear Information System (INIS)
Glover, S.E.; Qu, H.; LaMont, S.P.; Grimm, C.A.; Filby, R.H.
2001-01-01
The determination of isotopic thorium by alpha spectrometric methods is a routine practice for bioassay and environmental measurement programs. Alpha-spectrometry has excellent detection limits (by mass) for all isotopes of thorium except 232 Th due to its extremely long half-life. Improvements in the detection limit an sensitivity over previously reported methods of pre-concentration neutron activation analysis (PCNAA) for the recovery corrected, isotopic determination of thorium in various matrices is discussed. Following irradiation, the samples were dissolved, 231 Pa added as a tracer, and Pa isolated by two different methods and compared (extraction chromatography and anion exchange chromatography) followed by alpha spectrometry for recovery correction. Ion exchange chromatography was found to be superior for this application at this time, principally for reliability. The detection limit for 232 Th of 3.5 x 10 -7 Bq is almost three orders of magnitude lower than for alpha spectrometry using the PCRNAA method and one order of magnitude below previously reported PCNAA methods. (author)
International Nuclear Information System (INIS)
Reza Abdi, Mohammad; Kamali, Mehdi; Vaezifar, Sedigheh
2008-01-01
A reconnaissance study has been made of the distribution of 238 U, 232 Th, 40 K and 137 Cs and geochemical features in soils and sediments samples at various locations in the northwestern coast of Persian Gulf. Activity concentration levels due to radionuclides were measured in 30 soil and sediment samples collected from this region. From the measured spectra, activity concentrations were determined for 40 K (range from 146 to 500 Bq kg -1 ), 137 Cs (from 5 to 20 Bq kg -1 ), 238 U (from 21 to 65 Bq kg -1 ) and 232 Th (from 15 to 45 Bq kg -1 ) with lowest limit detection (LLD) of 68, 3.2, 4.3 and 4.3 Bq kg -1 , respectively. The dose rate from ambient air at the soil ranges was between 19 and 58 nGy h -1 with an average of 37.41 ± 9.66 nGy h -1
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
Park, Jiyun; An, Seong Soo A; Giau, Vo Van; Shim, Kyuhwan; Youn, Young Chul; Bagyinszky, Eva; Kim, SangYun
2017-08-01
In the present study, a novel mutation in exon 7 of presenilin 1 (Leu232Pro) was discovered in a Korean patient with early-onset Alzheimer's disease, who represented memory decline at 37 years of age, followed by impairment in spatial activity and concentrations and personality changes. Imaging analyses with magnetic resonance scan showed diffuse atrophy in the frontoparietal regions. Targeted next generation sequencing and Sanger sequencing identified a heterozygous T to C transition at position 695 (c.695T>C) of in presenilin 1 gene (PSEN1), resulting in a novel missense mutation at codon 232 from leucine to proline (L232P). Several family members of the patient developed dementia, suggesting an autosomal dominant inheritance; however, we were unable to perform a segregation analysis to confirm this. Since the proline may play a role as a helix breaker, this mutation could significantly disturb the transmembrane helix domain-V of PSEN1 and perturb its protein functions. This hypothesis was supported by the results from the in silico analyses, predicted a major kink on this helix. Several leucine>proline substitutions in other PSEN1 transmembrane helices revealed aggressive AD phenotypes. Future functional studies would be needed to evaluate the pathogenicity of this mutation in AD. Copyright © 2017 Elsevier Inc. All rights reserved.
Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H
International Nuclear Information System (INIS)
Blanchard, A.
1999-01-01
'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'
Independent Yields of Kr Isotopes at Photofission of $^{232}$Th and $^{238}$U
Gangrsky, Yu P; Zemlyanoi, S G; Maslova, N Yu; Myshinskii, G V; Norov, K S; Penionzhkevich, Yu E; Selesh, O
2002-01-01
The yields of the primary fission fragments - Kr isotopes - at the photofission of ^{232}Th and ^{238}U were measured. The experiments were performed at the microtron of FLNR, JINR, with the energy of the accelerated electrons 25 MeV. The methodic of fission fragments transportation by the gas flow through the capillary and condensation of the inert gases in the cryostat at the liquid nitrogen temperature was used. The fission fragments of other elements were stopped by the filter on the entrance of the capillary. The identification of the Kr isotopes was performed using the gamma-spectra of their daughter products. The mass distribution of the Kr isotopes independent yields was obtained and the comparison with yields at the prompt and thermal neutron fission was discussed.
International Nuclear Information System (INIS)
Garcez, Ricardo Washington Dutra; Lopes, Jose Marques; Silva, Ademir Xavier da; Domingues, Alessandro Mariano; Lima, Marco Frota
2015-01-01
Use of fertilizer is an established practice worldwide to promote agricultural productivity increased without increasing the planted area, resulting in native forests protection and increase of the food availability. Some kinds of fertilizer have in their chemical composition some radionuclides due the origin of its feedstock, such as 238 U, the 232 Th, and their descendants, beyond 40 K. Knowledge of the radioactivity levels in the environment is great importance to know the gamma radiation dose that the human being is exposed. For identification and quantitation of radionuclides, it was used gamma spectrometry where HPGe detector was used to obtain the spectra, and LabSOCS software for calculating the detection efficiency for each energy. The values of 232 Th specific concentrations ranged from 4.1 to 368.1 Bq.Kg -1 , the values of 238 U specific concentrations ranged from 16.0 to 647.7 Bq.Kg -1 and 40 K specific concentrations ranged from 19.1 to 12713 Bq.Kg -1 . Concentrations of values are consistent with those found in literature. (author)
Radium-228 as an indicator of thorium-232 presence in a soil in Pernambuco, Brazil.
Santos Júnior, J A; Amaral, R S; Silva, C M; Menezes, R S C; Bezerra, J D
2009-06-01
Radiometric measurements were taken in a small area of Pernambuco, Brazil, with the objective of monitoring the radium of the soil. For this, 78 soil samples were collected. The gamma analyses of the samples were carried out using HPGe. The values obtained for the (226)Ra varied from 14 to 367 Bqkg(-1) and for the (228)Ra from 73 to 429 Bqkg(-1). The ratio (228)Ra/(226)Ra varied from 1.0 to 7.0. Therefore, it is an indicator of an additional radioactivity source in this soil, maybe (232)Th, which will be further investigated in future studies.
International Nuclear Information System (INIS)
Ridha, A.A.; Mutter, M.M.; Salim, M.D.
2015-01-01
The study of natural radioactivity in public universities soil is very important because of containing a large numbers of students and personnel in small areas and for long periodic times, especially the centers and gathering students areas. So it was chosen the most important universities in Baghdad city according with the students density, which is Baghdad and Nahrain University in Al-Jadriyah region in addition to Al-Mustansiriyah University in Palestine street region. Thirteen soil samples collected from these regions to estimate the radiological impact to the dweller, the concentrations of 238 U, 232 Th and 40 K present in the soil samples were analyzed using HPGe as Gamma-spectrometry. The results showed that the average radioactivity of 238 U is 26.262±4.52 Bq/ kg, for 232 Th is equal to 24.860±4.03 Bq/ kg and for 40 K is 293.706±16.62 Bq/ kg. Thus, the values of specific activity of 238 U, 232 Th and 40 K for all soil samples are in acceptable values of the worldwide average. The maximum value for Ra eq is 119.727±10.94 Bq/ kg recorded in sample (Bag2), with an average value of 76.938±8.44 Bq/ kg. All soil samples have Ra eq value below the 247 Bq/ kg (Iraqi permissibility limit). In addition to radium equivalent, the absorbed gamma dose rate (D), outdoor annual effective dose and hazard indices are calculated in this work and show low values compared with permissible limits. (author)
International Nuclear Information System (INIS)
Kotthaus, Tanja
2010-01-01
In this thesis five heavy deformed isotopes from the mass region A≥230, namely 234 U, 233 U, 231 Th, 230 Pa and 232 Pa, were investigated by means of deuteron-induced neutron transfer reactions. The even-even isotope 234 U has been studied with the 4π-γ-spectrometer MINIBALL at the Cologne Tandem accelerator. Excited nuclei in the isotope 234 U were produced using the reaction 235 U(d,t) at a beam energy of 11 MeV. The target thickness was 3.5 mg/cm 2 . The analysis of the γγ-coincidence data yielded a reinterpretation of the level scheme in 12 cases. Considering its decay characteristics, the 4 + state at an excitation energy of 1886.7 keV is a potential candidate for a two-phonon vibrational state. The isotopes 233 U, 231 Th, 230 Pa and 232 Pa were investigated at the Munich Q3D spectrometer. For each isotope an angular distribution with angles between 5 and 45 were measured. In all four cases the energy of the polarized deuteron beam (vector polarization of 80%) was 22 MeV. As targets 234 U (160 μg/cm 2 ), 230 Th (140 μg/cm 2 ) and 231 Pa (140 μg/cm 2 ) were used. The experimental angular distributions were compared to results of DWBA calculations. For the odd isotope 233 U spin and parity for 33 states are assigned and in the other odd isotope 231 Th 22 assignments are made. The excitation spectra of the two odd-odd isotopes 230 Pa and 232 Pa were investigated for the first time. For the isotope 230 Pa 63 states below an excitation energy of 1.5 MeV are identified. Based on the new experimental data the Nilsson configuration of the ground state is either 1/2[530] p -5/2[633] n or 1/2[530] p +3/2[631] n . In addition 12 rotational bands are proposed and from this six values for the GM splitting energy are deduced as well as two new values for the Newby shift. In the other odd-odd isotope 232 Pa 40 states below an excitation energy of 850 keV are observed and suggestions for the groundstate band and its GM partner are made. From this one GM splitting
Determination of specific activity of 226Ra, 232Th and 40K for assessment of environmental hazards
International Nuclear Information System (INIS)
Al-Haydari, A.; Al Sharabi, E. S. A.; Al Buhairi, M. H.
2012-01-01
Studies have been carried out using gamma-spectrometric techniques to determine the natural radioactivity in some rocks that are used as building materials in Yemen. The concentrations of the natural radionuclides namely 226 Ra, 232 Th and 40 K in the rock samples collected from different rock markets in Yemen have been determined using an NaI(Tl) detector. The concentrations of 226 Ra, 232 Th and 40 K in the studied rock samples range from 22.2 to 88.8 Bq kg -1 , 8.12 to 113.68 Bq kg -1 and 31.3 to 2222.3 Bq kg -1 , respectively. The concentrations of these radionuclides are compared with the typical world values. To evaluate the radiological hazard of the natural radioactivity, the radium equivalent activity, the air absorbed dose rate, the annual effective dose rate, the representative level index and the values of both external and internal hazard indices were evaluated and compared with the internationally approved values. The radium equivalent activity values of all rock samples are lower than the limit of 370 Bq kg -1 except for one sample which is about 413.386. The values of external hazard index (H ex ) and internal hazard index (H in ), absorbed doses in indoor air and the corresponding effective dose equivalents in a typical dwelling are presented. The need for further studies is also discussed. (authors)
Energy Technology Data Exchange (ETDEWEB)
Park, Ji Young; Lim, Chung Sup [Radiation Biotechnology and Applied Radioiostope Science, University of Science and Technology, Daejeon (Korea, Republic of); Lim, Jong Myoung; Ji, Young Yong; Chung, Kun Ho; Lee, Wan No; Kang, Mun Ja [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Jang, Byung Uck [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)
2016-12-15
As new legislation has come into force implementing radiation safety management for the use of naturally occurring radioactive materials (NORM), it is necessary to establish a rapid and accurate measurement technique. Measurement of {sup 238}U and {sup 232}Th using conventional methods encounter the most significant difficulties for pretreatment (e.g., purification, speciation, and dilution/enrichment) or require time-consuming processes. Therefore, in this study, the applicability of ED-XRF as a non-destructive and rapid screening method was validated for raw materials and by-product samples. A series of experiments was conducted to test the applicability for rapid screening of XRF measurement to determine activity of {sup 238}U and {sup 23{sup 2}}Th based on certified reference materials (e.g., soil, rock, phosphorus rock, bauxite, zircon, and coal ash) and NORM samples commercially used in Korea. Statistical methods were used to compare the analytical results of ED-XRF to those of certified values of certified reference materials (CRM) and inductively coupled plasma mass spectrometry (ICP-MS). Results of the XRF measurement for {sup 238}U and {sup 232}Th showed under 20% relative error and standard deviation. The results of the U-test were statistically significant except for the case of U in coal fly ash samples. In addition, analytical results of {sup 238}U and {sup 232}Th in the raw material and by-product samples using XRF and the analytical results of those using ICP-MS (R{sup 2}≥0.95) were consistent with each other. Thus, the analytical results rapidly derived using ED-XRF were fairly reliable. Based on the validation results, it can be concluded that the ED-XRF analysis may be applied to rapid screening of radioactivities ({sup 238}U and {sup 232}Th) in NORM samples.
Penicyclones A-E, Antibacterial Polyketides from the Deep-Sea-Derived Fungus Penicillium sp. F23-2.
Guo, Wenqiang; Zhang, Zhenzhen; Zhu, Tianjiao; Gu, Qianqun; Li, Dehai
2015-11-25
Five new ambuic acid analogues, penicyclones A-E (1-5), were isolated from the extract of the deep-sea-derived fungus Penicillium sp. F23-2. The structures including the absolute configurations were established by interpretation of NMR and MS data, as well as the application of ECD, X-ray crystallography, and a chemical conversion, as well as the TDDFT-ECD calculations. Penicyclones A-E (1-5) exhibited antimicrobial activity against the Gram-positive bacterium Staphylococcus aureus with MIC values ranging from 0.3 to 1.0 μg/mL.
International Nuclear Information System (INIS)
Cumhur Canbazoglu; Mahmut Dogru
2013-01-01
Determining radioactivity levels in foodstuffs is of great importance for the protection of human health. In addition, the literature includes few studies related to this subject in Turkey. In this study, gamma spectroscopic system was used in order to measure 226 Ra, 232 Th, 40 K and 137 Cs activity concentrations in vegetables and fruits produced in Elazig( Region. The average activity concentrations in vegetables was calculated as 0.64 ± 0.26 Bq kg -1 for 226 Ra, 0.65 ± 0.14 Bq kg -1 for 232 Th, 13.98 ± 1.22 Bq kg -1 for 40 K, and 0.54 ± 0.04 Bq kg -1 for 137 Cs. The average activity concentrations in fruits were 1.52 ± 0.34, 0.98 ± 0.23, 18.66 ± 1.13 and 0.59 ± 0.16 Bq kg -1 , respectively for 226 Ra, 232 Th, 40 K and 137 Cs. Total committed effective dose value was determined as 20 and 30.55 μSv y -1 , respectively for vegetables and fruits. The findings were compared with previous data reported for Turkey and other regions of the world. (author)
Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H
Energy Technology Data Exchange (ETDEWEB)
Blanchard, A.
1999-05-10
'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'
International Nuclear Information System (INIS)
Tornow, W.; Arnold, W.; Herdtweck, J.; Mertens, G.
1986-01-01
The response of the deuterated scintillators NE 232 and NE 230 to protons and deuterons has been measured via elastic neutron-proton and neutron-deuteron scattering using the two mixtures of C 6 H 12 /C 6 D 12 and C 6 H 6 /C 6 D 6 and ''pure'' scintillators. The energy range covered for protons and deuterons was about 1-16 MeV. The light output relation Lsub(p)(E)=(1/2)Lsub(d) (2E) has been observed. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Denyak, V.V. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Pele Pequeno Principe Research Institute, Curitiba (Brazil); Khvastunov, V.M. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Paschuk, S.A. [Federal University of Technology - Parana, Curitiba (Brazil); Schelin, H.R. [Federal University of Technology - Parana, Curitiba (Brazil); Pele Pequeno Principe Research Institute, Curitiba (Brazil)
2013-04-15
Fission of the even-even nuclei {sup 232}Th, {sup 236,238}U and even-odd nuclei {sup 233,235}U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of {sup 236}U and {sup 238}U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of {sup 236}U. The measured cross section azimuthal asymmetry of the fission of {sup 232}Th does not show any fragment mass dependence. In the even-odd nuclei {sup 233}U and {sup 235}U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)
Data acquisition from vacuum gage controlled by RS-232 standard using LabVIEW
International Nuclear Information System (INIS)
Brandea, Iulian; Culcer, Mihai; Steflea, Dumitru
1999-01-01
This paper deals with the problem of connecting a microcontroller-based vacuum gage to a personal computer, using the RS-232 hardware standard and the software LabVIEW and his collection of virtual instruments from National Instruments. To solve the problem an instrument driver was created. This provided the customer with a perfect solution for the remote control and data acquisition from an Intel 80CXX microcontroller-based vacuum gage. The remote control making use of an IBM-PC was design and manufactured in our institute. In order to make it intelligent the device was provided with a microprocessor or a microcontroller. To fulfill the requirements a vacuum gage with an 80C31 microcontroller and two Bayard-Alpert ion gauges, for very low pressures (10 -3 to 10 -7 mbar) and low pressure (10 mbar to 10 -3 mbar) was built. Because this microcontroller has a built-in circuitry for a serial communication, we established a serial communication between the PC (Pentium -166 MHz) and the vacuum gage, according to the RS-232 hardware standard. Optimum selection of software development tools however, was not as straightforward. Most producers use the C/C ++ - language programming tool for developing instrument drivers for their intelligent devices. One of the advantages of C/C ++ is its speed, but the compilation and the high-level skill required for optimum programming do not fit well with some requirements, particularly those of versatility, upgradability and user friendliness. After careful evaluation of several options, a final decision was to develop a hybrid software package using two different software development tools: LabVIEW, and assembly language. We chose LabVIEW because it is dedicated to data acquisition and communications, containing libraries for data collection, analysis, presentation and storage. The assembly language for Intel 8051's microcontrollers family is used to write the firmware for the vacuum gage and arithmetic routines. (authors)
Directory of Open Access Journals (Sweden)
Victor M. Tshivhase
2015-12-01
Full Text Available Medicinal plant consumption can be a source of human exposure to radioactive elements such as 238U and 232Th, which can lead to internal radiation doses. The uptake of 238U and 232Th from soils to the leaf samples of three different medicinal plant species (Eucalyptus globulus, Acacia mearnsii and Hyparrhenia filipendula from the purlieu of the Princess gold mine dump, an abandoned contaminated tailings storage site (TSS, located at longitude 27°55′00″E and latitude 26°09′30″S in Davidsonville (Roodepoort, west of Johannesburg, South Africa was measured. This was done using ICP-MS spectrometry and substantial differences were observed in the soil-plant transfer factor (TF values between these radionuclides. The plant species E. globulus exhibited the highest uptake of 238U, with an average TF of 3.97, while that of H. filipendula was 0.01 and the lowest TF of 0.15 × 10−2 was measured for A. mearnsii. However, in the case of 232Th, the highest average TF was observed for A. mearnsii (0.29, followed by E. globulus (0.10 and lowest was measured for H. filipendula (0.27 × 10−2. The ratio of TF average value i.e., 238U to 232Th in the soil-plant leaves was 38.05 for E. globulus, 0.01 for A. mearnsii and 4.38 for H. filipendula.
Tshivhase, Victor M.; Njinga, Raymond L.; Mathuthu, Manny; Dlamini, Thulani C.
2015-01-01
Medicinal plant consumption can be a source of human exposure to radioactive elements such as 238U and 232Th, which can lead to internal radiation doses. The uptake of 238U and 232Th from soils to the leaf samples of three different medicinal plant species (Eucalyptus globulus, Acacia mearnsii and Hyparrhenia filipendula) from the purlieu of the Princess gold mine dump, an abandoned contaminated tailings storage site (TSS), located at longitude 27°55′00″E and latitude 26°09′30″S in Davidsonville (Roodepoort, west of Johannesburg, South Africa) was measured. This was done using ICP-MS spectrometry and substantial differences were observed in the soil-plant transfer factor (TF) values between these radionuclides. The plant species E. globulus exhibited the highest uptake of 238U, with an average TF of 3.97, while that of H. filipendula was 0.01 and the lowest TF of 0.15 × 10−2 was measured for A. mearnsii. However, in the case of 232Th, the highest average TF was observed for A. mearnsii (0.29), followed by E. globulus (0.10) and lowest was measured for H. filipendula (0.27 × 10−2). The ratio of TF average value i.e., 238U to 232Th in the soil-plant leaves was 38.05 for E. globulus, 0.01 for A. mearnsii and 4.38 for H. filipendula. PMID:26690462
Dynamic effects in neutron induced fission of 230Th and 232Th
International Nuclear Information System (INIS)
Trochon, J.; Frehaut, J.; Pranal, Y.; Simon, G.; Boldeman, J.W.
1982-09-01
The fission fragment characteristics of the two thorium isotopes 230 Th and 232 Th have been measured in an attempt to study the evolution of the fissioning nucleus from saddle point to scission. The partial fission channel at the saddle point have been deduced from a fission fragment angular distribution and fission cross section analysis. Changes with energy in the average number of prompt neutron (νsub(p)) emitted per fission and the total fragment kinetic energy (TKE) have been observed in the fission threshold region. A rather good fit of νsub(p) and TKE values has been obtained on the basis of a correlation of these quantities and the partial fission channel ratios. This leads to expect for these isotopes a passage from saddle point to scission sufficiently rapid for the coupling between collective and intrinsic excitation to be very weak [fr
International Nuclear Information System (INIS)
Abdul Rahman, A.T.; Ramli, A.T.
2007-01-01
A survey was carried out to determine terrestrial gamma radiation dose rates, the concentration level of 238 U and 232 Th and α and β activities for the surface soil in Ulu Tiram, Malaysia. A 125 measurements were performed using a NaI(Tl) gamma-ray detector with crystal size of 1' x 1' on 15 soil samples collected from the site area about 102 km 2 . 238 U and 232 Th concentrations were determined in soils by using hyper pure germanium (HPGe) gamma-ray spectrometry. The activity of α and β from the surface soil was counted by using alpha beta counting system. The average value of 238 U and 232 Th concentrations in soil samples collected are 3.63±0.39 ppm within the range of 1.74±0.20 to 4.58±0.48 and 43.00±2.31 ppm within the range of 10.68±0.76 to 82.10±4.01 ppm, respectively. The average estimate of α and β activity in soil samples collected are 0.65±0.09 Bq x g -1 and 0.68±0.08 Bq x g -1 , respectively. The average of terrestrial gamma-radiation dose rates measured in Ulu Tiram was found to be 200 nGy x h -1 , within the range of 96 to 409 nGy x h -1 . The population weighted outdoor annual effective dose was 1.2 mSv. (author)
International Nuclear Information System (INIS)
Wilcke, W.; Felix, W.; Elze, Th.W.; Huizenga, J.R.; Thompson, R.C.; Dreisler, R.M.
1977-01-01
Tables of spectroscopic information are given for the nuclei 233 , 235 , 237 Pa, and 229 , 231 Ac studied in the reactions 234 , 236 , 238 U, and 230 , 232 Th(t,α), including spin, parity, differential cross sections, and spectra. These quantities are discussed and plotted
International Nuclear Information System (INIS)
Odintsov, A.A.; Sazhenyuk, A.D.
2003-01-01
The experimental data determination of distribution 137 Cs, 90 Sr, 239+240 Pu, 241 Am 'Chernobyl' releases and 230 , 232 Th on the fraction of humic and fulvic acids sandy- podsolic, meadow and peaty soils taken in the exclusive zone ChNPP are presents. Soils organic matter was isolated by conventional alkali extraction (Turin's method). It was shown that, with depending of soils types 15-45 % 241 Am associate with fulvic acids. In all investigated types of soils 30 - 40 % 239+240 Pu connects with humic acids, as strong complexes. The distribution of environmental 230 , 232 Th and artificial 239+240 Pu on the fraction natural organic species is the same
DEFF Research Database (Denmark)
Toft-Petersen, Marie; Kjeldsen, Eigil; Nederby, Line
2014-01-01
We have identified a novel 7.7 Mb del(8)(q23.2q24.11) in a patient progressing to acute myeloid leukemia (AML) following a 12-year stable phase of chronic myelomonocytic leukemia (CMML). A surprisingly high JAK2+ allelic burden of 92% at the time of AML led us to delineate the molecular aberrations...... relevant for leukemogenesis. While a frameshift mutation in the TET2 gene was stably present throughout the course of disease the JAK2 mutation was acquired after initial diagnosis of CMML. At progression aCGH revealed del(8q)(q23.2q24.11) encompassing various cancer relevant genes of which RAD21 and CSMD3...
Deactivation and cleanout of the 308 Fuels Laboratory and the 232-Z Incinerator at the Hanford site
International Nuclear Information System (INIS)
Gerber, M.S.; Bliss, R.J.
1994-12-01
This paper describes the deactivation and source term reduction activities conducted over the recent past in two plutonium-contaminated Hanford Site buildings: the 308 Fuels Development Laboratory and the 232-Z Incinerator. Both of these facilities belong to the U.S. Department of Energy, and the projects are unique success stories carried out in direct support of EM-60 functions and requirements. In both cases the buildings, for different reasons, contained unacceptable amounts of plutonium, and were stabilized and placed in a safe, pre-D ampersand D (decontamination and decommissioning) mode. The concept of deactivation as the last step in the operating life of a facility will be discussed. The need for and requirements of EM-60 transition between operations and D ampersand D, the costs savings, techniques, regulations and lessons learned also will be discussed. This paper describes the strategies that led to successful source term reduction: accurate characterization, cooperation among different divisions within DOE and the Hanford Site, attention to regulations (especially unique in this case since the 232-Z Incinerator has been nominated as a Historic Structure to the National Register of Historic Places), and stakeholder concerns involving the proximity of the 308 Building to the Columbia River. The paper also weaves in the history, missions, and plutonium accumulation of the two buildings. The lessons learned are cogent to many other present and future deactivation activities across the DOE complex and indeed across the world
Directory of Open Access Journals (Sweden)
R. Damayanti
2017-05-01
Full Text Available An experimental transmission study was conducted using nine healthy Indonesian indigenous chickens placed together with two 30 days old ducks which were experimentally infected with H5N1 HPAI clade 2.3.2 virus in the Biosafety Laboratory Level 3 (BSL-3 facilities. The aim of the study was to find out the pathogenicity of H5N1 HPAI virus clade 2.3.2 in Indonesian indigenous chickens. The study showed that within twenty four hours rearing, the chickens were exhibited mild clinical signs and by 48 hours, all of the chickens died, whereas the ducks survived but with severe clinical signs. The H5N1 HPAI virus has been successfully isolated from chickens and ducks swabs, confirming that those animals were infected by the virus. Histologically, the infected chicken encountered with severe inflammation reaction namely non suppuratives encephalitis, tracheitis, myocarditis, interstitial pneumonia, hepatitis, proventriculitis, enteritis, pancreatitis, nephritis and bursitis. Necrotizing spleen and pancreas were also prominent. Viral antigen was detected by immunohistochemistry staining in various affected visceral organs. This suggests that Indonesian indigenous chickens were susceptible to H5N1 HPAI virus clade 2.3.2 and it can be transmitted easily to Indonesian indigenous chickens by contact transmission with infected ducks.
International Nuclear Information System (INIS)
Zheng Wei; Zeen Yao; Changlin Lan; Yan Yan; Yunjian Shi; Siqi Yan; Jie Wang; Junrun Wang; Jingen Chen; Chinese Academy of Sciences, Shanghai
2015-01-01
Monte Carlo transport code Geant4 has been successfully utilised to study of neutron-induced fission reaction for 232 Th in the transport neutrons generated from 3 H(d,n) 4 He neutron source. The purpose of this work is to examine the applicability of Monte Carlo simulations for the computation of fission reaction process. For this, Monte Carlo simulates and calculates the characteristics of fission reaction process of 232 Th(n,f), such as the fission yields distribution, kinetic energy distribution, fission neutron spectrum and decay γ-ray spectrum. This is the first time to simulate the process of neutron-induced fission reaction using Geant4 code. Typical computational results of neutron-induced fission reaction of 232 Th(n,f) reaction are presented. The computational results are compared with the previous experimental data and evaluated nuclear data to confirm the certain physical process model in Geant4 of scientific rationality. (author)
DEFF Research Database (Denmark)
Schönewolf-Greulich, Bitten; Ronan, Anne; Ravn, Kristine
2011-01-01
Microdeletion of the 17q23.2 region has very recently been suggested as a new emerging syndrome based on the finding of 8 cases with common phenotypes including mild-to-moderate developmental delay, heart defects, microcephaly, postnatal growth retardation, and hand, foot, and limb abnormalities...
Cost-based optimizations of power density and target-blanket modularity for 232Th/233U-based ADEP
International Nuclear Information System (INIS)
Krakowski, R.A.
1995-01-01
A cost-based parametric systems model is developed for an Accelerator-Driven Energy Production (ADEP) system based on a 232 Th/ 233 U fuel cycle and a molten-salt (LiF/BeF 2 /ThF 3 ) fluid-fuel primary system. Simplified neutron-balance, accelerator, reactor-core, chemical-processing, and balance-of-plant models are combined parametrically with a simplified costing model. The main focus of this model is to examine trade offs related to fission power density, reactor-core modularity, 233 U breeding rate, and fission product transmutation capacity
Energy Technology Data Exchange (ETDEWEB)
Lan, Chang-Lin; Fang, Kai-Hong [Lanzhou University, School of Nuclear Science and Technology, Lanzhou, Gansu Province (China); Lanzhou University, Engineering Research Center for Neutron Application, Ministry of Education, Lanzhou, Gansu Province (China); Liu, Shuang-Tong; Lv, Tao; Wang, Qiang; Zhang, Zheng-Wei [Lanzhou University, School of Nuclear Science and Technology, Lanzhou, Gansu Province (China); Lai, Cai-Feng [Chinese Academy of Engineering Physics, Institute of Nuclear Physics and Chemistry, Mianyang, Sichuan Province (China)
2016-11-15
The fission cross-section of the {sup 232}Th(n,f){sup 141}Ba reaction induced by neutrons around 14 MeV was measured precisely with the neutron activation and off-line gamma-ray spectrometric technique. Neutron fluence was monitored on-line using the accompanying α-particles from the {sup 3}H({sup 2}H,n){sup 4}He reaction, whereas the neutron energies were measured by the method of cross-section ratios of {sup 90}Zr(n,2n){sup 89}Zr to {sup 93}Nb(n,2n){sup 92m}Nb reactions. The experimentally determined {sup 232}Th(n,f){sup 141}Ba reaction cross-sections were 12.2 ± 0.4 mb at E{sub n} = 14.1 ± 0.3 MeV, 13.0 ± 0.5 mb at E{sub n} = 14.5 ± 0.3 MeV and 13.3 ± 0.5 mb at E{sub n} = 14.7 ± 0.3 MeV, respectively. (orig.)
International Nuclear Information System (INIS)
Saleh, Muneer Aziz; Ramli, Ahmad Termizi; Alajerami, Yasser; Aliyu, Abubakar Sadiq
2013-01-01
Extensive environmental survey and measurements of gamma radioactivity in the soil samples collected from Segamat District were conducted. Two gamma detectors were used for the measurements of background radiation in the area and the results were used in the computation of the mean external radiation dose rate and mean weighted dose rate, which are 276 nGy h −1 and 1.169 mSv y −1 , respectively. A high purity germanium (HPGe) detector was used in the assessment of activity concentrations of 232 Th, 226 Ra and 40 K. The results of the gamma spectrometry range from 11 ± 1 to 1210 ± 41 Bq kg −1 for 232 Th, 12 ± 1 to 968 ± 27 Bq kg −1 for 226 Ra, and 12 ± 2 to 2450 ± 86 Bq kg −1 for 40 K. Gross alpha and gross beta activity concentrations range from 170 ± 50 to 4360 ± 170 Bq kg −1 and 70 ± 20 to 4690 ± 90 Bq kg −1 , respectively. These results were used in the plotting of digital maps (using ARCGIS 9.3) for isodose. The results are compared with values giving in UNSCEAR 2000. -- Highlights: • Assessment of the activities in region of elevated radiation in Segamat District. • The average dose rate found to be six times higher than the world average. • The activity of 232 Th is six times world average. • The activity of 226 Ra is four times and 40 K is lower than world average. • A digital map plotted for isodose
Ferreira, Ademar de O.; Bastos, Rodrigo O.; Appoloni, Carlos R.
2008-08-01
Naturally occurring radioisotopes are present in different concentrations in sedimentary rocks, reflecting the origin of the sediments, the depositional environment, and more recent events such as weathering and erosion. Using a high-resolution γ-ray spectrometry methodology, sedimentary rocks were measured to assess the concentration activities of the natural radioisotopes. The surveyed rocks are from the Irati formation in the Paraná sedimentary basin, which are exposed by an abandoned, open-pit limestone mine, in the city of Sapopema, southern Brazil. The exposed vertical profile is 5 m, and its stratigraphy is represented by an alternation of limestone and bituminous shale (layers being a few decimeters thick), and some millimeter rhythm layers with limestone and bituminous shale laminas. Eleven samples were collected along this profile, each of them dried in the open air during 48 hours, sieved through 4 mm mesh and sealed in cylindrical recipients. Measurements were accomplished using a 66% relative efficiency HPGE detector connected to a standard gamma ray spectrometry electronic chain. The detector efficiency in the range of 60 to 1800 keV was carried out with the certified IAEA-385 sediment sample. The Lower Limit of Detection (LLD) to the system is 2.40 Bqṡkg-1 for 226Ra, 1.84 Bqṡkg-1 for 232Th and 4.20 Bqṡkg-1 for 40K. Activity concentrations were determined for 226Ra (from 16.22 to 151.55 Bqṡkg-1), 232Th (from 2.93 to 56.12 Bqṡkg-1) and 40K (from 38.45 to 644.63 Bqṡkg-1). The layers enriched with organic matter presented the higher values of activity. The measured concentrations of the natural radioisotopes were lower for limestone samples (average values and respective deviations were 22.81±0.22 Bqṡkg-1 for 226Ra, 4.21±0.07 Bqṡkg-1 for 232Th, and 50.11±0.82 Bqṡkg-1 for 40K). Higher concentrations were measured for the bituminous shale samples (average values and respective deviations were 108.10±12.17 Bqṡkg-1 for 226Ra, 43.69
Display of rotational levels near the fission threshold in 232Th(n,f) reaction
International Nuclear Information System (INIS)
Blons, J.; Mazur, C.; Paya, D.
1975-01-01
The 232 Th(n,f) cross section has been measured relative to that of 235 U up to 5MeV, with a neutron energy resolution of 3keV at 1.6MeV. The angular anisotropy of fission fragments has also been measured in the same energy range with an energy resolution of 6keV at 1,6MeV. The broad vibrational levels located above 1MeV are resolved into sharp structures which are interpreted as rotational states. The rotational constants h 2 /2J of highly deformed 233 Th are found to be 2.45 and 2.65keV at 1.5 and 1.6MeV respectively. These results are interpreted by the possibility of a third minimum in the fission barrier [fr
International Nuclear Information System (INIS)
Ferreira, Ademar de O.; Bastos, Rodrigo O.; Appoloni, Carlos R.
2008-01-01
Naturally occurring radioisotopes are present in different concentrations in sedimentary rocks, reflecting the origin of the sediments, the depositional environment, and more recent events such as weathering and erosion. Using a high-resolution γ-ray spectrometry methodology, sedimentary rocks were measured to assess the concentration activities of the natural radioisotopes. The surveyed rocks are from the Irati formation in the Parana sedimentary basin, which are exposed by an abandoned, open-pit limestone mine, in the city of Sapopema, southern Brazil. The exposed vertical profile is 5 m, and its stratigraphy is represented by an alternation of limestone and bituminous shale (layers being a few decimeters thick), and some millimeter rhythm layers with limestone and bituminous shale laminas. Eleven samples were collected along this profile, each of them dried in the open air during 48 hours, sieved through 4 mm mesh and sealed in cylindrical recipients. Measurements were accomplished using a 66% relative efficiency HPGE detector connected to a standard gamma ray spectrometry electronic chain. The detector efficiency in the range of 60 to 1800 keV was carried out with the certified IAEA-385 sediment sample. The Lower Limit of Detection (LLD) to the system is 2.40 Bq·kg -1 for 226 Ra, 1.84 Bq·kg -1 for 232 Th and 4.20 Bq·kg -1 for 40 K. Activity concentrations were determined for 226 Ra (from 16.22 to 151.55 Bq·kg -1 ), 232 Th (from 2.93 to 56.12 Bq·kg -1 ) and 40 K (from 38.45 to 644.63 Bq·kg -1 ). The layers enriched with organic matter presented the higher values of activity. The measured concentrations of the natural radioisotopes were lower for limestone samples (average values and respective deviations were 22.81±0.22 Bq·kg -1 for 226 Ra, 4.21±0.07 Bq·kg -1 for 232 Th, and 50.11±0.82 Bq·kg -1 for 40 K). Higher concentrations were measured for the bituminous shale samples (average values and respective deviations were 108.10±12.17 Bq·kg -1 for
International Nuclear Information System (INIS)
Misdaq, M. A.; Outeqablit, K.
2010-01-01
238 U, 232 Th, 222 Rn and 220 Rn concentrations were measured inside various Moroccan black soap samples widely used by the Moroccan population in traditional baths (Hammams) by using both CR-39 and LR-115 type II solid state nuclear track detectors. The measured 238 U, 232 Th, 222 Rn and 220 Rn concentrations, respectively, ranged from (3.7±0.2) to (11.7±0.7) mBq kg -1 , (0.11±0.01) to (0.32±0.02) mBq kg -1 , (3.8±0.2) to (11.6±0.6) Bq kg -1 and (0.10±0.01) to (0.31±0.02) Bq kg -1 for the Moroccan black soap samples studied. The influence of pollution on the concentrations of these radionuclides inside the considered Moroccan black soap was investigated. A new dosimetric model for evaluating annual committed effective doses due to 238 U, 232 Th and 222 Rn to the skin of different age groups of the Moroccan populations from the application of the black soap samples studied was developed. The maximum total committed effective dose to the skin due to 238 U, 232 Th and 222 Rn from the application of unpolluted black soap samples 20 min per week by the Moroccan populations was found to be equal to (0.88±0.05) μSv y -1 cm -2 . (authors)
Bovenhuis, H.; Visker, M.H.P.W.; Poulsen, N.A.; Sehested, J.; Valenberg, van H.J.F.; Arendonk, van J.A.M.; Larsen, L.B.; Buitenhuis, A.J.
2016-01-01
Several studies have described associations between the diacylglycerol o-acyltransferase 1 (DGAT1) K232A polymorphism and routinely collected milk production traits but not much is known about effects of the DGAT1 polymorphism on detailed milk composition. The aim of this study was to estimate
The total kinetic energy release in the fast neutron-induced fission of {sup 232}Th
Energy Technology Data Exchange (ETDEWEB)
King, Jonathan; Yanez, Ricardo; Loveland, Walter; Barrett, J. Spencer; Oscar, Breland [Oregon State University, Dept. of Chemistry, Corvallis, OR (United States); Fotiades, Nikolaos; Tovesson, Fredrik; Young Lee, Hye [Los Alamos National Laboratory, Physics Division, Los Alamos, NM (United States)
2017-12-15
The post-emission total kinetic energy release (TKE) in the neutron-induced fission of {sup 232}Th was measured (using white spectrum neutrons from LANSCE) for neutron energies from E{sub n} = 3 to 91 MeV. In this energy range the average post-neutron total kinetic energy release decreases from 162.3 ± 0.3 at E{sub n} = 3 MeV to 154.9 ± 0.3 MeV at E{sub n} = 91 MeV. Analysis of the fission mass distributions indicates that the decrease in TKE with increasing neutron energy is a combination of increasing yields of symmetric fission (which has a lower associated TKE) and a decrease in the TKE release in asymmetric fission. (orig.)
Measurement of the 232Th capture cross section in the energy region 5 keV-150 keV
International Nuclear Information System (INIS)
Lobo, G.; Schillebeeckx, P.; Brusegan, A.; Borella, A.; Corvi, F.; Janeva, N.; Volev, K.
2003-01-01
The 232 Th(n,γ) neutron capture cross-section is of great importance for accelerator driven reactor (ADS) systems based on the Thorium-Uranium fuel cycle. An analysis of the required nuclear data, reveals that the status of the 232 Th capture data is far from the requested 2 % uncertainty level. Recently 232 Th average capture measurements, between 5-200 keV neutron energy, were performed at the FzK Karlsruhe (DE). A comparison of the measured averaged capture cross section with the evaluated data files shows a reasonable agreement in the neutron energy range above 15 keV. However, discrepancies of up to 40 % at lower neutron energies are observed. The same order of discrepancies is observed when comparing their results with the results obtained by Macklin et al. at ORELA. To clarify these discrepancies we measured at IRMM the average capture cross-section at the GEel LINear Accelerator (GELINA). The measurements were performed at a 14.37 m flight-path using the Time-Of-Flight (TOF) method. The gamma rays, originating from the 232 Th(n,γ) reaction, were detected by a pair of C 6 D 6 -based liquid scintillators applying a pulse-height weighting method. The neutron flux was measured with an ionisation chamber placed at 80 cm before the Thorium sample. This chamber has a cathode loaded with two back-to-back layers of about 40 μg/cm 2 10 B. The sample consisted of a metallic natural thorium disc of 8 cm diameter and 0.5 mm thick, corresponding to a thickness of 1.588 10 -3 at/b. The background for the capture measurements consists of a time independent and time dependent component. The former, mainly produced by the radioactive decay of the sample, was deduced from measurements with a closed beam. The latter was measured by replacing the thorium sample with a 0.5 mm thick 208 Pb sample of the same size. Such a Pb sample has practically the same scattering probability as the thorium sample and has a negligible capture yield. Therefore, the 208 Pb run provides a good
The way to safe and secure carotid endarterectomy. Review of 232 consecutive cases
International Nuclear Information System (INIS)
Moteki, Katsuhiko; Murayama, Takaya
2007-01-01
We investigated retrospectively perioperative and long-term complications of carotid endarterectomy (CEA) in 232 consecutive cases. Perioperative complications in surgical patients are 2.2% with no mortality. There was no perioperative embolic stroke in the later series of 130 CEA, although postoperative hyperperfusion was associated in two patients with edema and bleeding in their watershed area. We encountered 16 cases of pseudoocclusion, 11 cases were collapsed carotid arteries treated successfully by thromboendarterectomy, and 5 thrombosed cases were treated by CEA and thrombectomy, resulting in poor outcome. Thirteen cases of CEA with contlateral occlusion were performed uneventfully under intraluminal shunting. Redo operation for recurrent stenosis were performed successfully in 1.3% with patching. In the long-term follow-up of 118 consecutive cases, CEA had a clear benefit of preventing ipsilateral stroke in the first 3 years, but actual risks in long-term surgical patients were influenced more by their cardiac events than the stroke. Our findings suggest that managing cardiac events significantly affects life expectancy. (author)
International Nuclear Information System (INIS)
Ganesan, S.; McLaughlin, P.K.
1992-02-01
Since 1990, one of the most interesting developments in the field of nuclear data for nuclear technology applications is that several new evaluated data files have been finalized and made available to the International Atomic Energy Agency (IAEA) for distribution to its Member States. Improved evaluated nuclear data libraries such as ENDF/B-VI from the United States and JENDL-3 from Japan were developed over a period of 10-15 years. This report is not an evaluation of the evaluations. The report as presented here gives a first look at the cross section line shapes of the isotopes that are important to the thorium fuel cycle derived from the two recently evaluated data files: JENDL-3 and ENDF/B-VI. The basic evaluated data files JENDL-3 and ENDF/B-VI were point-processed successfully using the codes LINEAR and RECENT. The point data were multigrouped in three different group structures using the GROUPIE code. Graphs of intercomparisons of cross section line shapes of JENDL-3 and ENDF/B-VI are presented in this paper for the following isotopes of major interest to studies of the thorium fuel cycle: 230 Th, 232 Th, 231 Pa, 233 Pa, 232 U, 233 U and 234 U. Comparisons between JENDL-3 and ENDF/B-VI which were performed at the point and group levels show large discrepancies in various cross sections. We conclude this report with a general remark that it is necessary to perform sensitivity studies to assess the impacts of the discrepancies between the two different sets of data on calculated reactor design and safety parameters of specific reactor systems and, based on the results of such sensitivity studies, to undertake new tasks of evaluations. (author). 2 refs, 245 figs, 8 tabs
Energy Technology Data Exchange (ETDEWEB)
Reza Abdi, Mohammad [Department of Physics, University of Isfahan, Isfahan 81747-73441 (Iran, Islamic Republic of)], E-mail: r.abdi@phys.ui.ac.ir; Kamali, Mehdi [Central Laboratory, University of Isfahan, Isfahan 81747-73441 (Iran, Islamic Republic of); Vaezifar, Sedigheh [Department of Chemistry, University of Isfahan, Isfahan 81747-73441 (Iran, Islamic Republic of)
2008-04-15
A reconnaissance study has been made of the distribution of {sup 238}U, {sup 232}Th, {sup 40}K and {sup 137}Cs and geochemical features in soils and sediments samples at various locations in the northwestern coast of Persian Gulf. Activity concentration levels due to radionuclides were measured in 30 soil and sediment samples collected from this region. From the measured spectra, activity concentrations were determined for {sup 40}K (range from 146 to 500 Bq kg{sup -1}), {sup 137}Cs (from 5 to 20 Bq kg{sup -1}), {sup 238}U (from 21 to 65 Bq kg{sup -1}) and {sup 232}Th (from 15 to 45 Bq kg{sup -1}) with lowest limit detection (LLD) of 68, 3.2, 4.3 and 4.3 Bq kg{sup -1}, respectively. The dose rate from ambient air at the soil ranges was between 19 and 58 nGy h{sup -1} with an average of 37.41 {+-} 9.66 nGy h{sup -1}.
Energy Technology Data Exchange (ETDEWEB)
Garcez, Ricardo Washington Dutra; Lopes, Jose Marques; Silva, Ademir Xavier da, E-mail: rgarcez@con.ufrj.br, E-mail: marqueslopez@yahoo.com.br [Coordenacao dos Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Domingues, Alessandro Mariano; Lima, Marco Frota, E-mail: slessandrodomingues@fisica.if.uff.br, E-mail: marcofrotalima@yahoo.com.br [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Instituto de Biologia
2015-07-01
Use of fertilizer is an established practice worldwide to promote agricultural productivity increased without increasing the planted area, resulting in native forests protection and increase of the food availability. Some kinds of fertilizer have in their chemical composition some radionuclides due the origin of its feedstock, such as {sup 238}U, the {sup 232}Th, and their descendants, beyond {sup 40}K. Knowledge of the radioactivity levels in the environment is great importance to know the gamma radiation dose that the human being is exposed. For identification and quantitation of radionuclides, it was used gamma spectrometry where HPGe detector was used to obtain the spectra, and LabSOCS software for calculating the detection efficiency for each energy. The values of {sup 232}Th specific concentrations ranged from 4.1 to 368.1 Bq.Kg{sup -1} , the values of {sup 238}U specific concentrations ranged from 16.0 to 647.7 Bq.Kg{sup -1} and {sup 40}K specific concentrations ranged from 19.1 to 12713 Bq.Kg{sup -1} . Concentrations of values are consistent with those found in literature. (author)
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Behera, B.R.; Jena, S.; Satapathy, M.; Ison, V.V.; Kailas, S.; Chatterjee, A.; Shrivastava, A.; Mahata, K.; Satpathy, L.; Basu, P.; Roy, S.; Sharan, M.; Chatterjee, M.L; Datta, S.K.
2000-01-01
Fission fragment angular distributions of heavy-ion induced fission in actinide nuclei at near-barrier energies show anomalous fragment anisotropies. At above barrier energies entrance channel dependence is a probable cause and explanation in terms of pre-equilibrium fission and the critical mass asymmetry parameter (Businaro-Gallone) has been tried. Target deformation and ground state spin also seem to influence the measured anisotropy. To understand the extent of importance of some or all of these features, we performed a set of experiments where (i) entrance channel dependence (ii) mass asymmetry on the two sides of Businaro-Gallone and (iii) different ground state spins are present. The channels chosen are 14 N+ 232 Th and 11 B+ 235 U. Experiments were done using the Pelletron accelerators at NSC, New Delhi and BARC-TIFR, Bombay. Compound nucleus populated in both cases is 246 Bk. 232 Th has ground state spin zero and 235 U has spin 7/2. Fragment anisotropies have been measured from 10-15 % above barrier to 10 % below barrier at similar excitation energy (around 40 MeV to 58 MeV). The mean square angular momentum is matched at least at one energy. Results indicate that when both excitation energy and angular momentum are matched, there are differences in the measured values of fission anisotropies. This implies entrance channel dependence consistent with the expectation of pre-equilibrium fission model. (authors)
Environmental geochemistry of 238U, 232Th, 40K and some heavy metals in River Nile sediments
International Nuclear Information System (INIS)
Siddeeg, S. M. B.
2007-06-01
Environmental geochemistry is concerned with the abundance, distribution, and mobility of chemical elements in surface materials at the surface of earth crust. This study aimed at better understanding of geochemical behavior of 238 U, 23 '2Th and 40 K in river sediments and some heavy elements with emphasis on Mg, Ca, Mn, Fe, Ni, Cu, Zn and Pb. The analysis was conducted for a total of 33 bulk sediment samples from White Nile, Blue Nile and River Nile within Khartoum, the samples were fractionated into seven grain sizes each (2000-1000, 1000-500, 500-250, 250-200, 200-125, 125-100 and > 100 μm), using high resolution gamma spectrometer for radionuclides measurements, whereas Particle Induced X-ray Emission (PIXE) was used for heavy metals analysis. On the average, the activity concentration of 238 U, 232 Th and 40 K were 17.90±5.23, 16.38±5.34 and 379.82±107.76 Bq -1 Kg in White Nile, 19.56±5.04, 17.72±4.69, and 494.36±105.79 Bq -1 Kg in Blue Nile and 19.27±2.88, 17.48±2.78, 359.50±83.15 Bq -1 Kg in the River Nile sediments. Results revealed inverse relationship between activity concentration and grain size in White and Blue Nile, while the trend is not clear in the River Nile. In general, the variation of the measured values within single grain size was smaller in White Nile compare to Blue and River Nile sediments, and it was observed that the data are highly scattered in grain size (200-125μm). The ratio between 238 U/ 232 Th is grater than unity in the three rivers indicating that there is relative enrichment of 238 U in the surface sediments. The activity concentration of the fallout radionuclide 137 Cs is one order of magnitude lower in the White Nile sediments (0.89±0.96) Bq -1 Kg compared to values in the Blue Nile sediments (3.60±1.55) Bq -1 Kg. Comparison of the values obtained for natural radionuclides and the fallout radionuclide ( 137 Cs in the three sites with the global data reflect low and /or insignificant difference. For heavy metal
International Nuclear Information System (INIS)
Smith, C.W. Jr.; Dowd, A.S. Jr.; Hinds, S.S.; Johnson, S.V.
1994-01-01
The Savannah River Site (SRS) has been actively proceeding with the decontamination and decommissioning (D and D) of various facilities and structures which were instrumental in the success of past missions at the site. The most ambitious of these efforts involves the subcontracting of the complete D and D of the first SRS Tritium Extraction Facility, identified as building 232-F. This facility operated in the mid 1950's and discontinued operations permanently in 1958. The approach utilized for this effort attempts to invoke the novel principle of open-quotes As Commercial As Reasonably Achievableclose quotes or open-quotes ACARAclose quotes. This concept of ACARA applies only the minimum essential requirements necessary to successfully perform the D and D task. Integral to this approach is the subcontractor provision for maximum flexibility in the identification of and adherence to the requirements of applicable DOE Orders, federal, state and local laws and regulations, as well as site specific procedures without violating the site contractual requirements. The technical specification prepared for this effort provides the basis for a competitively bid contract to perform the entire D and D evolution, including initial facility characterization, waste stream characterization and certification, D and D and waste disposal. Preparation and development of this specification and the subsequent Request For Proposal (RFP) was a successful team oriented endeavor. The schedule for this fast-track undertaking took three months to complete. Successful initiation of this task will be the first D and D of a facility containing both radioactive and hazardous material at an operating site within the DOE Weapons Complex. The strategy for preparing the D and D subcontract for the 232-F structure was facilitated by applying the ACARA principle. This approach resulted in the accelerated development of the specification and RFP documents, as well as minimized the complexities of
International Nuclear Information System (INIS)
Karamyan, S.A.; Adam, J.; Belov, A.G.; Chaloun, P.; Norseev, Yu.V.; Stegajlov, V.I.
1997-01-01
Fission-fragment mass distribution has been measured by the cumulative yields of radionuclides detected in the 232 Th(γ,f)-reaction at the Bremsstrahlung endpoint energies of 12 and 24 MeV. The yield upper limits have been estimated for the light nuclei 24 Na, 28 Mg, 38 S etc. at the Th and Ta targets exposure to the 24 MeV Bremsstrahlung. The results are discussed in terms of the multimodal fission phenomena and cluster emission >from a deformed fissioning system or from a compound nucleus
Directory of Open Access Journals (Sweden)
Oliveira Luciano S.R.
2015-01-01
Full Text Available Absolute soil concentrations of 238U, 232Th, 40K, and 137Cs samples were measured using high-resolution gamma spectrometry. The area of interest encompasses an embankment in a mangrove swamp in Guaratiba, Rio de Janeiro, called Capao Island, where nuclear, chemical and biological defense laboratories of the Brazilian Army Technology Center are in operation for more than 30 years. In order to ensure that no significant environmental impact has resulted from neutron physics experiments performed in a graphite exponential pile in addition to the operation of two cesium-driven irradiating facilities, radiation monitoring of the isotopes was carried out. A total of eight 250 ml soil samples were extracted within an area of 300 m x 300 m. No trace of 137Cs was detected and the measured levels of 238U were found to be close to the global mean. However, some data that slightly exceeded the expected normal range for 232Th (60 % of samples and 40K (20 % of samples should be attributed to the construction debris (cement, rocks, and sand used in the embankment at the site. Since there is no handling of those isotopes at that site or adjacent facilities that could affect their presence, it was concluded that no detectable contamination has occurred.
Energy Technology Data Exchange (ETDEWEB)
Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Alfaro de la T, M. C., E-mail: arevalo0591@hotmail.com [Universidad Autonoma de San Luis Potosi, Dr. Salvador Nava s/n, Zona Universitaria, 78290 San Luis Potosi, SLP (Mexico)
2016-09-15
The present work deals with the methodology established for the quantification of {sup 232}Th, {sup 234}U, {sup 238}U and {sup 235}U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO{sub 3} minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of {sup 232}Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ({sup 232}Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of {sup 232}Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)
International Nuclear Information System (INIS)
Jesus, Gleyka J.D.; Chiozzini, Vitor G.; Saueia, Cátia H.R.; Nisti, Marcelo B.; Braga, Elisabete S.; Fávaro, Deborah I.T.; Universidade de São Paulo
2017-01-01
The Cananéia-Iguape estuarine-lagoon complex, located in the south of São Paulo State, Brazil, is a protected area recognized by UNESCO as part of the Biosphere Reserve, due to its importance as a natural ecosystem. However, along the years, the mining activities in the region affected the river basin, to such an extent that contamination was observed for As, Cu, Pb and Zn. Since the mining activities can also enhance the levels of natural radioactivity in the sediments, this study aimed to determine the activity concentration of the natural radionuclides (K-40, U, Ra-226, Pb-210, Th-232 and Ra-228) in 34 bottom sediments samples collected in the Cananéia-Iguape system. The samples were measured by gamma spectrometry, using a HPGe for the determination of K-40, Ra-226, Pb-210 and Ra-228. The concentration of U and Th-232 was determined by instrumental neutron activation analysis. The activity concentration of K-40 varied from 119 ± 17 to 522 ± 74 Bq kg"-"1; U-238 varied from 0.31 ± 0.05 to 5.8 ± 0.3 mg kg"-"1; Ra-226 varied from 3.7 ± 0.3 to 43.3 ± 1.5 Bq kg"-"1; Pb-210 varied from 5.8 ± 2.6 to 118 ± 12 Bq kg"-"1; Th-232 varied from 0.67 ± 0.02 to 16.6 ± 0.4 mg kg"-"1 and Ra-228 varied from 3.5 ± 0.6 to 64.9 ± 2.4 Bq kg"-"1. These results were compared with literature values for the region, indicating that they are the background of the region and no contamination was observed from NORM (Naturally Occurring Radioactive Material) industries. (author)
Energy Technology Data Exchange (ETDEWEB)
Jesus, Gleyka J.D.; Chiozzini, Vitor G.; Saueia, Cátia H.R.; Nisti, Marcelo B.; Braga, Elisabete S.; Fávaro, Deborah I.T., E-mail: gjdjesus@ipen.br, E-mail: chsaueia@ipen.br, E-mail: mbnisti@ipen.br, E-mail: defavaro@ipen.br, E-mail: vitor.chio@usp.br, E-mail: edsbraga@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Universidade de São Paulo (USP), SP (Brazil). Instituto Oceanográfico
2017-07-01
The Cananéia-Iguape estuarine-lagoon complex, located in the south of São Paulo State, Brazil, is a protected area recognized by UNESCO as part of the Biosphere Reserve, due to its importance as a natural ecosystem. However, along the years, the mining activities in the region affected the river basin, to such an extent that contamination was observed for As, Cu, Pb and Zn. Since the mining activities can also enhance the levels of natural radioactivity in the sediments, this study aimed to determine the activity concentration of the natural radionuclides (K-40, U, Ra-226, Pb-210, Th-232 and Ra-228) in 34 bottom sediments samples collected in the Cananéia-Iguape system. The samples were measured by gamma spectrometry, using a HPGe for the determination of K-40, Ra-226, Pb-210 and Ra-228. The concentration of U and Th-232 was determined by instrumental neutron activation analysis. The activity concentration of K-40 varied from 119 ± 17 to 522 ± 74 Bq kg{sup -1}; U-238 varied from 0.31 ± 0.05 to 5.8 ± 0.3 mg kg{sup -1}; Ra-226 varied from 3.7 ± 0.3 to 43.3 ± 1.5 Bq kg{sup -1}; Pb-210 varied from 5.8 ± 2.6 to 118 ± 12 Bq kg{sup -1}; Th-232 varied from 0.67 ± 0.02 to 16.6 ± 0.4 mg kg{sup -1} and Ra-228 varied from 3.5 ± 0.6 to 64.9 ± 2.4 Bq kg{sup -1}. These results were compared with literature values for the region, indicating that they are the background of the region and no contamination was observed from NORM (Naturally Occurring Radioactive Material) industries. (author)
Directory of Open Access Journals (Sweden)
Todorovik Aleksandra
2012-01-01
Full Text Available Taking into consideration the importance of the distribution and transfer of radio nuclides in soil, an attempt was made in this work to determine the concentration of 226Ra, 232Th 40К and 137Cs in the same. The concentrations of activity in the gamma-absorbed dose rates of the terrestrial naturally occurring radio nuclides, as follows, 226Ra, 232Th and 40K were determined in samples of soil collected from some parts of Republic of Macedonia, i.e. from three major cities in the Republic of Macedonia. The samples are taken by means of a special dosage dispenser which enables sampling of samples at a depth of 0-5 cm, 5-10cm and 10-15cm, thus disabling the sampling above these layers of soil. An identification of radio nuclides and assessment of their activity has been performed by applying gamma spectrometry. The time of counting for each sample was 65000 s. in order to obtain statistically small mistake. The spectrums were analyzed by a commercially available software GENIE-2000 received from Canberra, Austria. The activity of soil had wide range of values: 20.3 to 82.9 Bq kg-1for 226Ra, 16.1 to 82.5 Bq kg-1 for 232Th, 325 to 799.0 Bq kg-1for 40К and 9.1 to 24.3 Bq kg-1for 137Cs, respectively. The concentrations of these radio nuclides have been compared with the available data from the other countries. Natural environmental radioactivity and the associated external exposure due to gamma radiation depend primarily on the geological and geographical conditions. Namely, the specific levels of terrestrial environmental radiation are related to the type of rocks from which the soils originate. The obtained data indicate that the average value of activity of 232Th is about higher than the one of 226Ra The concentration of activity of 40К in the soil has greater value than 32Th and 226Ra in all soils. The causes for the existence of 137Cs in these soils are the nuclear explosions, waste radioactive materials and other incidents. It reaches the
Disentangling effects of breakup coupling and incomplete fusion in 6Li + 232Th reaction
International Nuclear Information System (INIS)
Jha, V.; Parkar, V.V.; Mohanty, A.K.; Kailas, S.
2014-01-01
A component of fusion that is very important but quite difficult to evaluate is the incomplete fusion (ICF), in which only a part of the nucleus fuses with the target. ICF occurs together with the usual complete fusion (CF), in which the whole projectile fuses or all the projectile fragments after breakup fuse with the target nucleus. The ICF leads to the flux removal from the fusion channel and its calculation is essential for a comprehensive description of the fusion process. In the present work, a recently developed method of calculating the ICF cross-section (σ ICF ) is used in a novel way to disentangle the ICF effect on the fusion process from those due to breakup couplings. The total fusion cross-section σ TF and σ ICF for the 6 Li + 232 Th system are calculated at energies above and below the Coulomb barrier, where the measured fusion-fission data is available
Daoh, M.; Masae, R. N.; Po-oh, S.; Boonkrongcheep; Kessaratikoon, P.
2017-09-01
The Specific Activities of 40K, 226Ra and 232Th were studied and determinate for 30 beach sand samples collected from Talo Kapo beach of Yaring district in Pattani province. Experimental results were obtained by using a high-purity germanium (HPGe) detector and gamma spectrometry analysis system. The IAEA-SOIL-6 reference materials obtained from the International Atomic Energy Agency were also used to analyze and compute the 40K, 226Ra and 232Th specific activity in all 30 beach sand samples. The measuring time of each sample is 10,000 seconds. It was found that specific activity range from 1805.37 - 3323.05, 40.96 - 2137.36 38.63 - 4329.28 Bq/kg for with mean values of 2242.79 ± 117.40, 250.18 ± 8.21 and 458.42 ± 7.68 Bq/kg for 40K, 226Ra and 232Th, respectively. Moreover, the results were also compared with research data in the south of Thailand, the Office of Atoms for Peace (OAP) annual report data and the recommended values which were proposed by United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR,)
Energy Technology Data Exchange (ETDEWEB)
Grosjean, C
2005-03-15
The thorium-U{sup 233} fuel cycle might provided safer and cleaner nuclear energy than the present Uranium/Pu fuelled reactors. Over the last 10 years, a vast campaign of measurements has been initiated to bring the precision of neutron data for the key nuclei (Th{sup 232}, Pa{sup 233} and U{sup 233}) at the level of those for the U-Pu cycle. This is the framework of these measurements, the energy dependent neutron induced fission cross section of Th{sup 232} and U{sup 233} has been measured from 1 to 7 MeV with a target accuracy lesser than 5 per cent. These measurements imply the accurate determination of the fission rate, the number of the target nuclei as well as the incident neutron flux impinging on the target, the latter has been obtained using the elastic scattering (n,p). The cross section of which is very well known in a large neutron energy domain ({approx} 0,5 % from 1 eV to 50 MeV) compared to the U{sup 235}(n,f) reaction. This technique has been applied for the first time to the Th{sup 232}(n,f) and U{sup 233}(n,f) cases. A Hauser-Feshbach statistical model has been developed. It consists of describing the different decay channels of the compound nucleus U{sup 234} from 0,01 to 10 MeV neutron energy. The parameters of this model were adjusted in order to reproduce the measured fission cross section of U{sup 233}. From these parameters, the cross sections from the following reactions could be extracted: inelastic scattering U{sup 233}(n,n'), radiative capture U{sup 233}(n,{gamma}) and U{sup 233}(n,2n). These cross sections are still difficult to measure by direct neutron reactions. The calculated values have allowed us to fill the lack of experimental data for the major fissile nucleus of the thorium cycle. (author)
International Nuclear Information System (INIS)
Behzens, T.W.; Ables, E.; Browne, T.C.
1982-01-01
The authors have measured the fission cross-section ratio 232 Th: 235 U as a function of neutron energy from 0.7 to 30 MeV using ionization fission chambers, the threshold cross-section method, and the time-of-flight technique at the Lawrence Livermore National Laboratory 100-MeV electron linear accelerator. The measured cross-section ratio, averaged over the neutron energy interval from 1.75 to 4.00 MeV, was 0.1086 + 0.0024
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1988-01-01
Neutron-induced fission cross section ratios for samples of /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence up to 30 MeV. These data provided the shape of the /sup 235/U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known values were determined using the neutron fluence measured with a second proton recoil telescope. Cross section values for /sup 232/Th, /sup 238/U, /sup 237/Np, and /sup 239/Pu were computed from the ratio data using our values for /sup 235/U(n,f). In addition to providing new results at high neutron energies, these data resolve long standing discrepancies among different data sets. 1 ref., 1 fig.
International Nuclear Information System (INIS)
Daoh, Murnee; Kessaratikoon, Prasong; Udomsomporn, Suchin
2011-06-01
Full text: Specific activity of natural (238 U , 232 T h, 226 R a and 40 K ) and anthropogenic radionuclide (137 C s) in 109 soil samples collected from 11 districts in Phathalung province have been measured and analyzed. Experimental results were obtained by using a high purity germanium (HPGe) detector and gamma spectrometry analysis system at Nuclear and Material Physics laboratory in Department of Physics Faculty of Science Thaksin University Songkhla Campus. Gamma ray radioactive standard sources 60 C o, 137 C s and 133 B a were used to calibrate the measurement system. The KCl and two reference materials (RGU-1 and RGTh-1) obtained from the International Atomic Energy Agency were also used to analyze and compute the 40 K , 238 U (or 226 R a) and 232 T h specific activity in all soil samples. The IAEA/SL-2 was also used to evaluate the specific activity of 137 C s in all soil samples. The measuring time of each sample was 10,800 seconds. It was found that specific activity ranged from 148.17 to 11276.78 Bq/kg for 40 K , 58.29 to 518.45 Bq/kg for 226 R a, 8.40 to 236.19 Bq/kg for 232 T h and 0.00 tp 12.39 Bq/kg for 137 C s with mean values of 3573.35 ± 203.89 Bq/kg, 135.89 ± 6.71 Bq/kg, 76.34 ± 5.32 Bq/kg and 1.05 ± 0.70 Bq/kg respectively. Furthermore, absorbed dose rate in air (D), radium equivalent activity (Ra e q), external hazard index (H e x), and annual effective dose rate (AEDout) of this area were also evaluated by using the mean values of specific activities of the 40 K , 226 R a and 232 T h. Moreover, the experimental results were also compared with Office of Atoms for Peace (OAP) research data, Thailand and global radioactivity measurement and evaluations. The radioactive contour maps of specific activities of natural and anthropogenic radionuclides from this study were created by using the program ArcGis Version 9.2
International Nuclear Information System (INIS)
Norimura, Toshiyuki; Tsuchiya, Takehiko; Hatakeyama, Satoru; Yamamoto, Hisao; Okajima, Shunzo.
1989-01-01
To estimate the absorbed dose in the critical organs of Thorotrast patients, it is necessary to know not only the distribution and concentration of 232 Th but also its daughter nuclides in the body. The present investigation was undertaken in order to clarify the long-term 232 Th tissue distribution and steady state activity ratios between subsequent daughters in the critical tissues, using about 30 Wister male rats, as a basis for estimating absorbed doses. The tissue distribution of thorium was examined by means of an autoradiographty of the whole body and/or the gamma-ray spectrometry at various times during 2 to 24 months following injection. The concentrations of daughter nuclides in tissues were determined by repetitive gamma examination over a period from 1 hr to 35 days after being sacrificed. The data indicate (1) that approximately 90% of injected Thorotrast is retained in the body for a prolonged period, but about 50% of radium and 10% of radon produced from thorium are eliminated from the body, (2) that the mean steady state activity ratios of 224 Ra and 212 Pb to 228 Th for liver are 0.56 and 0.28, and 0.54 and 0.16 for spleen, 0.58 and 0.82 for lungs, respectively, and (3) that the parent 228 Th is translocated to the bone. (author)
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Zhao, Guo; Zhong, Lei; Lu, Xinlun; Hu, Jiao; Gu, Xiaobing; Kai, Yan; Song, Qingqing; Sun, Qing; Liu, Jinbao; Peng, Daxin; Wang, Xiaoquan; Liu, Xiaowen; Liu, Xiufan
2012-02-01
In spring 2009, one strain of H5N1 clade 2.3.2 virus was isolated from wild swans in Shanghai, indicating the importance of the wild swan in the ecology of this highly pathogenic avian influenza virus (HPAIV) in Eastern China. Pathogenicity experiments conducted in this study indicated that the virus was highly pathogenic for chickens but lowly pathogenic for mammalian hosts, as evidenced by reduced infection of mice. The analysis of complete genome sequences and genetic evolution showed that A/Swan/Shanghai/10/09 (SW/SH/09) may be derived from the strain A/silky chicken/Shantou/475/2004 (CK/ST/04), which is homologous to the influenza viruses isolated from chicken, duck, pika, little egret, swan, mandarin duck and bar-headed goose in China Hunan, China Qinghai, Mongolia, Russia, Japan, Korea, Laos and Hong Kong during 2007-2011, indicating that the virus has retro-infected diverse wild birds from chicken, and significant spread of the virus is still ongoing through overlapping migratory flyways. On the basis of the molecular analysis, we also found that there was a deletion of the glycosylation site (NSS) in amino acid 156 of the hemagglutinin (HA) protein when compared with that of the other Clade 2.3.2 viruses isolated between 2007 and 2011. More importantly, the sequence analysis of SW/SH/09 virus displayed the drug-resistant mutations on the matrix protein (M2) and neuraminidase (NA) genes.
238U-234U-230Th-232Th systematics and the precise measurement of time over the past 500,000 years
International Nuclear Information System (INIS)
Edwards, R.L.; Chen, J.H.; Wasserburg, G.J.
1987-01-01
We have developed techniques to measure the 230 Th abundance in corals by isotope dilution mass spectrometry. This, coupled with our previous development of mass spectrometric techniques for 234 U and 232 Th measurement, has allowed us to reduce significantly the analytical errors in 238 U- 234 U- 230 Th dating and greatly reduce the sample size. We show that 6x10 8 atoms of 230 Th can be measured to ±30per mille (2 σ) and 2x10 10 atoms of 230 Th to ±2per mille. The time over which useful age data on corals can be obtained ranges from a few years to ≅ 500 ky. The uncertainty in age, based on analytical errors, is ±5 y(2 σ) for a 180 year old coral (3 g), ±44 y at 8294 years and ±1.1 ky at 123.1 ky (250 mg of coral). We also report 232 Th concentrations in corals (0.083-1.57 pmol/g) that are more than two orders of magnitude lower than previous values. Ages with high analytical precision were determined for several corals that grew during high sea level stands ≅ 120 ky ago. These ages lie specifically within or slightly postdate the Milankovitch insolation high at 128 ky and support the idea that the dominant cause of Pleistocene climate change is Milankovitch forcing. (orig.)
Speciation analysis of 129I, 137Cs, 232Th, 238U, 239Pu and 240Pu in environmental soil and sediment
DEFF Research Database (Denmark)
Qiao, Jixin; Hansen, Violeta; Hou, Xiaolin
2012-01-01
The environmental mobility and bioavailability of radionuclides are related to their physicochemical forms, namely species. We here present a speciation analysis of important radionuclides including 129I (also 127I), 137Cs, 232Th, 238U and plutonium isotopes (239Pu and 240Pu) in soil (IAEA-375......) and sediment (NIST-4354) standard reference materials and two fresh sediment samples from Øvre Heimdalsvatnet Lake, Norway. A modified sequential extraction protocol was used for the speciation analysis of these samples to obtain fractionation information of target radionuclides. Analytical results reveal...
Design study of Thorium-232 and Protactinium-231 based fuel for long life BWR
Energy Technology Data Exchange (ETDEWEB)
Trianti, N.; Su' ud, Z.; Riyana, E. S. [Nuclear Physics and Biophysics Research Division Department of Physics - Institut Teknologi Bandung (ITB) Jalan Ganeca 10 Bandung 40132 (Indonesia)
2012-06-06
A preliminary design study for the utilization of thorium added with {sup 231}Pa based fuel on BWR type reactor has been performed. In the previous research utilization of fuel based Thorium-232 and Uranium-233 show 10 years operation time with maximum excess-reactivity about 4.075% dk/k. To increase reactor operation time and reduce excess-reactivity below 1% dk/k, Protactinium (Pa-231) is used as Burnable Poison. Protactinium-231 has very interesting neutronic properties, which enable the core to reduce initial excess-reactivity and simultaneously increase production of {sup 233}U to {sup 231}Pa in burn-up process. Optimizations of the content of {sup 231}Pa in the core enables the BWR core to sustain long period of operation time with reasonable burn-up reactivity swing. Based on the optimization of fuel element composition (Th and Pa) in various moderation ratio we can get reactor core with longer operation time, 20 {approx} 30 years operation without fuel shuffling or refuelling, with average power densities maximum of about 35 watt/cc, and maximum excess-reactivity 0.56% dk/k.
DEFF Research Database (Denmark)
Viktrup, L.; Rortveit, G.; Lose, G.
2008-01-01
OBJECTIVE: Assess the impact of subsequent urinary incontinence risk factors in women with different urinary incontinence history. STUDY DESIGN: In a cohort study 232 women answered validated questions about urinary incontinence after the first delivery and 12 years later. Women who were continent...
International Nuclear Information System (INIS)
Santos, E.E.; Lauria, D.C.; Amaral, E.C.S.; Rochedo, E.R.
2002-01-01
The concentrations of the naturally occurring radionuclides 232 Th, 238 U, 210 Pb, 226 Ra and 228 Ra were determined in the vegetables (leafy vegetables, fruit, root, bean and rice) and derived products (sugar, coffee, manioc flour, wheat flour, corn flour and pasta) consumed most by the adult inhabitants of Rio de Janeiro City. A total of 88 samples from 26 different vegetables and derived products were analyzed. The highest contribution to radionuclide intake arises from bean, wheat flour, manioc flour, carrot, rice, tomato and potato consumption. The estimated daily intakes due to the consumption of vegetables and derived products are 1.9 mBq of 232 Th (0.47 μg), 2.0 mBq of 238 U (0.17 μg), 19 mBq of 226 Ra, 26 mBq of 210 Pb and 47 mBq of 228 Ra. The estimated annual effective dose due to the ingestion of vegetables and their derived products with the long-lived natural radionuclides is 14.5 μSv. Taking into account literature data for water and milk from Rio de Janeiro the dose value increases to 29 μSv, with vegetables and derived products responsible for 50% of the dose and water for 48%. 210 Pb (62%) and 228 Ra (24%) were found to be the main sources for internal irradiation
International Nuclear Information System (INIS)
Zhang, Jiahua
1994-01-01
In contrast with the conventional nuclear reactor which usually fuelled with on single fissile nuclide, a constellation type fissile fuels reactor consists of a parent nuclide such as 232 Th or 238 U and its whole family of neutron generated daughter nuclides. All of them are regarded as fissile fuels but of quite different fission ability. The concentration of each daughter nuclide is determined by its saturate concentration ratio with the parent nuclide. In such fuel system, the whole fuel consumed by neutron reaction almost completely results in fission products. In this article, some properties of such fuel system, determination of the saturate concentration of each daughter nuclide and applicability to Th- 233 U fueled reactor will be discussed. 3 refs., 1 tab., 2 figs
Gastelen, van S.; Visker, M.H.P.W.; Edwards, J.E.; Antunes Fernandes, E.C.; Hettinga, K.A.; Alferink, S.J.J.; Hendriks, W.H.; Bovenhuis, H.; Smidt, H.; Dijkstra, J.
2017-01-01
Complex interactions between rumen microbiota, cow genetics, and diet composition may exist. Therefore, the effect of linseed oil, DGAT1 K232A polymorphism (DGAT1), and the interaction between linseed oil and DGAT1 on CH4 and H2 emission, energy and N metabolism, lactation performance, ruminal
International Nuclear Information System (INIS)
Santos Junior, Jose Araujo dos; Amaral, Romilton dos Santos; Bezerra, Jairo Dias; Damascena, Kennedy Francys Rodrigues; Oliveira, Jose Valdez Monterazo de; Bispo, Rodrigo Cesar Bezerra; Silva, Cleomacio Miguel da; Rocha, Edilson Accioly
2011-01-01
The mobility of the radionuclides in soil depends primarily on the physic-chemical parameters. The uranium is easily oxidized in aqueous environment, which allows its characterization with higher mobility. The Thorium is practically insoluble, mainly if the environment has organic matter and sulfates. The geochemical characteristics of the rocks, associated with the weather and metamorphism produce alterations in the concentration diagrams of the natural radionuclides in different types of soil. The ratio 232 Th/ 238 U has been used as an indicator of oxidizing and reducing conditions. Th/U less than 2 suggests that the uranium is in its concentrated form abundantly when compared to the thorium. In reducing conditions, the value Th/U higher than 7 indicates a removal of the uranium. In this work it was possible to analyze the agricultural soil in the municipality of Pedra, Pernambuco, Brazil where there are uranium anomaly and thorium in rocky outcrops. Sixty-two samples of the horizon C soil were collected, in an area of 2 km 2 , where the main uranium occurrences are located. The analyses were done by High-Resolution Gamma-Spectroscopy. In the analyses the secular equilibrium was assumed and the 238 U and the 232 Th specific activities were used to estimate the oxidizing and reducing conditions defining the uranium mobility in the soil. The obtained findings show that the ratio Th/U varied from 0.3 to 13.4, with average of 4.6. The biggest 238 U fraction was fix (80.3%), with low mobility; the smallest fraction concentrated (6.6%) and a lixiviated intermediate fraction (13.1%). (author)
Distribution of nuclear charge in the proton-induced fission of Th-232
Energy Technology Data Exchange (ETDEWEB)
Pate, B D [Brookhaven National Laboratory, Upton, New York (United States); Foster, J S; Yaffe, L [McGill Univ., Montreal, Quebec (Canada)
1958-09-15
A great deal of work has been done on the distribution of nuclear mass in the fission process. About the nuclear charge distribution less is known. Data exist on the distribution from the fission of U-235 with thermal neutrons and with 14 Mev neutrons. Data also exist for the fission of uranium by 170 Mev protons, of bismuth by 190 Mev deuterons, and of uranium, thorium and bismuth by 480 Mev protons, and there is fragmentary information from other systems. The present work was undertaken to investigate the changes that occur in the charge distribution from proton-induced fission of Th-232 as the bombarding energy is raised from 8 to 90 Mev, the maximum proton energy of the McGill synchrocyclotron. This energy range is of interest in view of the substantial changes observed in the mass distribution. Also in this interval a change presumably begins in the nature of the initial step in nuclear reactions, from simple compound-nucleus formation, to a mechanism of direct interaction with individual nucleons. Thus at the lower energies studied, excitation of the nuclei at the end of the first step of the reaction will be essentially monochromatic whereas at the higher end of the bombarding-energy range, a broad spectrum of excitation energies will be produced, with corresponding complexity of the reaction products observed. (author)
Amelia, Afritha; Julham; Viyata Sundawa, Bakti; Pardede, Morlan; Sutrisno, Wiwinta; Rusdi, Muhammad
2017-09-01
RS232 of serial communication is the communication system in the computer and microcontroller. This communication was studied in Department of Electrical Engineering and Department of Computer Engineering and Informatics Department at Politeknik Negeri Medan. Recently, an application of simulation was installed on the computer which used for teaching and learning process. The drawback of this system is not useful for communication method between learner and trainer. Therefore, this study was created method of 10 stage to which divided into 7 stages and 3 major phases. It can be namely the analysis of potential problems and data collection, trainer design, and empirical testing and revision. After that, the trainer and module were tested in order to get feedback from the learner. The result showed that 70.10% of feedback which wide reasonable from the learner of questionnaire.
International Nuclear Information System (INIS)
Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Alfaro de la T, M. C.
2016-09-01
The present work deals with the methodology established for the quantification of "2"3"2Th, "2"3"4U, "2"3"8U and "2"3"5U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO_3 minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of "2"3"2Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ("2"3"2Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of "2"3"2Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)
Radio continuum observations of the quasar-galaxy pair 3C 232-NGC 3067
International Nuclear Information System (INIS)
Haxthausen, E.; Carilli, C.; Vangorkom, J.H.
1990-01-01
The quasar-galaxy pair 3C 232-NGC 3067 is well known to show absorption by gas associated with the foreground galaxy against the background quasar (see Stocke et al. this volume). Observations by Carilli, van Gorkom, and Stocke (Nature 338, 134, 1989) found that the absorbing gas is located in a long tail of gas which extends from the galaxy toward the quasar and beyond (in projection). Though the HI observations of NGC 3067 indicate that the galaxy has been severely disturbed, there is no obvious candidate in the field which could cause such a disturbance, leading to the conclusion that the system has undergone a recent merger. The radio continuum observations of this system were designed to study the nature of this highly disturbed galaxy. New continuum observations confirm the notion that NGC 3067 is a highly disturbed system, and, in particular, the notion that the western half of the galaxy extends only 1/2 as far in radius as the eastern half. This disturbance must have occurred recently, since the galactic rotation would smooth out the observed asymmetry in about 10(exp 8) years. Researchers are left with the problem that there are no obvious candidates which could have caused such a disturbance
Dermoscopy of Pigmented Actinic Keratosis of the Face: A Study of 232 Cases.
Kelati, A; Baybay, H; Moscarella, E; Argenziano, G; Gallouj, S; Mernissi, F Z
2017-11-01
The diagnosis of pigmented actinic keratosis (PAK) is often challenging because of overlapping features with lentigo maligna. To investigate dermoscopic patterns of PAK according to their different evolutionary stages, and to correlate the pattern with clinical characteristics of the patients. Descriptive and analytical study of 232 PAK. Dermoscopic patterns were divided into two categories: the follicule surroundings' abnormalities (FSA) and follicular keratosis' abnormalities (FKA). FSA and FKA dermoscopic patterns were related to male gender, except for star-like appearance, double white clods and dermoscopic horn (p≤0.04). Rhomboidal, annular granular pattern, gray halo, white circle and double clods were dermoscopic pattern significantly related to xeroderma pigmentosum's type of skin. Based on the evolutionary stages of PAK, the jelly sign was significantly related to thin patches of PAK. Central crusts and scales were related to thick plaques and the star-like appearance to hypertrophic PAK. The presence of 2 or more dermoscopic signs in both FSA and FKA was noticed in 99.1% of lesions. The dermoscopic diagnosis of PAK vary according to the evolutionary stages of the disease, this will increase the diagnosis accuracy, with therapeutic implications. Copyright © 2017 AEDV. Publicado por Elsevier España, S.L.U. All rights reserved.
Delayed neutron kinetic functions for /sup 232/Th and /sup 238/U mixtures
Energy Technology Data Exchange (ETDEWEB)
Ganich, P P; Goshovskij, M V; Lendel, A I; Lomonosov, V I; Sikora, D I; Sychev, S I
1984-11-01
In order to investigate the applicability of the method based on using kinetic functions, describing the emission of delayed neutrons by samples for determination of the content of fissionable nuclides in binary mixtures, the /sup 232/Th+/sup 238/U mixtures have been analyzed with the M-30 microtron. Fresh samples containing ThO/sub 2/, U/sub 3/O/sub 8/ and their mixtures are irradiated by bremstrahlung at the 15.5 MeV energy of accelerated electrons and 9 ..mu..A average current. The mass of samples is about 6 g. To determine the kinetic functions, temporal distributions of delayed neutron pulses are used, their maximum number for different samples being (1.7-3.0) x 10/sup 4/. In processing the data obtained two methods of normalization of the delayed neutron number in the kinetic functions are used: to the total yield of delayed neutrons and to the yield of /sup 133/I ..gamma..-quanta. The conclusion is drawn that the method investigated permits to determine relative /sup 238/U concentrations in the mixtures considered with 0.06-0.2 errors. Error reduction is achieved during the normalization of the number of delayed neutrons to the yield of /sup 130/I ..gamma..-quanta.
International Nuclear Information System (INIS)
Hess, A.L.
1995-01-01
This Criticality Safety Evaluation Report addendum extends the coverage of the original CSER (90-006) about dismantling the ductwork in 232-Z to include cleanout of the Scrubber Glovebox, with an estimated residual Pu holdup of less than 200 grams. For conservatism and containment considerations, the provisions about waste packaging and water exclusion from the original work are retained, even though it is not credible for the Scrubber Pu content to be made critical with water added (NDA gives about 1/3 a minimum critical mass)
International Nuclear Information System (INIS)
Egan, J.J.; Menachery, J.D.; Kegel, G.H.R.; Pullen, D.J.
1980-01-01
The /sup 232/Th(n,n/prime/sub gamma/) reaction has been studied up to 2.1 MeV bombarding energy for states with excitation energies from 700 to 1700 keV. Seventy-five gamma-ray transitions from forty-three above the first excited state have been observed from a disk scatterer with a 40-cm/sup 3/ Ge(Li) detector surrounded by an anti-Compton annulus of NaI(Tl). The time-of-flight technique was employed to further reduce background. Cross sections for twenty-two states are reported here. The data have been corrected for the finite sample effects of neutron and gamma-ray attenuation, and neutron multiple scattering. The results are compared to those of McMurray et al. and to the predictions of the compound nucleus statistical model. A compound nucleus plus direct interaction calculation is also shown for the 1/sup -/ state at 714 kev. 7 refs
Energy Technology Data Exchange (ETDEWEB)
Vapirev, E; Jordanov, T; Khristoskov, I [Sofia Univ. (Bulgaria). Fizicheski Fakultet
1996-12-31
The possibility of using highly enriched uranium available from military inventories for production of mixed oxide fuel (MOX) has been proposed. The fuel is based on U-235 dioxide as fissile isotope and Th-232 dioxide as a non-fissile isotope. It is shown that although the fuel conversion coefficient to U-233 is expected to be less than 1, the proposed fuel has several important advantages resulting in cost reduction of the nuclear fuel cycle. The expected properties of MOX fuel (cross-sections, generated chains, delayed neutrons) are estimated. Due to fuel generation the initial enrichment is expected to be 1% less for production of the same energy. In contrast to traditional fuel no long living actinides are generated which reduces the disposal and reprocessing cost. 7 refs.
Saleh, Muneer Aziz; Ramli, Ahmad Termizi; Alajerami, Yasser; Aliyu, Abubakar Sadiq
2013-10-01
Extensive environmental survey and measurements of gamma radioactivity in the soil samples collected from Segamat District were conducted. Two gamma detectors were used for the measurements of background radiation in the area and the results were used in the computation of the mean external radiation dose rate and mean weighted dose rate, which are 276 nGy h(-1) and 1.169 mSv y(-1), respectively. A high purity germanium (HPGe) detector was used in the assessment of activity concentrations of (232)Th, (226)Ra and (40)K. The results of the gamma spectrometry range from 11 ± 1 to 1210 ± 41 Bq kg(-1) for (232)Th, 12 ± 1 to 968 ± 27 Bq kg(-1) for (226)Ra, and 12 ± 2 to 2450 ± 86 Bq kg(-1) for (40)K. Gross alpha and gross beta activity concentrations range from 170 ± 50 to 4360 ± 170 Bq kg(-1) and 70 ± 20 to 4690 ± 90 Bq kg(-1), respectively. These results were used in the plotting of digital maps (using ARCGIS 9.3) for isodose. The results are compared with values giving in UNSCEAR 2000. Copyright © 2013 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Zare, Mohammad Reza; Mostajaboddavati, Mojtaba; Kamali, Mahdi; Abdi, Mohammad Reza; Mortazavi, Mohammad Seddigh
2012-01-01
The natural radioactivity levels in sediment samples of the northern coast of Oman Sea, covering the coastal strip from Hormoz canyon to Goatr seaport, as the first time has been determined. The results of measurements will serve as background reference level for Oman Sea coastlines. Sediments from 36 coastal and near shore locations were collected for analysis. Analysis on the collected samples were carried out to determine 235 U, 238 U, 232 Th, 40 K and 137 Cs using two high purity germanium detectors with 38.5% and 55% relative efficiencies. The concentration of 235 U, 238 U, 232 Th, 40 K and 137 Cs in sediment samples ranged between 1.01 and 2.87 Bq/kg, 11.83 and 22.68 Bq/kg, 10.7 and 25.02 Bq/kg, 222.89 and 535.07 Bq/kg and 0.14 and 2.8 Bq/kg, respectively. The radium equivalent activity was well below the defined limit of 370 Bq/kg. The external hazard indices were found to be less than 1, indicating a low dose.
International Nuclear Information System (INIS)
Ladeira, Paula C.; Alves, Rex Nazare; Ruperti Junior, Nerbe J.
2011-01-01
The industrial-mining facilities constantly produce, in Brazil and in abroad, wastes from its production, many times containing uranium and/or thorium associated. Due to the large quantities generated, these wastes are usually deposited at the site of the facility, close to the place where they were produced. Since the chains of radioactive U 238 and Th 232 with alpha-emitting radionuclides have long half-life, waste deposits associated with these elements may cause radiological impact on the man and on the environment, even in the long term. Mathematical models are often used to represent the biosphere and the transport of radionuclides near to the surface. Thus, it was decided, through the software M athematica , to present a methodology based on the solution of Bateman equations for the calculation of radiological impact on individuals from the public exposed to contamination. The radiological impact appraisal was carried out considering a scenario of intrusion into landfills containing U 238 and / or Th 232 in post-operational phase of an industrial-mining installation. The critical group examined was represented by farmers who used water from an artesian well for daily consumption and which feed themselves on vegetables locally grown in clay soil. As a result, there was the exposure in pathways evaluated, a minor contribution of dose for ingestion of contaminated water. The conclusion of this work, show us that calculated doses were within the accepted international limits for the intrusion scenario. Parameters associated with mathematical models defining the choice of project to build a landfill for the purpose of deposition, whereas rates of doses can be estimated in each of the scenarios proposed. (author)
Energy Technology Data Exchange (ETDEWEB)
Aerts, G
2005-09-01
Within the context of nuclear power as a sustainable energy resource, a program of research is concentrated on a new nuclear fuel cycle based on thorium. The main advantage, as compared to the uranium cycle, is a lower production of minor actinides, of which the radiological impact on the long term constitutes a problem. At present, nuclear data libraries don't provide cross sections of a good enough quality, allowing more realistic calculations from simulations related to these reactors. The {sup 232}Th neutron capture cross section is an example. With the n-TOF collaboration, the measurement of this reaction was achieved in 2002 using two C{sub 6}D{sub 6} detectors. The experimental area located at CERN, is characterized by an outstanding neutron energy resolution coupled to a high instantaneous neutron flux. The determination of the gamma-ray cascade detection efficiency, with a random behaviour, has been obtained by the use of weighting functions. These were deduced from Monte Carlo simulations with the code MCNP. Data extraction, reduction, and the description of the neutron flux have lead to the capture yield. In the resolved resonance region, the resonance parameters describing the cross section were deduced with the code SAMMY, using the R-matrix theory. In the unresolved resonance region, an uncertainty of 3,5% is found, and a comparison with recent measurements shows a good agreement. (author)
Rare-gas yields in 238U and 232Th fission by 14MeV neutrons, measured by an emanating method
International Nuclear Information System (INIS)
Feu Alvim, C.A.; Bocquet, J.P.; Brissot, R.; Crancon, J.; Moussa, A.
1977-01-01
A direct method, using emanation of rare gases by uranyle stearate and thorium stearate, has been applied to the measurement of cumulative fractional yields of certain isotopes of krypton and xenon, in the fissions of 238 U and 232 Th by 14MeV-neutrons. The independent yields of the same isotopes were measured previously by means of isotopic on-line separation. From these results, the widths of the mass and charge distributions, the relative chain yields, the fractional cumulative yields of certain bromine and iodine isotopes, the values of Zsub(p) the most probable charge, in the isobaric chains 87-93 and 137-142, and the elemental yields of krypton and xenon were calculated [fr
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
International Nuclear Information System (INIS)
Oliveira, Luciano S.R.; Oliveira, Celio J.V.; Vilela, Paulo R.T.; Vital, Helio C.
2013-01-01
Absolute soil concentrations of U-238, Th-232, K-40 and Cs-137 samples collected from Capao Island have been measured by using Hi-Resolution Gamma HPGe Spectrometry. The area of interest encompasses an embankment in a mangrove swamp in Guaratiba, Rio de Janeiro, where nuclear, chemical and biological defense laboratories of the Brazilian Army Technology Center (CTEx) are located. In order to ensure that no significant environmental impact has resulted from neutron physics experiments performed in a graphite subcritical assembly in addition to the operation of two cesium-driven irradiating facilities, routine monitoring of those isotopes have been regularly performed. A total of eight 250 ml samples of mangrove and embankment soils were extracted from four sites of known coordinates within an area of 300 x 300 m 2 and remained stored for a minimum thirty-day period to allow equilibrium to be reached. Collection and preparation of samples were made according to previously established procedures. High purity germanium detectors were used to obtain high-resolution gamma spectra and counting times were required to exceed 30 hours in order to yield sufficient statistical accuracy. Energy and efficiency calibration curves of the counting system were determined by using the GENIE 2000 software for analysis of the gamma spectrum generated by nine standard sources with a total of 11 peak energies ranging from 0.05 to 1.3 MeV. The results, corrected for background, have been expressed as absolute specific activities. All experiments have been made in the Laboratory for Identification of Radiological Agents (LIAR) at CTEx. No trace of cesium-137 has been found and the measured levels of uranium-238, in the order of 10 Bq/kg, are close to the global mean. However, some data have been found to slightly exceed the expected normal range for thorium-232 (60% of samples) and potassium-40 (20% of samples). Since there is no handling of those isotopes in the site or others that could
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Luciano S.R.; Oliveira, Celio J.V.; Vilela, Paulo R.T.; Vital, Helio C., E-mail: vital@ctex.eb.br [Centro Tecnologico do Exercito (DDQBN/CTEX), Rio de Janeiro, RJ (Brazil). Div. de Defesa Quimica, Biologica e Nuclear. Secao de Defesa Nuclear
2013-07-01
Absolute soil concentrations of U-238, Th-232, K-40 and Cs-137 samples collected from Capao Island have been measured by using Hi-Resolution Gamma HPGe Spectrometry. The area of interest encompasses an embankment in a mangrove swamp in Guaratiba, Rio de Janeiro, where nuclear, chemical and biological defense laboratories of the Brazilian Army Technology Center (CTEx) are located. In order to ensure that no significant environmental impact has resulted from neutron physics experiments performed in a graphite subcritical assembly in addition to the operation of two cesium-driven irradiating facilities, routine monitoring of those isotopes have been regularly performed. A total of eight 250 ml samples of mangrove and embankment soils were extracted from four sites of known coordinates within an area of 300 x 300 m{sup 2} and remained stored for a minimum thirty-day period to allow equilibrium to be reached. Collection and preparation of samples were made according to previously established procedures. High purity germanium detectors were used to obtain high-resolution gamma spectra and counting times were required to exceed 30 hours in order to yield sufficient statistical accuracy. Energy and efficiency calibration curves of the counting system were determined by using the GENIE 2000 software for analysis of the gamma spectrum generated by nine standard sources with a total of 11 peak energies ranging from 0.05 to 1.3 MeV. The results, corrected for background, have been expressed as absolute specific activities. All experiments have been made in the Laboratory for Identification of Radiological Agents (LIAR) at CTEx. No trace of cesium-137 has been found and the measured levels of uranium-238, in the order of 10 Bq/kg, are close to the global mean. However, some data have been found to slightly exceed the expected normal range for thorium-232 (60% of samples) and potassium-40 (20% of samples). Since there is no handling of those isotopes in the site or others that
Resolution of USQ regarding source term in the 232-Z Waste Incinerator Building
International Nuclear Information System (INIS)
Westsik, G.A.
1995-09-01
The 232-Z Waste Incinerator at the Hanford Plutonium Finishing Plant (PFP) was used to incinerate plutonium-bearing combustible materials generated during normal plant operations. Nondestructive (NDA) measurements performed after the incinerator ceased operations indicated high plutonium loadings in exhaust ductwork near the incinerator glovebox, while the incinerator was found to have only low quantities. Measurements, following a campaign to remove some of the ductwork, resulted in markedly higher assay value for the incinerator glovebox itself. Subsequent assays confirmed the most recent results and pointed to a potential further underestimation of the holdup, in part because of attenuation due to fire brick, which could not be seen easily and which had been reported to not be present. NaI detector based measurements were used to map the deposits. Extended count times, using high resolution Ge detectors helped estimate the isotopic composition of the plutonium and quantify the deposits. Experiments were performed using a Ge detector to obtain adequate corrections for the high attenuation of the incinerator glovebox. Several neutron detectors and detector configurations were employed to understand and quantify the neutron flux. Due to the disparity that was anticipated to occur between the gamma ray and neutron assay results, radiation modeling was used to try to reconcile the divergent results. This was a third aspect of the team's effort, utilizing computer modeling to resolve discrepancies between measurement methods
International Nuclear Information System (INIS)
Dantas, Bernardo Maranhao
1993-08-01
Thorium-232 is the parent of one of the naturally occurring decay series and is widely spread on the earth's crust, being also present in higher concentrations at some deposits located mainly in Brazil and India. The occupational exposure to this radionuclide may occur in several steps of the thorium cycle. In Brazil, there is a large number of workers that should be monitored because they manipulate directly or indirectly different kinds of ores, raw materials and products containing significant amounts of thorium in its composition. In this study, the techniques developed specifically for the in vivo and in vitro monitoring of these workers are presented together with the application of these techniques to a group of selected workers classified as occupationally exposed. It is also presented the methodology by which the results obtained with these measurements are interpreted with the objective of identifying the main pathways of incorporation and reducing the internal doses to values as low as reasonably achievable. (author)
Th{sup 232} (n,2n) Th{sup 231} cross section from threshold to 20.4 Mev
Energy Technology Data Exchange (ETDEWEB)
Butler, J P; Santry, D C
1961-07-01
The excitation curve for the reaction Th{sup 232} (n,2n) Th{sup 231} has been measured by the activation method from the threshold energy, 6.34 Mev, to 20.4 Mev, relative to the known cross section for the S{sup 32} (n, p) P{sup 32} reaction. Monoenergetic neutrons were obtained from the D (d,n) He{sup 3} and T (d,n) He{sup 4} reactions employing a Tandem Van de Graaff accelerator. From threshold to 9.0 Mev, the (n,2n) cross section rises rapidly, reaching its maximum value of 1.88 {+-} 0.09 barns in the region of 9.5 to 11.0 Mev. Above 11.5 Mev the (n,2n) cross section decreases due to competition of the (n,3n) and (n,2nf) reactions and at 20.4 Mev it has a value of 0.22{sub 5} {+-} 0.01{sub 5} barns. (author)
Identification of ensuremath J^{π = 19/2^+} and ensuremath 23/2^+ isomeric states in 127Sb
Watanabe, H.; Lane, G. J.; Dracoulis, G. D.; Byrne, A. P.; Nieminen, P.; Kondev, F. G.; Ogawa, K.; Carpenter, M. P.; Janssens, R. V. F.; Lauritsen, T.; Seweryniak, D.; Zhu, S.; Chowdhury, P.
2009-11-01
The nucleus ensuremath ^{127Sb} , which is on the neutron-rich periphery of the ensuremath β -stability region, has been populated in complex nuclear reactions involving deep-inelastic and fusion-fission processes with ensuremath {^{136}Xe} beams incident on thick targets. The previously known isomer at 2325 keV in ensuremath {^{127}Sb} has been assigned spin and parity ensuremath 23/2^+ , based on the measured ensuremath γ - ensuremath γ angular correlations and total internal conversion coefficients. The half-life has been determined to be 234(12) ns, somewhat longer than the value reported previously. The 2194 keV state has been assigned ensuremath J^{π} = 19/2^+ and identified as an isomer with ensuremath T_{1/2} = 14(1) ns , decaying by two ensuremath E2 branches. The observed level energies and transition strengths are compared with the predictions of a shell model calculation. Two ensuremath 15/2^+ states have been identified close in energy, and their properties are discussed in terms of mixing between vibrational and three-quasiparticle configurations.
232Th and 238U neutron emission cross section calculations and analysis of experimental data
International Nuclear Information System (INIS)
Tel, E.
2004-01-01
In this study, pre-equilibrium neutron-emission spectra produced by (n,xn) reactions on nuclei 2 32Th and 2 38U have been calculated. Angle-integrated cross sections in neutron induced reactions on targets 2 32Th and 2 38U have been calculated at the bombarding energies up to 18 MeV. We have investigated multiple pre-equilibrium matrix element constant from internal transition for 2 32Th (n,xn) neutron emission spectra. In the calculations, the geometry dependent hybrid model and the cascade exciton model including the effects of pre-equilibrium have been used. In addition, we have described how multiple pre-equilibrium emissions can be included in the Feshbach-Kerman-Koonin (FKK) fully quantum-mechanical theory. By analyzing (n,xn) reaction on 232 T h and 2 38U, with the incident energy from 2 Me V to 18 Me V, the importance of multiple pre-equilibrium emission can be seen cleady. All calculated results have been compared with experimental data. The obtained results have been discussed and compared with the available experimental data and found agreement with each other
International Nuclear Information System (INIS)
Kumar, Abhijeet; Rajpal, Rachana; Pujara, Harshad; Mandaliya, Hitesh; Edappala, Praveenalal
2016-01-01
Highlights: • We have designed Universal Interface on Zynq"® SoC with CAN, RS-232, Ethernet and AXI GPIO for Instrumentation & Control. This project is based on Zynq"®-7000 family xc7z020clg484-1 chip. • We explored the full design flow starting from the hardware development in Vivado to software development in SDK using APIs in C language and then interfacing the host application developed in LabVIEW. • We also explored how to make custom IP with AXI bus interface in Vivado. • Useful for those who wants to make custom hardware on Zynq"® SoC. - Abstract: This paper describes an application developed on the latest Zynq"®-7000 All Programmable SoC (AP SoC) [1] devices which integrate the software programmability of an ARM"®-based processor with the hardware programmability of an FPGA, on a single device. In this paper we have implemented application which uses various interfaces like CAN, RS-232, Ethernet and AXI GPIO, so that our host application running on PC in LabVIEW can communicates with any hardware which has at least any one of the available interface. Zynq-7000 All Programmable SoCs (System On Chip) infuse customizable intelligence into today’s embedded systems to suit your unique application requirements. This family of FPGA is meant for high end application because it has huge resources on single chip. It offers you to make your own custom hardware IP, in fact we have made our custom IP called myIP in our design. The beauty of this chip is that it can write drivers for your custom IP which has AXI bus layer attached. After exporting the hardware information to the Software Development Kit (SDK), the tool is able to write drivers for your custom IP. This simplifies your development to a great extent. In a way this application provides the universal interfacing option to user. User can also write the digital data on the GPIO (General Purpose Input Output) through LabVIEW Test application GUI. This project can be used for remote control and
International Nuclear Information System (INIS)
Mehra, Rohit; Singh, Surinder
2008-01-01
The activity concentrations of soil samples collected from different locations of Ludhiana and Patiala districts of Punjab were determined by using HPGe detector based on high-resolution gamma spectrometry system. The range of activity concentrations of 226 Ra, 232 Th and 40 K in the soil from the studied areas varies from 23.32 Bq kg -1 to 43.64 Bq kg -1 , 104.23 Bq kg -1 to 148.21 Bq kg -1 and 289.83 Bq kg -1 to 394.41 Bq kg -1 with overall mean values of 32 Bq kg -1 , 126 Bq kg -1 and 348 Bq kg -1 respectively. The absorbed dose rate calculated from activity concentration of 226 Ra, 232 Th and 40 K ranges between 10.75 and 20.12, 64.93 and 92.33, and 11.99 and 16.32 n Gy h -1 , respectively. The total absorbed dose in the study area ranges from 91.35 n Gy h -1 to 119.76 n Gy h -1 with an average value of 107.97 n Gy h -1 . The calculated values of external hazard index (H ex ) for the soil samples of the study area range from 0.55 to 0.72. Since these values are lower than unity, therefore, according to the Radiation Protection 112 (European Commission, 1999) report, soil from these regions is safe and can be used as a construction material without posing any significant radiological threat to population. The concentration of 232 Th in soil samples of Malwa region of Punjab are higher than the world figures reported in UNSCEAR (2000). However, the concentrations for 226 Ra is very much comparable and concentration of 40 K are lower than world figures. The results obtained have shown that the indoor and outdoor effective dose due to natural radioactivity of soil samples is lower than the average national and world recommended value of 1.0 mSv.Y -1 . These values reported for radium content in soils of study area are generally low as compared to the values reported for radium concentration in soils of Himachal Pradesh. (author)
Measurement of {sup 232}Th(n, 5nγ) cross sections from 29 MeV to 42 MeV
Energy Technology Data Exchange (ETDEWEB)
Kerveno, M.; Baumann, P.; Dessagne, P.; Rudolf, G. [Universite de Strasbourg, IPHC, Strasbourg (France); CNRS, UMR7178, Strasbourg (France); Nolte, R.; Reginatto, M. [Physikalisch-Technische Bundesanstalt, Braunschweig (Germany); Jericha, E. [Technische Universitaet Wien, Atominstitut, Wien (Austria); Jokic, S.; Lukic, S. [Vinca Institute of Nuclear Sciences, Belgrade (Serbia); Koning, A.J. [Nuclear Research and Consultancy Group, Petten (Netherlands); Meulders, J.P. [Institut de Physique Nucleaire, Louvain-la-Neuve (Belgium); Nachab, A. [Universite Cadi Ayyad, Departement de physique, Faculte Poly-disciplinaire de Safi, Safi (Morocco); Pavlik, A. [Faculty of Physics, University of Vienna, Wien (Austria)
2014-10-15
The excitation function of the reaction {sup 232} Th(n, 5nγ){sup 228} Th from 29 to 42 MeV has been measured for the first time at the quasi-monoenergetic neutron beam of the UCL cyclotron CYCLONE employing the {sup 7}Li(p,n) source reaction. Taking advantage of the good energy resolution of the planar High-Purity Germanium (HPGe) detectors, prompt γ-ray spectroscopy was used to detect the γ-rays resulting from the decay of excited states of nuclei created by the (n,xn) reactions. The neutron beam was characterized by a combination of time of flight measurements carried out using a liquid scintillation detector and a {sup 238}U fission ionization chamber. Fluence measurements were performed using a proton recoil telescope. The results are compared with TALYS-1.4 code calculations. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ladeira, Paula C.; Alves, Rex Nazare, E-mail: rexnazare@ime.eb.b [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil); Ruperti Junior, Nerbe J., E-mail: nruperti@cnen.gov.b [Comissao Nacional de Energia Nuclear (DIREJ/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Div. de Rejeitos Radioativos
2011-07-01
The industrial-mining facilities constantly produce, in Brazil and in abroad, wastes from its production, many times containing uranium and/or thorium associated. Due to the large quantities generated, these wastes are usually deposited at the site of the facility, close to the place where they were produced. Since the chains of radioactive U{sup 238} and Th{sup 232} with alpha-emitting radionuclides have long half-life, waste deposits associated with these elements may cause radiological impact on the man and on the environment, even in the long term. Mathematical models are often used to represent the biosphere and the transport of radionuclides near to the surface. Thus, it was decided, through the software {sup M}athematica{sup ,} to present a methodology based on the solution of Bateman equations for the calculation of radiological impact on individuals from the public exposed to contamination. The radiological impact appraisal was carried out considering a scenario of intrusion into landfills containing U{sup 238} and / or Th{sup 232} in post-operational phase of an industrial-mining installation. The critical group examined was represented by farmers who used water from an artesian well for daily consumption and which feed themselves on vegetables locally grown in clay soil. As a result, there was the exposure in pathways evaluated, a minor contribution of dose for ingestion of contaminated water. The conclusion of this work, show us that calculated doses were within the accepted international limits for the intrusion scenario. Parameters associated with mathematical models defining the choice of project to build a landfill for the purpose of deposition, whereas rates of doses can be estimated in each of the scenarios proposed. (author)
International Nuclear Information System (INIS)
Lopes, J.M.; Garcêz, R.W.D.; Silva, A.X.
2017-01-01
This work presents an analysis of specific concentrations of 40 K, 226 Ra, 228 Ra and 232 Th in some vegetables that are part of the diet of the population of the state of Rio de Janeiro. Furthermore, was analyzed the concentrations of radionuclides in the same coating tissue that compose the vegetables. It can notice an increase of the specific concentration of 40 K in the peels of vegetables that have little or no contact with the ground. Among the samples examined, only the pumpkin showed measurable amount of 137 Cs both saves and in the skin. (author)
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
Energy Technology Data Exchange (ETDEWEB)
Kumar, Abhijeet, E-mail: akumar@ipr.res.in; Rajpal, Rachana; Pujara, Harshad; Mandaliya, Hitesh; Edappala, Praveenalal
2016-11-15
Highlights: • We have designed Universal Interface on Zynq{sup ®} SoC with CAN, RS-232, Ethernet and AXI GPIO for Instrumentation & Control. This project is based on Zynq{sup ®}-7000 family xc7z020clg484-1 chip. • We explored the full design flow starting from the hardware development in Vivado to software development in SDK using APIs in C language and then interfacing the host application developed in LabVIEW. • We also explored how to make custom IP with AXI bus interface in Vivado. • Useful for those who wants to make custom hardware on Zynq{sup ®} SoC. - Abstract: This paper describes an application developed on the latest Zynq{sup ®}-7000 All Programmable SoC (AP SoC) [1] devices which integrate the software programmability of an ARM{sup ®}-based processor with the hardware programmability of an FPGA, on a single device. In this paper we have implemented application which uses various interfaces like CAN, RS-232, Ethernet and AXI GPIO, so that our host application running on PC in LabVIEW can communicates with any hardware which has at least any one of the available interface. Zynq-7000 All Programmable SoCs (System On Chip) infuse customizable intelligence into today’s embedded systems to suit your unique application requirements. This family of FPGA is meant for high end application because it has huge resources on single chip. It offers you to make your own custom hardware IP, in fact we have made our custom IP called myIP in our design. The beauty of this chip is that it can write drivers for your custom IP which has AXI bus layer attached. After exporting the hardware information to the Software Development Kit (SDK), the tool is able to write drivers for your custom IP. This simplifies your development to a great extent. In a way this application provides the universal interfacing option to user. User can also write the digital data on the GPIO (General Purpose Input Output) through LabVIEW Test application GUI. This project can be used
Landsberger, S; Sharp, A; Wang, S; Pontikes, Y; Tkaczyk, A H
2017-07-01
This study employs thermal and epithermal neutron activation analysis (NAA) to quantitatively and specifically determine absorption dose rates to various body parts from uranium, thorium and potassium. Specifically, a case study of bauxite residue (red mud) from an industrial facility was used to demonstrate the feasibility of the NAA approach for radiological safety assessment, using small sample sizes to ascertain the activities of 235 U, 238 U, 232 Th and 40 K. This proof-of-concept was shown to produce reliable results and a similar approach could be used for quantitative assessment of other samples with possible radiological significance. 238 U and 232 Th were determined by epithermal and thermal neutron activation analysis, respectively. 235 U was determined based on the known isotopic ratio of 238 U/ 235 U. 40 K was also determined using epithermal neutron activation analysis to measure total potassium content and then subtracting its isotopic contribution. Furthermore, the work demonstrates the application of Monte Carlo Neutral-Particle (MCNP) simulations to estimate the radiation dose from large quantities of red mud, to assure the safety of humans and the surrounding environment. Phantoms were employed to observe the dose distribution throughout the human body demonstrating radiation effects on each individual organ. Copyright © 2016 Elsevier Ltd. All rights reserved.
A DFT study on the structures and electronic states of zinc cluster Znn (n = 2-32)
International Nuclear Information System (INIS)
Iokibe, Kei; Tachikawa, Hiroto; Azumi, Kazuhisa
2007-01-01
Ab-initio and density functional theory (DFT) calculations have been carried out for zinc clusters Zn n (n = 2-32, n is the number of atoms to form a cluster) to elucidate the structure and electronic charge states of the clusters and the mechanism of clustering. The binding energies of Zn atoms were negligibly small at n = 2-3, whereas the energy increased significantly at n = 4 (the first transition). The second transition occurred at n = 8-16. In the larger clusters (n = 16-32), the binding energy increased slightly with increasing cluster size (n). The cluster size dependence of the binding energy and bond length between zinc atoms agreed well with that of the natural population of electrons in the 4p orbital of the zinc atom. In the larger clusters (n > 20), it was found that the zinc atoms in the surface region of the cluster have a positive charge, whereas those in the interior region have a negative charge with a large population in the 4p orbital. The formation mechanism of zinc clusters was discussed on the basis of the theoretical results
Energy Technology Data Exchange (ETDEWEB)
Reyss, J.L. [Laboratoire des Sciences du Climat et de l' Environnement - LSCE/IPSL, Unite Mixte de Recherche 8212 CEA, CNRS, UVSQ, F-91198 Gif-sur-Yvette Cedex (France); Mangeret, A.; Courbet, C.; Saadi, Z.; Guillevic, J. [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP 17, 92262 Fontenay aux Roses (France); Thouvenot, A. [LMGE, UMR CNRS 6023, Lab Microorganismes Genome et Environnement, 63 177 Aubiere (France)
2014-07-01
In rivers and lakes, sediment dynamics are very difficult to quantify by field measurements as well as by modeling studies (Olley et al. 1997 WRR 33, 1319-1326). The well-known {sup 210}Pb excess method (Appleby 2000 Limnology 59-S.1, 1-14; Perga et al. 2010 Limnol. and Ocean. 55, 803-816) cannot be used for quantifying sedimentation rates over granitic catchments as large amounts of {sup 210}Pb produced by granite weathering tend to dilute the atmospheric {sup 210}Pb. The knowledge of sedimentation rates in lakes is however very important for understanding the geochemical mechanisms involved in contaminant scavenging and remobilization at the sediment-water interface (SWI). Moreover, these measurements are crucial for developing solute transport models, especially for radionuclides and metals in pore waters and through the SWI. In order to overcome these issues, this study focuses on an artificial pound located in a granitic catchment, down-gradient from a former uranium mining site that ceased operations at the beginning of the 80's (Guillevic and Reyss 2011 ICRER 2011). Sediment sampling was carried out in this artificial lake with an UWITEC{sup R} hand corer. All the samples were dried and the activities of artificial and natural radionuclides were measured by gamma spectrometry, at the Underground Laboratory of Modane and alpha spectrometry after radiochemical purification. The profile of {sup 210}Pb activities in the sediment increased with depth in the core and did not allow to distinguish the atmospheric {sup 210}Pb from the {sup 210}Pb produced by watering processes in this uranium enriched environment. Another method for quantifying sediment accumulation rates is therefore proposed here using the disequilibrium between {sup 228}Ra (half-life of 5.75 years) and {sup 232}Th, the parent isotope. The excess of {sup 228}Ra over its respective parent {sup 232}Th has already been demonstrated by (Olley et al. 1997 WRR 33, 1319-1326) in river and lake
International Nuclear Information System (INIS)
Adam, J.; Chitra Bhatia; Katovskij, K.
2011-01-01
Spallation neutrons produced in a collision of 2.33 GeV deuteron beam with the large lead target are moderated by the thick graphite block surrounding the target and used to activate the radioactive samples of nat U and Th put at the three different positions, identified as holes 'a', 'b' and 'c' in the graphite block. Rates of the (n, f), (n, γ), and (n, 2n) reactions in the two samples are determined using the gamma spectrometry. Ratio of the experimental reaction rates, R(n, 2n)/R(n, f) for the 232 Th and nat U are estimated in order to understand the role of reactions of (n, xn) type in Accelerator Driven Subcritical Systems. For the Th-sample, the ratio is ∼ 54(10)% in case of hole 'a' and ∼ 95(57)% in case of hole 'b' compared to 1.73(20)% for the hole 'a' and 0.710(9)% for the hole 'b' in case of the nat U sample. Also the ratio of fission rates in uranium to thorium, nat U(n, f)/ 232 Th(n, f), is ∼ 11.2(17) in case of hole 'a' and 26.8(85) in hole 'b'. Similarly, ratio 238 U(n, 2n)/ 232 Th(n, 2n) is 0.36(4) for the hole 'a' and 0.20(10) for the hole 'b' showing that 232 Th is more prone to the (n, xn) reaction than 238 U. All the experimental reaction rates are compared with the simulated ones by generating neutron fluxes at the three holes from MCNPX 2.6c and making use of LA150 library of cross sections. The experimental and calculated rates of all the three reactions are in good agreement. The transmutation power of the set-up is estimated using the rates of (n, γ) and (n, 2n) reactions for both the samples in the three holes and compared with some of the results of the 'Energy plus Transmutation' set-up and TARC experiment
International Nuclear Information System (INIS)
Addo, Moses Ankamah; Gbadago, J.K.; Ameyaw, Felix; Darko, E.O.; Gordon, Chris; Davor, Peter; Faanu, A.; Kpeglo, David
2014-01-01
Globally, the cement industry has been identified as one which causes significant particle pollution. In Ghana, environmental research in the neighborhood of the cement industry especially on human health is scanty. In the present work, attempts were made to evaluate the concentration of airborne dust at various distances and directions around the Diamond Cement Factory in the Volta Region of Ghana. The samples of dust were collected on filter papers and later analyzed for the concentration (mg/kg) of 232 Th and 23 '8U using neutron activation analysis. The principal objective of the study was to generate data intended at assessing the annual effective dose due to 232 Th and 238 U inhalation for both adult and children population living in the vicinity of cement factory. The data generated were supposed to assist in remediation decision making, if required. The study recorded a few incidences of higher total dust load concentrations as compared to the permissible limit of 150 μg/m 3 specified by the Ghana Environmental Protection Agency. The calculated mean effective doses were 28.2 ± 1.06 μSv/year and 25.9 ± 0.91 μSv/year for both adult and child, respectively. From the radiological point of view, the study concluded that the people living in the vicinity of the cement factory are not at risk to significant radiological hazards. However, the study indicated the need to have a complete evaluation of the impact of the factory on the environment assessment programs which should include both chemical and radiological toxicity. (author)
Analyzing urine ketone of 235 medical examiners%232例体检者尿酮体阳性结果分析
Institute of Scientific and Technical Information of China (English)
王会敏; 何柯新
2012-01-01
目的 探讨尿酮体在体检人群不同年龄段、不同性别的分布及其与血糖的相关性.方法 对232例尿酮体为阳性的体检者按年龄及性别分组进行分析,同时与其同期检测的血糖结果 进行对比分析.结果 尿酮体阳性者以1+和2+为主;主要出现在20~50岁年龄段中;大多数尿酮体阳性者其血糖不高(≤6.1).结论 在体检人群中尿酮体阳性与血糖高低不存在相关性,尿酮体阳性并不能准确反映患者的血糖水平;尿酮体阳性主要集中在20~50岁年龄组.%Objective Objective: To explore the relationship between urine ketone and different age and gender and plasma glucose detected in the same time with urine ketone. Methods The results of totally 232 medical examiners whose urine ketone were positive were analyzed according to different ages and genders. Results The urine ketone results which are positive are 1+ and 2 + , mainly distribute the ages of 20 to 50. And great majority of them has a normal or low level of fasting plasma glucose. Conclusion The urine ketone which are positive has no relationship with plasma glucose,it can't accurately reflect the level of plasma glucose. We found that most of the groups distribute the ages of 20 to 50. The reasons probably are they have heavy work pressure and imbalanced diet. People need to pay attention to the quality of life. Having a balanced nutrition diet and eating on time will be a good life style.
International Nuclear Information System (INIS)
Embarch, K.
1988-01-01
Fission product cumulative and independent yields were determined for 238-U(n,f) and 232-Th(n,f) reactions with essentially monoenergetic neutrons of 3 and 14 Mev. Fission product activities were measured by Ge(Li)γ-ray spectrometry of irradiated 238-U and 232-Th foils. These experiments allowed us to measure a great number of cumulative yields and to obtain the fission product mass distributions corresponding to the studied reactions mentioned above. The mass distributions were completely interpreted by nucleon shell effects and proton even-odd effects. The independent yield measurements are sometimes not possible using the activation technique because of the fission fragment decay data. The values which can not be measured were determined using the measured mass yields and a prediction systematic of fractional independent yield. The results allowed us to obtain the nuclear charge distributions and to estimate proton even-odd effect corresponding values. This effect decreases when the excitation energy of the fissioning nucleus increases, this shows the importance of this parameter in the viscosity study of the nuclear matter. In conclusion, the shell effects observed in the mass distributions show that the static aspect of the fission mechanism plays a great role during the fission process, and observed proton even-odd effects act for a weak nuclear viscosity. 54 refs., 27 figs., 25 tabs
Alhilaly, Mohammad J.; Bootharaju, Megalamane Siddaramappa; Joshi, Chakra Prasad; Besong, Tabot M.D.; Emwas, Abdul-Hamid M.; Juarez-Mosqueda, Rosalba; Kaappa, Sami; Malola, Sami; Adil, Karim; Shkurenko, Aleksander; Hakkinen, Hannu; Eddaoudi, Mohamed; Bakr, Osman
2016-01-01
Engineering the surface ligands of metal nanoparticles is critical in designing unique arrangements of metal atoms. Here, we report the synthesis and total structure determination of a large box-shaped Ag-67 nanocluster (NC) protected by a mixed shell of thiolate (2,4-dimethylbenzenethiolate, SPhMe2) and phosphine (triphenylphosphine, PPh3) ligands. Single crystal X-ray diffraction (SCXRD) and electrospray ionization mass spectrometry (ESI-MS) revealed the cluster formula to be [Ag-67(SPhMe2)(32)(PPh3)(8)](3+). The crystal structure shows an Ag-23 metal core covered by a layer of Ag44S32P8 arranged in the shape of a box. The Ag-13, core was formed through an unprecedented centered cuboctahedron, i.e., Ag-13, unlike the common centered Ag-13 icosahedron geometry. Two types of ligand motifs, eight AgS3P and eight bridging thiols, were found to stabilize the whole cluster. The optical spectrum of this NC displayed highly structured multiple absorption peaks. The electronic structure and optical spectrum of Ag-67 were computed using time-dependent density functional theory (TDDFT) for both the full cluster [Ag-67(SPhMe2)(32)(PPh3)(8)](3+) and a reduced model [Ag-67(SH)(32)(PH3)(8)](3+). The lowest metal-to-metal transitions in the range 500-800 nm could be explained by considering the reduced model that shows almost identical electronic states to 32 free electrons in a jellium box. The successful synthesis of the large box-shaped Ag-67 NC facilitated by the combined use of phosphine and thiol paves the way for synthesizing other metal clusters with unprecedented shapes by judicious choice of thiols and phosphines.
Alhilaly, Mohammad J.
2016-10-13
Engineering the surface ligands of metal nanoparticles is critical in designing unique arrangements of metal atoms. Here, we report the synthesis and total structure determination of a large box-shaped Ag-67 nanocluster (NC) protected by a mixed shell of thiolate (2,4-dimethylbenzenethiolate, SPhMe2) and phosphine (triphenylphosphine, PPh3) ligands. Single crystal X-ray diffraction (SCXRD) and electrospray ionization mass spectrometry (ESI-MS) revealed the cluster formula to be [Ag-67(SPhMe2)(32)(PPh3)(8)](3+). The crystal structure shows an Ag-23 metal core covered by a layer of Ag44S32P8 arranged in the shape of a box. The Ag-13, core was formed through an unprecedented centered cuboctahedron, i.e., Ag-13, unlike the common centered Ag-13 icosahedron geometry. Two types of ligand motifs, eight AgS3P and eight bridging thiols, were found to stabilize the whole cluster. The optical spectrum of this NC displayed highly structured multiple absorption peaks. The electronic structure and optical spectrum of Ag-67 were computed using time-dependent density functional theory (TDDFT) for both the full cluster [Ag-67(SPhMe2)(32)(PPh3)(8)](3+) and a reduced model [Ag-67(SH)(32)(PH3)(8)](3+). The lowest metal-to-metal transitions in the range 500-800 nm could be explained by considering the reduced model that shows almost identical electronic states to 32 free electrons in a jellium box. The successful synthesis of the large box-shaped Ag-67 NC facilitated by the combined use of phosphine and thiol paves the way for synthesizing other metal clusters with unprecedented shapes by judicious choice of thiols and phosphines.
International Nuclear Information System (INIS)
Brusegan, A.; Schillebeeckx, P.; Lobo, G.; Borella, A.; Volev, K.; Janeva, N.
2003-01-01
To deduce the resonance parameters for 232 Th in the resolved resonance region, high resolution transmission and capture measurements are being performed. The measurements are performed at the Time-Of-Flight facility GELINA. A comparison of experimental data resulting from capture (top) and transmission (bottom) are shown. The transmission measurements are performed at a 50 m flight path. The neutron are detected with a 0.25' thick lithium glass (NE912) placed in an Al sphere and viewed by a 5' EMI KQB photomultiplier orthogonal to the neutron beam axis. The injection of a stabilised light pulse in the detector during the measurements provided an efficient tool to control to better than 1% the gain of the entire electronics. The experimental set-up includes a sample-changer, placed at 23 m from the neutron source, which is driven by the acquisition system. The determination of the flight path length, was based on transmission of the 6.673 eV resonance of 238 U. We summarise, for the different energy regions of interest, the scheduled measurement conditions: the operation frequency of the accelerator and the target thickness. A simultaneous analysis of the data using REFIT will result in the resonance parameters from 0 to 4 keV. We show the result of a resonance shape analysis for the resonances at 21.8 and 23.5 eV. The resulting resonance parameters are important for the energy calibration and normalisation of the capture measurements in both the resolved and unresolved resonance region. The capture measurements are completed and were performed at a 60 m flight path. The sample consisted of a metallic natural thorium disc of 8 cm diameter and 1.0 mm thick, corresponding to a thickness of 3.176 10 -3 at/b. The neutron flux was measured with an ionisation chamber loaded with three back-to-back layers of about 40 μg/cm 2 10 B. The gamma rays, originating from the 232 Th(n,γ) reaction, were detected by four C 6 D 6 -based liquid scintillators (NE230) placed
International Nuclear Information System (INIS)
Happ, T.
1989-01-01
In the present thesis by means of a particle-particle-γ and particle-particle-neutron coincidence experiment γ and neutron spectroscopic studies after quasi-elastic collisions at incident energies far above the Coulomb barrier were performed. For the study of the γ decay by the necessary correction of the Doppler shift the possibility results to study excitations in the projectile and in the target. So in the case of 232 Th beside the observation of the ground state band up to the spin 14 ℎ also a very large number of transitions from vibrational side bands. From the spectra the γ emission probabilities in dependence on the distance of closest approximation were extracted. (orig./HSI) [de
Energy Technology Data Exchange (ETDEWEB)
Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.
1998-11-01
The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)
Measurement of fission yields for 232-Th (n,f) at 14,7 MeV by direct gamma spectrometric method
International Nuclear Information System (INIS)
Chouak, K.; Berrada, M.; Embarech, K.
1994-01-01
Fission yields for the reaction 232-Th (n,f) were measured at 14,7 MeV using the activation technique with direct gamma spectrometric method. Neutrons were produced via the T(d,n) sup 4 He reaction. The neutron fluences were determined relative to the well-known sup 2 sup 7 Al(n,p) sup 2 sup 7 Mg or sup 2 sup 7 Al(n,alpha) sup 2 sup 4 Na cross section, according to the irradiation time. Yields of fission products were determined by measuring the induced gamma ray activities of the irradiated Th foils, using a calibrated Ge(Li) detector. All necessary corrections were taken into account: self absorption, coincidence losses and natural gamma rays. Fifty six cumulative yields were measured and only twenty one corresponding results were found in the literature (Crouch,1977). A satisfactory agreement is observed between our results and the published data with the exception of the masses:A=134 and A=140. 1 tab., 2 refs. (author)
230Th, 232Th and 238U determinations in phosphoric acid fertilizer and process products by ICP-MS
International Nuclear Information System (INIS)
Nascimento, Marcos R.L. do; Guerreiro, Luisa M.R.; Bonifacio, Rodrigo L.; Taddei, Maria H.T.
2015-01-01
Through processing of Santa Quiteria-CE mine phosphate rock, Brazil has established a project for production of phosphoric acid fertilizer and uranium as a by-product. Under leaching conditions of phosphate rock with sulfuric acid, which is the common route for preparing phosphoric acid fertilizer, a large part of uranium, thorium and their decay products naturally present in the rock are solubilized. In order to assess the contamination potential in phosphoric acid and others process products, this paper describes a previous precipitation and direct methods for routine analysis of thorium and uranium isotopes by ICP-MS. In all samples, 230 Th, 232 Th and 238 U were directly determined after dilution, except 230 Th in phosphoric acid loaded with uranium sample, which to overcome equipment contamination effect, was determined after its separation by oxalate precipitation using lanthanum as a carrier. The results obtained by the proposed method by ICP-MS, were in good agreement when compared to alpha spectrometry for 230 Th, and ICP-OES and spectrophotometry with arsenazo III for elementary uranium and thorium determinations. (author)
Coullin, Ph.; Crooijmans, R.P.M.A.; Groenen, M.A.M.; Heilig, R.; Mollicone, R.; Oriol, R.; Candelier, J.J.
2002-01-01
The human FUT8 gene is implicated in crucial developmental stages and is overexpressed in some tumors and other malignant diseases. Based on three different experiments we have assigned the FUT8 gene to chromosome bands 14q23.2 --> q24.1 and not 14q24.3 as previously shown (Yamaguchi et al.,
International Nuclear Information System (INIS)
Foell, U.
1978-01-01
Experiments were carried out in mice in order to determine activity ratios and distribution kinetics of ThO 2 and its decay products. The data will be used as a basic for dose calculations. In supplementary investigations, the microdistribution, localisation, and quantitative enrichment of thorotrast were determined in order to provide a basis for microdosimetric evaluation of late thorotrast lesions. The radioactive colloid was injected intravenously into the tail vein of the animals (25 to 250 μl). Whole-body activity was measured at regular intervals. The animals were killed at different times after incorporation, and their livers, spleens, and skeleton without bone marrow were investigated by gammy spectrometry and histoautoradiography. With the findings obtained for the macroscopic distribution of colloid 232 ThO 2 and its decay products on the cellular level as a function of the duration of thorotrast storage, the mean radiation exposure of RHS organs can be determined and at least the order of magnitude of the local dose can be estimated. It will require long-term animal experiments to determine the biological effects of thorotrast incorporation and correlate them with the results of these dose calculations on the basis of the studies on thorotrast biokinetics. (orig./MG) [de
International Nuclear Information System (INIS)
Rajesh, S.; Avinash, P.R.; Kerur, B.R.; Anilkumar, S.
2014-01-01
The natural radiation dose received by the public mainly arises from the cosmic radiation (galactic and solar) and from terrestrial sources. Terrestrial radiation levels in the environment are due to radiations from natural radioactive elements preset in various environmental materials. Naturally occurring radionuclides are the major contributors to the total effective dose of ionizing radiation received by the population. The gamma rays from natural radionuclides like 226 Ra, 232T h and 40 K are the most significant for environmental dose, due to its wide range and penetrating power. The occurrence and concentration of these radionuclides depend mainly on the local geological formation and geochemical composition of earth. Two adjoining talukas, Sedam and Chincholi selected for the present study lies in the eastern part of Gulbarga district of North-East Karnataka covers the area with range 17.12° - 17.51° N latitude and 77.08° - 77.85° E longitude as shown in the paper. The soil types in the study region are mainly black soil. The area is surrounded by the plane surface and small hills in certain directions which have an abundant resource of the shale and limestone, which are highly deformed in nature. The study area is popular for industries like cement production and granite mining, utilizing natural resources in large scale. It will be of interest to examine the variation of environmental radiation dose rates due to various activities in the study area. Large number surface soil samples have been collected from the study region for the assessment of effective dose from 226 Ra, 232 Th and 40 K. The data generated in this study region will act as a baseline data for natural background radiation and is essential for future assessments, comparison and radiological mapping of the study area
Energy Technology Data Exchange (ETDEWEB)
Zaika, N I; Kibkalo, Yu V; Parlag, O A; Sikora, D I; Tokarev, V P; Shityuk, V A [AN Ukrainskoj SSR, Kiev (Ukrainian SSR). Inst. Yadernykh Issledovanij
1989-04-01
Two-parameter measurements of the mass and energy distributions of fission products in the fission of {sup 232}Th by 21.0-26.4 MeV {alpha}-particles (h=1 MeV) are conducted using the correlation method. The obtained results show that in the region under investigation the average total kinetic energies of the fission products E-bar{sub k} have no noticeable variations within the experimental error of {plus minus} 1.5 MeV and the dispersion {sigma}{sup 2}E{sub k} slowly increases. For the E-bar{sub k} mass dependence of heavy fraction the maximum is observed at A=132, that confirms a hypothesis on the influence of the closed-shell effects at the magic numbers of Z=50 and N=82. Assuming the existence of different barrier values for two models of the fission the ratio of symmetric and asymmetric fission yields are analyzed in the statistical model. It is shown that the barrier difference for two modes of fission is 1.3-1.4 MeV, which is in good agreement with the model of two fission modes.
International Nuclear Information System (INIS)
Costa Lauria, D. da.
1986-01-01
A sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 in environmental samples and applied to the analysis of mineral waters is studied. Thorium isotopes are coprecipitated with lanthanium fluoride before counting in alpha spectrometer, the uranium isotopes are determined by alpha spectrometry following extraction with TOPO onto a polymenic membrane. Radium-226 is determined with the radom emanation technique. (M.J.C.) [pt
International Nuclear Information System (INIS)
Misdaq, M.A.; Ouabi, H.; Merzouki, A.
2007-01-01
Uranium ( 238 U) and thorium ( 232 Th) concentrations as well as radon ( 222 Rn) and thoron ( 220 Rn) alpha-activities per unit volume have been measured inside various potable water samples collected from nineteen cities in Morocco by using CR-39 and LR-115 type II solid state nuclear track detectors (SSNTDs). Measured radon alpha-activities ranged from (0.37 ± 0.02) Bq l -1 to (13.6 ± 1.10) Bq l -1 for the potable water samples studied. Alpha-activities due to radon from the ingestion of the studied potable water samples were determined in different compartments of the gastrointestinal system by using the ICRP compartmental model for radon. Annual committed equivalent doses due to radon were evaluated in the gastrointestinal compartments from the ingestion of the potable water samples studied. The influence of the target tissue mass, radon intake and alpha-activity integral due to radon on the annual committed equivalent doses in the gastrointestinal compartments was investigated
International Nuclear Information System (INIS)
Baba, Mamoru; Itoh, Nobuo; Maeda, Kazuto; Hirakawa, Naohiro; Wakabayashi, Hidetaka.
1989-10-01
This report presents the summary of experimental studies of prompt fission neutron spectra and double-differential neutron inelastic-scattering cross sections of 238 U and 232 Th. The experiments were performed at Tohoku University Fast Neutron Laboratory employing a time-of-flight technique and Dynamitron accelerator as the pulsed neutron generator. From the experiments, we obtained the following data for both nuclei; 1. prompt fission neutron spectrum for 2 MeV neutrons, 2. double-differential neutron inelastic-scattering cross sections for 1.2, 2.0, 4.2, 6.1 and 14.1 MeV incident neutrons. Both in experiments and data processing, cares were taken to obtain reliable data by avoiding systematic uncertainty. The experimental data were compared with those by other experiments, evaluations and model calculations. Through the data comparison, some fundamental problems were found in the experiments by previous authors and the evaluations. The present data will provide useful data base for refinement of the evaluated data and theoretical models. (author)
International Nuclear Information System (INIS)
Oliveira, Roges de; Lopes, Ricardo T.; Melo, Dunstana R.; Juliao, Ligia M.Q.C.
2005-01-01
The object of this study consists of an open mine from which Niobium ore (pyrochlore) is extracted and a metallurgy company, where Fe-Nb alloys are produced for export. For geological reasons, the main ore is associated to natural radionuclides U and Th, and its decay products. The concentration of 234 U, 238 U, 232 Th, 226 Ra and 228 Ra, 228 Th, including 210 Pb in fecal excretion of 12:0 am, 29 workers and 13 family members were determined. The technique employed for the determination of the elements was the sequential method of radiochemical separation, followed by alpha spectrometry and counting α and β in proportional detector. Statistically significant difference was observed in the concentration of 234 U and 238 U, in feces samples, among the group of mining workers and family members; as well as for 232 Th in the feces of workers of crushing and metallurgy groups when compared with the Family Group. No statistically significant difference was detected at a concentration of 226 Ra, 228 Ra and 210 Pb, in feces of any group of workers of the installation in relation to the family group
International Nuclear Information System (INIS)
Su Qiong; Cheng Jianping; Diao Lijun; Li Guiqun
2006-01-01
A comparison on determining activities of 238 U and 232 Th based on transfer samples is reported in the paper. Especially, disturbance of X-ray from out-sources i.e. non-nucleus-self are studied and more detailed. And other factors that influence this time comparison result are discussed too in the work. In the paper it is pointed out definitely that the characteristic peaks that are disturbed by characteristic X-rays from out-sources ought to be not adopted to determine activities of the samples. In final some associations of ideas for some investigation passed of environment radiation are also described. (authors)
International Nuclear Information System (INIS)
Su Qiong; Cheng Jianping; Diao Lijun; Li Guiqun
2007-01-01
A comparison on determining activities of 238 U and 232 Th based on transfer samples is reported in the paper. Especially, disturbance of X-ray from out-sources i.e. non-nucleus-self are studied and more detailed. And other factors that influence this time comparison result are discussed too in the work. In the paper it is pointed out definitely that the characteristic peaks that are disturbed by characteristic X-rays from out-sources ought to be not adopted to determine activities of the samples. In final some associations of ideas for some investigation passed of environment radiation are also described. (authors)
International Nuclear Information System (INIS)
Sepulveda Munita, C.J.A.; Atalla, L.T.
1980-01-01
The determination of thorium via the measurement of 233 Th activity (obtained by irradiating natural thorium with neutrons) may suffer the interference of various radioisotopes which may be also formed during irradiation, if their parent isotopes are present in the sample. Taking into account this possibility, another technique was chosen for the determination of thorium, based on isotopic exchange associated with ionic exchange. Conditions for the isotopic exchange between 234 Th in solution and 232 Th in the resin were optimized. It was verified that the behaviour of 233 Th and 234 Th is the same regarding isotopic exchange with 232 Th. 234 Th was chosen for the experiments since it has a longer half-life (24.1 days) than 233 Th (22.3 min), thus facilitating the performance of the work. As the major objective of this work is to separate thorium and europium isotopes, the behaviour of 152-154 Eu was studied in the same system used for thorium, envisaging a minimum retention of these radioisotopes in the resin. In order to establish the best conditions for separating 234-Th and 152/154-Eu, the following parameters were considered: the thorium concentration in the solution; the hydrochloric acid concentration in solution; the concentration of other elements in solution; the degree of cross-linking of the resin; the flow rate of the solution through the column. The other elements added to the elutant solution were: uranium, molybdenum, lanthanum, europium, ytterbium, bromine, cobalt, barium, manganese, indium, cesium and selenium. Europium was added so to dilute the 152/154-Eu tracer and avoid the retention of the latter in the resin. The other elements were added because they give rise to radioisotopes which interfere in the activation analysis of thorium when 233-Th activity is used and, the separation of these elements from thorium will also be subsequently studied by the method used in the present work. (C.L.B.) [pt
Directory of Open Access Journals (Sweden)
I. P. Stamat
2008-01-01
Full Text Available In the Sanitary Rules SR 2.6.1.1292-03 and SR 2.6.6.1169-02 classification of the industrial waste containing naturally occurring radioactive materials is adopted in accordance to the values of their effective specific activity Aeff. In a case of the disturbed equilibrium in 238U and 232Th series it is necessary to take into consideration actual contribution of the separate natural radionuclides of the mentioned series into the value of gamma dose rate of the waste. This will permit to avoid unjustified overestimating or understating of the waste category which prevents as unjustified expenditures on their treating so undertaking of the necessary measures providing radiation safety.
Neutron induced fission cross section ratios for 232Th, 235,238U, 237Np and 239Pu from 1 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1988-01-01
Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, 235,238 U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. (author)
International Nuclear Information System (INIS)
Hansen, L.F.; Grimes, S.M.; Pohl, B.A.; Poppe, C.H.; Wong, C.
1980-01-01
Differential cross sections for the (p,n) reactions to the isobaric analog states (IAS) of 232 Th and 238 U targets were measured at 26 and 27 MeV. The analysis of the data was done in conjunction with the proton elastic and inelastic (2 + , 4 + , 6 + ) differential cross sections measured at 26 MeV. Because collective effects are important in this mass region, deformed coupled-channels calculations were carried out for the simultaneous analysis of the proton and neutron outgoing channels. The sensitivity of the calculations was studied with respect to the optical model parameters used in the calculations, the shape of the nuclear charge distribution, the type of coupling scheme assumed among the levels, the magnitude of the deformation parameters, and the magnitude of the isovector potentials, V 1 and W 1 . A Lane model-consistent analysis of the data was used to infer optical potential parameters for 6- to 7-MeV neutrons. The neutron elastic differential cross sections obtained from these calculations are compared with measurements available in the literature, and with results obtained using neutron parameters from global sets reported at these energies. 7 figures, 3 tables
Impulse transfer and light particles emission during the reaction α + 232Th at 70 MeV/u
International Nuclear Information System (INIS)
Nguyen, M.S.
1988-02-01
We have measured during the reaction 4 He + 232 Th at 70 MeV/u the angular correlation of heavy fragments of fission, the inclusive energy spectra of light particles (p, d, t, 3 He and α) and triple coincidence between two fission fragments and a light ejectile. Energy spectra show an evaporation component at low energy, a component of projectile fragmentation at energy equivalent to beam velocity and an intermediate component attributed to pre-equilibrium emission. The analysis of the correlation between linear momentum transfer to the fissioning nucleus and the characteristics of the ejectile in coincidence shows a phenomenon of incomplete massive transfer. We run an Intra-Nuclear Cascade (INC) computation to reproduce ejectile energy spectra, but the agreement with experiment was very bad. We conclude to the impossibility to apply INC computation at intermediate energy of 70 MeV/u. We also applied Distorted Wave Born Approximation (DWBA) for direct transfer reaction extended to continuum states: but the agreement with experiment was again deceiving. Finally, we used an analysis by moving sources for which we propose a model of generalized fragmentation giving a continuous representation of the emission source phenomenon from low energy up to high energy [fr
The measurement of activities of 226Ra, 232Th, 40K in phosphogypsum by gamma ray spectrometry
International Nuclear Information System (INIS)
Parmaksiz, A.
2004-06-01
Phosphatic fertilizers are produced from the industrial processing of rock phosphate ores which are known to contain naturally occuring radionuclides such as 238 U and its daughter products. A high volume by-product known as phosphogypsum (PG) from the production of phosphoric acid and phosphate fertilizer causes serious storage and environmental problems in phosphoric acid industries. During the phosphoric acid production process, 226 Ra (t 1/2 =1600 y) ends up in PG which has chemical analogous to calcium periodical table. Since the stockpiles of PG near the phosphatic fertilizer plants are huge amounts, the radioactivity contained in PG has to measured in view of environmental radioactivity problem. In this work, the natural radioactivity in eighty PG samples, issued from a stock of about 60.000 tones was measured by a high resolution gamma ray spectrometer with a HPGe detector. The averaged activity of 226 Ra in PG has been found to be 546 Bq.kg -1 . However, the activities of 232 Th and 40 K measured in PG samples are negligibly small. The extra gamma radiation dose rate arising from 1 - 1.5 kg of PG is estimated to be about 241 nGy/h from 1 m ground level applied in 1 m 2 surface area of field
Alpha-emitting isotopes and chromium in a coastal California aquifer
Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.
2014-01-01
The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238U and its daughter 234U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232Th, including its daughter 224Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ53Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development.
Energy Technology Data Exchange (ETDEWEB)
Lopes, J.M.; Garcêz, R.W.D., E-mail: marqueslopez@yahoo.com.br [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Silva, A.X. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil). Escola Politécnica
2017-07-01
This work presents an analysis of specific concentrations of {sup 40}K, {sup 226}Ra, {sup 228}Ra and {sup 232}Th in some vegetables that are part of the diet of the population of the state of Rio de Janeiro. Furthermore, was analyzed the concentrations of radionuclides in the same coating tissue that compose the vegetables. It can notice an increase of the specific concentration of {sup 40}K in the peels of vegetables that have little or no contact with the ground. Among the samples examined, only the pumpkin showed measurable amount of {sup 137}Cs both saves and in the skin. (author)
Energy Technology Data Exchange (ETDEWEB)
Jung, Yoon Hee; Lim, Jong Myoung; Ji, Young Yong; Chung, Kun Ho; Kang, Mun Ja [Environmental Radioactivity Assessment Team, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2017-03-15
Phosphate rock and its by-product are widely used in various industries to produce phosphoric acid, gypsum, gypsum board, and fertilizer. Owing to its high level of natural radioactive nuclides (e.g., 238U and 226Ra), the radiological safety of workers who work with phosphate rock should be systematically managed. In this study, 238U, 232Th, 226Ra, and 40K levels were measured to analyze the transport characteristics of these radionuclides in the production cycle of phosphate rock. Energy dispersive X-ray fluorescence and gamma spectrometry were used to determine the activity of 238U, 232Th, 226Ra, and 40K. To evaluate the extent of secular disequilibrium, the analytical results were compared using statistical methods. Finally, the distribution of radioactivity across different stages of the phosphate rock production cycle was evaluated. The concentration ratios of 226Ra and 238U in phosphate rock were close to 1.0, while those found in gypsum and fertilizer were extremely different, reflecting disequilibrium after the chemical reaction process. The nuclide with the highest activity level in the production cycle of phosphate rock was 40K, and the median 40K activity was 8.972 Bq·g−1 and 1.496 Bq·g−1, respectively. For the 238U series, the activity of 238U and 226Ra was greatest in phosphate rock, and the distribution of activity values clearly showed the transport characteristics of the radionuclides, both for the byproducts of the decay sequences and for their final products. Although the activity of 40K in k-related fertilizer was relatively high, it made a relatively low contribution to the total radiological effect. However, the activity levels of 226Ra and 238U in phosphate rock were found to be relatively high, near the upper end of the acceptable limits. Therefore, it is necessary to systematically manage the radiological safety of workers engaged in phosphate rock processing.
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
International Nuclear Information System (INIS)
Perianez, R.; Abril, J.M.; Garcia-Leon, M.
1997-01-01
A numerical model to simulate the dispersion of non conservative radionuclides in tidal waters has been developed. The model includes four phases: water, suspended matter and two grain size sediment fractions. Ionic exchanges between water and the solid phases have been formulated in terms of kinetic transfer coefficients instead of distribution coefficients, because the model was developed for nonequilibrium conditions. The model simultaneously solves the shallow water hydrodynamic equations, the suspended matter dispersion equation and the four equations which give the time evolution of specific activity in each phase. The model has been applied to the Odiel river (southwest Spain), where a phosphate complex releases its wastes. It gives good results in predicting concentrations of 226 Ra, 238 U and 232 Th in water, suspended matter, distribution coefficients and Th/U mass rations. (author)
International Nuclear Information System (INIS)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1988-01-01
Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, /sup 235,238/U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
International Nuclear Information System (INIS)
Matsuoka, H.; Honzawa, S.; Takahashi, A.; Yoshikawa, H.; Watanabe, E.; Watanabe, T.; Ozawa, Y.; Yamada, Y.; Iizuka, T.; Uda, Y.
2008-01-01
The photostability of (E)-2-[3-(2-thioxopyrrolidin-3-ylidene)methyl]-tryptophan ((E)-TPMT), the main yellow pigment in salted radish, was studied. First we analyzed the photoproduct generated from (E)-TPMT under longwave UV irradiation. On the basis of NMR spectroscopy, the photoproduct was identified as Z-configurated TPMT, and isomerization from the Z- to the E-form was reversibly induced by Vis-light irradiation. The optimum wavelength for isomerization from the E- to the Z-form was 360-380 nm, and that for isomerization from the Z- to the E-form was 440-460 nm. The E/Z-ratios in the photostationary state under UV- and Vis-light irradiation conditions were approximately 0.95:1 and 26:1 respectively. The (Z)-isomer was more sensitive to light irradiation than the (E)-isomer in the quantum yield measurement. Yellowing was dependent on the ratio of the (Z)-isomer, because the b* and chroma value rose with increases in the (Z)-isomer by the colorimeters. Hence, it is possible that the formation of the (Z)-isomer contribute to the yellow color of takuan-zuke during long salting and fermentation
Directory of Open Access Journals (Sweden)
Bejjani Bassem A
2009-01-01
Full Text Available Abstract Background Complex chromosome rearrangements (CCRs, which involve more than two breakpoints on two or more chromosomes, are uncommon occurrences. Although most CCRs appear balanced at the level of the light microscope, many demonstrate cryptic, submicroscopic imbalances at the translocation breakpoints. Results We report a female with hearing loss and global developmental delay with a complex three-way unbalanced translocation (5;20;8(q31;p11.2;p21 resulting in microdeletions on 5q31.2, 5q31.3, and 8p23.2 identified by karyotyping, microarray analysis and fluorescence in situ hybridization. Discussion The microdeletion of bands 8p23.2 may be associated with the hearing impairment. Furthermore, the characterization of this patient's chromosomal abnormalities demonstrates the importance of integrated technologies within contemporary cytogenetics laboratories.
Energy Technology Data Exchange (ETDEWEB)
Schupfner, R. [Regensburg Univ. (Germany). ZRN-URA Lab.
2016-07-01
The determination of the activity concentration of the radionuclides {sup 14}C/C and {sup 90}Sr/Ca and {sup 228}Th/{sup 232}Th applying combined radionuclide analyses methods has been proved to be a suitable tool for the purpose of an unambiguous age determination of elephant ivory [1, 2, 3, 10, 11, 12, 13]. Analysing representative and independently dated samples (N = 28) of ivory the curves fitting the post mortal interval (PMI) versus the activity concentration of the radionuclides mentioned above produced the data base enabling a more unambiguous age determination. Data from these studies origin [1, 2, 3, 10, 11, 12, 13] in analyses of ivory samples which were available up to the 2012. During the last five years there was a gap in information of the future trend of {sup 14}C/C and {sup 90}Sr/Ca. Up to this study it was not possible to assess whether the future level of {sup 14}C/C as well as {sup 90}Sr/Ca can analytically be distinguished from the level before 1954. At about 1954 the activity concentration of radionuclides from the atmospheric nuclear explosion, as {sup 14}C and {sup 90}Sr, increased in ivory significantly. This study aims in closing this information gap. The results of analyses of {sup 14}C/C, {sup 90}Sr/Ca, {sup 228}Th/{sup 232}Th in ivory with PMI values ranging from 1 to 5 years are presented and interpreted. These data enable an actualization of the calibration curves of PMI versus specific activities. This is necessary for a better understanding of the effect of blindness of {sup 14}C/C dating and its prevention. On the base of all available results form independent dated ivory sample available up to 2015 a suitable analytical procedure is suggested which aims in a more precise and reliable age determination of elephant tusks. Results of determining of radionuclides {sup 14}C/C and {sup 90}Sr/Ca and {sup 228}Th/{sup 232}Th in ivory are shown from before 1950 to 2015. These results are discussed with respect the purposes of dating as well
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
Zaidi, E.; FahrulRazi, MJ; Azhar, ATS; Hazreek, ZAM; Shakila, A.; Norshuhaila, MS; Omeje, M.
2017-08-01
The assessment of radioactivity levels and the distribution of heavy metals in soil samples at CEP Farm landfill, Renggam in Johor State was to determine the activity concentrations of naturally occurring radionuclides and heavy metal concentrations of this landfill. The background radiation was monitored to estimate the exposure level. The activity concentrations of radionuclides in soil samples were determined using HPGe gamma ray spectroscopy whereas the heavy metal concentration was measured using X-RF analysis. The mean exposure rate at the landfill site was 36.2±2.4 μR hr-1 and the annual effective dose rate at the landfill site was 3.19 ± 0.22 mSv yr-1. However, residential area has lower mean exposure dose rate of about 16.33±0.72 μR hr-1 and has an annual effective dose rate of 1.43±0.06 mSv yr-1 compared to landfill sites. The mean activity concentration of 40K, 238U and 232Th at landfill site were 239.95±15.89 Bq kg-1, 20.90±2.49 Bq kg-1 and 40.61±4.59 Bq kg-1, respectively. For heavy metal compositions, Cr, Ni and Cu have mean concentration of 232±10 ppm, 23±2 ppm, and 46±19 ppm, respectively. Whereas, Zn has concentration of 64±9 ppm and concentration of 12±1 ppm and 71±2 ppm was estimated for As and Pb respectively. The higher activity concentration of 40K down the slope through leaching process whereas the higher activity level of 238U content at the landfill site may be attributed to the soil disruption to local equilibrium.
International Nuclear Information System (INIS)
Singh, S.K.; Dalai, Tarun K.; Krishnaswami, S.
2003-01-01
238 U and 232 Th concentrations and the extent of 238 U- 234 U- 230 Th radioactive equilibrium have been measured in a suite of Precambrian carbonates and black shales from the Lesser Himalaya. These measurements were made to determine their abundances in these deposits, their contributions to dissolved uranium budget of the headwaters of the Ganga and the Indus in the Himalaya and to assess the impact of weathering on 238 U- 234 U- 230 Th radioactive equilibrium in them. 238 U concentrations in Precambrian carbonates range from 0.06 to 2.07 μg g -1 . The 'mean' U/Ca in these carbonates is 2.9 ng U mg -1 Ca. This ratio, coupled with the assumption that all Ca in the Ganga-Indus headwaters is of carbonate origin and that U and Ca behave conservatively in rivers after their release from carbonates, provides an upper limit on the U contribution from these carbonates, to be a few percent of dissolved uranium in rivers. There are, however, a few streams with low uranium concentrations, for which the carbonate contribution could be much higher. These results suggest that Precambrian carbonates make only minor contributions to the uranium budget of the Ganga-Indus headwaters in the Himalaya on a basin wide scale, however, they could be important for particular streams. Similar estimates of silicate contribution to uranium budget of these rivers using U/Na in silicates and Na* (Na corrected for cyclic and halite contributions) in river waters show that silicates can contribute significantly (∼40% on average) to their U balance. If, however, much of the uranium in these silicates is associated with weathering resistant minerals, then the estimated silicate uranium component would be upper limits. Uranium concentration in black shales averages about 37 μg g -1 . Based on this concentration, supply of U from at least ∼50 mg of black shales per liter of river water is needed to balance the average river water U concentration, 1.7 μg L -1 in the Ganga-Indus headwaters
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Constantinescu, B.; Constantin, F.; Dusoiu, N.; Pascovoici, G.
1996-01-01
Two particular sources from the natural radiation background which may be encountered in Romanian industry are here presented: the phosphate containing fertilizers and the gold and copper ores, respectively. U-238, Th-232, K-40, and Ra-226 activity levels for several imported phosphorites, superphosphates and also for concentrated Cu and Au indigenous ores are reported. A simple and efficient radioactivity determination procedure based on a large volume NaI(Tl) detector, coupled to a Romanian design portable multichannel analyzer is described. Potential radiological impacts for the specialized workers are also discussed. (author) 1 fig., 4 tabs. 6 refs
International Nuclear Information System (INIS)
Boyer, S.
2004-10-01
The Thorium cycle Th 232 /U 233 may face brilliant perspectives through advanced concepts like molten salt reactors or accelerator driven systems but it lacks accurate nuclear data concerning some nuclei. Pa 233 is one of these nuclei, its high activity makes the direct measurement of its radiative neutron capture cross-section almost impossible. This difficulty has been evaded by considering the transfer reaction Th 232 (He 3 ,p)Pa 234 * in which the Pa 234 nucleus is produced in various excited states according to the amount of energy available in the reaction. The first chapter deals with the thorium cycle and its assets to contribute to the quenching of the fast growing world energy demand. The second chapter gives a detailed description of the experimental setting. A scintillation detector based on deuterated benzene (C 6 D 6 ) has been used to counter gamma ray cascades. The third chapter is dedicated to data analysis. In the last chapter we compare our experimental results with ENDF and JENDL data and with computed values from 2 statistical models in the 0-1 MeV neutron energy range. Our results disagree clearly with evaluated data: our values are always above ENDF and JENDL data but tend to near computed values. We have also perform the measurement of the radiative neutron cross-section of Pa 231 for a 110 keV neutron: σ(n,γ) 2.00 ± 0.14 barn. (A.C.)
International Nuclear Information System (INIS)
HOPKINS, A.M.; MINETTE, M.J.; KLOS, D.B.
2007-01-01
This paper describes the unique challenges encountered and subsequent resolutions to accomplish the deactivation and decontamination of a plutonium ash contaminated building. The 232-Z Contaminated Waste Recovery Process Facility at the Plutonium Finishing Plant was used to recover plutonium from process wastes such as rags, gloves, containers and other items by incinerating the items and dissolving the resulting ash. The incineration process resulted in a light-weight plutonium ash residue that was highly mobile in air. This light-weight ash coated the incinerator's process equipment, which included gloveboxes, blowers, filters, furnaces, ducts, and filter boxes. Significant airborne contamination (over 1 million derived air concentration hours [DAC]) was found in the scrubber cell of the facility. Over 1300 grams of plutonium held up in the process equipment and attached to the walls had to be removed, packaged and disposed. This ash had to be removed before demolition of the building could take place
International Nuclear Information System (INIS)
Silva, Carolina Fernanda da
2015-01-01
Brazil is the largest exporter and second largest producer of tobacco worldwide, according to the crop production of 2013/2014. The tobacco plant (Nicotiana tabacum L.) is used to manufacture all derivatives and the chemical composition of the resulting tobacco products varies with the type of tobacco leaves, how they are grown, the region where they are cultivated, the characteristics of preparation (compression, filter and paper) and the temperature variations resulting from the incomplete combustion of tobacco. Tobacco products are extensively used throughout the world, and the most consumed are cigarettes, cigars and narghile. The damaging effects that these products cause to human health are discussed globally, and many surveys are performed with the aim of relating the use of these products with various illnesses. There is a lack of information about the radiological characterization of the tobacco plant both in international and Brazilian literature. The objective of this study was to determine the concentration of radionuclides 238 U, 234 U, 230 Th, 22 '6Ra, 210 Pb and 210 Po, members from the 238 U decay series, and the radionuclides 232 Th and 228 Ra members of the 232 Th decay series in the varieties Burley and Virginia, which are the most cultivated in Brazil. Plants from these varieties were cultivated in pots with organic substrate and fertilizer and also acquired from the producers and analyzed by alpha spectrometry for U and Th isotopes and 210 Po determination, and gross alpha and beta counting, 228 Ra, 226 Ra and 210 Pb determination. The whole plant, from both places, was analyzed; root, stem, leaves, as well as the organic substrate, the fertilizers, and the soil. The results for U and Th isotopes presented values below the detection limits of the methods to the leaves and stems of all plants analyzed, with measurable results only in roots, soil, and substrate. The radionuclides 226 Ra, 228 Ra, 210 Pb, and 210 Po, were determined in most
Directory of Open Access Journals (Sweden)
Rakopoulos Vasileios
2017-01-01
Full Text Available Independent isomeric yield ratios (IYR of 81Ge, 96Y, 97Y, 97Nb, 128Sn and 130Sn have been determined in the 25 MeV proton-induced fission of natU and 232Th. The measurements were performed at the Ion Guide Isotope Separator On-Line (IGISOL facility at the University of Jyväskylä. A direct ion counting measurement of the isomeric fission yield ratios was accomplished for the first time, registering the fission products in less than a second after their production. In addition, the IYRs of natU were measured by means of γ-spectroscopy in order to verify the consistency of the recently upgraded experimental setup. From the obtained results, indications of a dependence of the production rate on the fissioning system can be noticed. These data were compared with data available in the literature, whenever possible. Using the TALYS code and the experimentally obtained IYRs, we also deduced the average angular momentum of the fission fragments after scission.
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
Energy Technology Data Exchange (ETDEWEB)
Silva, Carolina Fernanda da
2015-07-01
Brazil is the largest exporter and second largest producer of tobacco worldwide, according to the crop production of 2013/2014. The tobacco plant (Nicotiana tabacum L.) is used to manufacture all derivatives and the chemical composition of the resulting tobacco products varies with the type of tobacco leaves, how they are grown, the region where they are cultivated, the characteristics of preparation (compression, filter and paper) and the temperature variations resulting from the incomplete combustion of tobacco. Tobacco products are extensively used throughout the world, and the most consumed are cigarettes, cigars and narghile. The damaging effects that these products cause to human health are discussed globally, and many surveys are performed with the aim of relating the use of these products with various illnesses. There is a lack of information about the radiological characterization of the tobacco plant both in international and Brazilian literature. The objective of this study was to determine the concentration of radionuclides {sup 238}U, {sup 234}U, {sup 230}Th, {sup 22}'6Ra, {sup 210}Pb and {sup 210}Po, members from the {sup 238}U decay series, and the radionuclides {sup 232}Th and {sup 228}Ra members of the {sup 232}Th decay series in the varieties Burley and Virginia, which are the most cultivated in Brazil. Plants from these varieties were cultivated in pots with organic substrate and fertilizer and also acquired from the producers and analyzed by alpha spectrometry for U and Th isotopes and {sup 210}Po determination, and gross alpha and beta counting, {sup 228}Ra, {sup 226}Ra and {sup 210}Pb determination. The whole plant, from both places, was analyzed; root, stem, leaves, as well as the organic substrate, the fertilizers, and the soil. The results for U and Th isotopes presented values below the detection limits of the methods to the leaves and stems of all plants analyzed, with measurable results only in roots, soil, and substrate. The
International Nuclear Information System (INIS)
Jung, Yoon Hee; Lim, Jong Myoung; Ji, Young Yong; Chung, Kun Ho; Kang, Mun Ja
2017-01-01
Phosphate rock and its by-product are widely used in various industries to produce phosphoric acid, gypsum, gypsum board, and fertilizer. Owing to its high level of natural radioactive nuclides (e.g., 238U and 226Ra), the radiological safety of workers who work with phosphate rock should be systematically managed. In this study, 238U, 232Th, 226Ra, and 40K levels were measured to analyze the transport characteristics of these radionuclides in the production cycle of phosphate rock. Energy dispersive X-ray fluorescence and gamma spectrometry were used to determine the activity of 238U, 232Th, 226Ra, and 40K. To evaluate the extent of secular disequilibrium, the analytical results were compared using statistical methods. Finally, the distribution of radioactivity across different stages of the phosphate rock production cycle was evaluated. The concentration ratios of 226Ra and 238U in phosphate rock were close to 1.0, while those found in gypsum and fertilizer were extremely different, reflecting disequilibrium after the chemical reaction process. The nuclide with the highest activity level in the production cycle of phosphate rock was 40K, and the median 40K activity was 8.972 Bq·g−1 and 1.496 Bq·g−1, respectively. For the 238U series, the activity of 238U and 226Ra was greatest in phosphate rock, and the distribution of activity values clearly showed the transport characteristics of the radionuclides, both for the byproducts of the decay sequences and for their final products. Although the activity of 40K in k-related fertilizer was relatively high, it made a relatively low contribution to the total radiological effect. However, the activity levels of 226Ra and 238U in phosphate rock were found to be relatively high, near the upper end of the acceptable limits. Therefore, it is necessary to systematically manage the radiological safety of workers engaged in phosphate rock processing
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1988-01-01
Time-of-flight measurements of neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs.
International Nuclear Information System (INIS)
Tapia, M.; Roth, M.; Ruiz, M.T.
1988-01-01
Near-infrared JHKL photometry of more than 200 stars, members of the open clusters Tr14, Tr15, Tr16, Cr228 and Cr232 in the Carina Nebula are presented. From comparing these results with the available visual photometry and spectroscopy, it is found that, except in Tr15, the intracluster reddening is characterized by a 'normal' extinction law at λ > 0.5μm but is highly anomalous and variable in the U- and B-bands. This behaviour may be explained by the presence of intracluster interstellar grains 'processed' by shock waves presumably associated with the explosive history of η Carinae. All clusters are found to be at the same distance from the Sun at d = 2.4 ± 0.2 kpc or Vsub(o) - Msub(v) 11.9 ± 0.2. The total amount of reddening, though, differs significantly from cluster to cluster. (author)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
Energy Technology Data Exchange (ETDEWEB)
Boyer, S
2004-10-15
The Thorium cycle Th{sup 232}/U{sup 233} may face brilliant perspectives through advanced concepts like molten salt reactors or accelerator driven systems but it lacks accurate nuclear data concerning some nuclei. Pa{sup 233} is one of these nuclei, its high activity makes the direct measurement of its radiative neutron capture cross-section almost impossible. This difficulty has been evaded by considering the transfer reaction Th{sup 232}(He{sup 3},p)Pa{sup 234}* in which the Pa{sup 234} nucleus is produced in various excited states according to the amount of energy available in the reaction. The first chapter deals with the thorium cycle and its assets to contribute to the quenching of the fast growing world energy demand. The second chapter gives a detailed description of the experimental setting. A scintillation detector based on deuterated benzene (C{sub 6}D{sub 6}) has been used to counter gamma ray cascades. The third chapter is dedicated to data analysis. In the last chapter we compare our experimental results with ENDF and JENDL data and with computed values from 2 statistical models in the 0-1 MeV neutron energy range. Our results disagree clearly with evaluated data: our values are always above ENDF and JENDL data but tend to near computed values. We have also perform the measurement of the radiative neutron cross-section of Pa{sup 231} for a 110 keV neutron: {sigma}(n,{gamma}) 2.00 {+-} 0.14 barn. (A.C.)
Vlachoudis, Vasilis
2000-01-01
The study is centered on the research of the incineration possibility of nuclear waste, by the association of a particle accelerator with a multiplying medium of neutrons, in the project "Energy Amplifier" of C. Rubbia. It consists of the experimental determination of the rates of capture and fission of certain elements (232-Th, 238-U, 237-Np and 239-Pu) subjected to a fluence of fast spallation neutrons. These neutrons are produced by the interaction of high kinetic energy protons (several GeV) provided by the CERN-PS accelerator, on a large lead solid volume. The measurement techniques used in this work, are based on the activation of elements in the lead volume and the subsequent gamma spectroscopy of the activated elements, and also by the detection of fission fragment traces. The development, of a Monte Carlo code makes it possible, on one hand, to better understand the relevant processes, and on the other hand, to validate the code, by comparison with measurements, for the design and the construction of...
Directory of Open Access Journals (Sweden)
Jeng-Huey Chen
2018-04-01
Full Text Available This retrospective study aimed to evaluate the clinicopathological features of 232 cases of radicular cyst (January 2001–December 2016 submitted for histopathological examination to Department of Oral Pathology by endodontists in our institution. Demographic data including age, gender, affected site, involved tooth, and histopathological features, were reviewed. The study population comprised 133 females (57.3% and 99 males (42.7%, with a mean age of 40.5 years and an age range of 13–78 years. Two-hundred and one cysts occurred in the maxilla (86.7% and 31 in the mandible (13.3%. Most cases involved the anterior teeth of the maxilla (67.2%. The most frequently-involved tooth was the maxillary lateral incisor (50.5%. In most cases (228 cases; 98.3%, the cyst was lined with nonkeratinized stratified squamous epithelium, with two cases containing epithelial lining of the mucoepidermoid epithelium (0.9% and respiratory epithelium (0.9%, respectively. One case (0.4% revealed epithelial dysplasia of the epithelial lining. Hyaline body was seen in two cases (0.9%, and Rushton body was noted in seven cases (3.0%. Odontogenic epithelial rest was noted in one case (0.4%. Cholesterol clefts (54 cases; 23.3%, foamy histiocytes (72 cases; 31.0%, hemosiderins (57 cases; 24.6%, dystrophic calcifications (94 cases; 40.5%, foreign bodies (44 cases; 19.0%, and bacterial colonies (22 cases; 9.5% were also observed. Fifty-three cases (22.8% showed a mixed acute and chronic inflammatory infiltrate, whereas chronic inflammatory infiltrate only was noted in 179 cases (77.2%. In summary, the current findings provide a valuable source for clinicopathological reference concerning radicular cysts of the jawbone. Keywords: Periapical cyst, Radicular cyst, Taiwan
Abdullah, Anisa; Hamzah, Zaini; Saat, Ahmad; Wood, Ab. Khalik
2016-01-01
Distribution of radionuclides from anthropogenic activities has been widely studied in marine coastal area. Due to rapid population growth and socio-economic development in Manjung area such as coal fired power plant, iron foundries, port development, waste discharged from factories and agriculture runoff may contribute to increase in pollution rate. The radioactive materials from anthropogenic activities could deteriorate the quality of the marine ecosystem and thus lead to possible radiological health risk to the population. Radionuclides (232Th, 238U and 40K) content in surface and profile sediment from Manjung coastal area was determined in this study. Radionuclides in sediment from seven locations were collected using sediment core sampling and measurements were carried out using Energy Dispersive X-ray Fluorescence (EDXRF) spectroscopy. The results show that the concentration of radionuclides in surface sediment and distribution trend of depth vertical profile sediment generally varies depending on locations. Enrichment factors (EF), geo-accumulation index (Igeo) and pollution index (PI) were applied to determine level of pollution of this study area. The radiological risks related to human exposure were evaluated based on external hazard index (Hex).
International Nuclear Information System (INIS)
Abdullah, Anisa; Hamzah, Zaini; Wood, Ab. Khalik; Saat, Ahmad
2016-01-01
Distribution of radionuclides from anthropogenic activities has been widely studied in marine coastal area. Due to rapid population growth and socio-economic development in Manjung area such as coal fired power plant, iron foundries, port development, waste discharged from factories and agriculture runoff may contribute to increase in pollution rate. The radioactive materials from anthropogenic activities could deteriorate the quality of the marine ecosystem and thus lead to possible radiological health risk to the population. Radionuclides ( 232 Th, 238 U and 40 K) content in surface and profile sediment from Manjung coastal area was determined in this study. Radionuclides in sediment from seven locations were collected using sediment core sampling and measurements were carried out using Energy Dispersive X-ray Fluorescence (EDXRF) spectroscopy. The results show that the concentration of radionuclides in surface sediment and distribution trend of depth vertical profile sediment generally varies depending on locations. Enrichment factors (EF), geo-accumulation index (I geo ) and pollution index (PI) were applied to determine level of pollution of this study area. The radiological risks related to human exposure were evaluated based on external hazard index (H ex )
Neutronic simulation of a research reactor core of (232Th, 235U)O2 fuel using MCNPX2.6 code
International Nuclear Information System (INIS)
Feghhi, Seyed Amir Hossein; Rezazadeh, Marzieh; Kadi, Yacine; ); Tenreiro, Claudio; Aref, Morteza; Gholamzadeh, Zohreh
2013-01-01
The small reactor design for the remote and less developed areas of the user countries should have simple features in view of the lack of infra-structure and resources. Many researchers consider long core life with no on-site refuelling activity as a primary feature for the small reactor design. Long core life can be achieved by enhancing internal conversion rate of fertile to fissile materials. For that purpose, thorium cycle can he adopted because a high fissile production rate of 233 U converted from 232 Th can be expected in the thermal energy region. A simple nuclear reactor core arranged 19 assemblies in hexagonal structure, using thorium-based fuel and heavy water as coolant and moderator was simulated using MCNPX2.6 code, aiming an optimized critical assembly. Optimized reflector thickness and gap between assemblies were determined to achieve minimum neutron leakage and void reactivity. The result was a more compact core, where assemblies were designed having 19-fuel pins in 1.25 pitch-to-diameter ratio. Optimum reflector thickness of 15 cm resulted in minimal neutron leakage in view of economic limitations. A 0.5 cm gap between assembles achieved more safety and 2.2 % enrichment requirements. The present feasibility study suggests a thermal core of acceptable neutronic parameters to achieve a simple and safe core. (author)
Alpha-emitting isotopes and chromium in a coastal California aquifer
International Nuclear Information System (INIS)
Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.
2014-01-01
Highlights: • Alluvium in Piedra de Lumbre basin higher radionuclides likely from natural Th. • Natural uranium decay-chain isotopes, including Ra, present in marine deposits. • Marine deposits also contain low concentrations of chromium. • Radionuclides and chromium concentrations lower in alluvium in the Las Flores basin. - Abstract: The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238 U and its daughter 234 U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232 Th, including its daughter 224 Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ 53 Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development
Study of transfer induced fission and fusion-fission reactions for 28 Si + 232 Th system at 340 MeV
International Nuclear Information System (INIS)
Prete, G.; Rizzi, V.; Fioretto, E.; Cinausero, M.; Shetty, D.V.; Pesente, S.; Brondi, A.; La Rana, G.; Moro, R.; Vardaci, E.; Boiano, A.; Ordine, A.; Gelli, N.; Lucarelli, F.; Bortignon, P.F.; Saxena, A.; Nayak, B.K.; Biswas, D.C.; Choudhury, R.K.; Kapoor, R.S.
2001-01-01
Full text: Fission induced by nucleons transfer has been investigated in the reaction 28 Si + 232 Th at 340 MeV. Looking at the projectile-like-fragments (PLF), the fission yield increases as the transfer increases, but a decreases is observed for transfers with DZ . Light charged particles in coincidence with PLF and Fission have been detected with large solid angle and show an increasing multiplicity as the Z of PLF is reduced and a constant value when fission is requested. The present results indicate inhibition of transfer induced fission reaction for higher Z transfer and increasing probability for decay through charged particle evaporation. Fission is the dominant decay process in heavy reactions involving fissile systems but the dynamical evolution of the composite system is largely governed by the formation and decay mechanisms. Important insight into the formation and the survival probability of the heavy composite nuclei formed in heavy ion collisions can be gained by simultaneously investigate the fission process and light particle emission over a continuous range of excitation energy, angular momentum and fissility. This can be achieved by studying fission induced by transfer of nucleons between the interacting projectile and the target nucleus. In the present work, we have carried out measurements on multinucleon transfer induced fission reactions in 28 Si + 232 Th system at Elab = 340 MeV. The experiment has been performed at the Laboratori Nazionale di Legnaro (LNL) using the 8pLP detector in its final configuration with 257 DE-E telescopes. The backward detectors were used to measure both light charged particles and fission fragments. The projectile-like fragments were detected using separate DE-E telescopes around the grazing angle. Two neutron detectors were placed at a distance of 115.5 cm from the target to measure neutrons emitted in coincidence with fission fragments. Here we present the results of the data analysis of transfer induced fission
Energy Technology Data Exchange (ETDEWEB)
Suzuki-Muresan, Tomo; Perrigaud, Katy; Vandenborre, Johan; Ribet, Solange; Grambow, Bernd [Nantes Univ., CNRS/IN2P3 (France). SUBATECH Unite Mixte de Recherche 6457; Takamasa, Inai [TOKAI Univ., Kanagawa (Japan)
2017-08-01
This work aims to assess the solubility and the surface reactivity of crystallized thorium at pH 3.0 in presence of three types of solids: synthesized powder at 1300 C, crushed kernel, and intact kernel. In this study, the kernel is composed by the core solid from high temperature reactors (HTR) sphere particles. The originality of this work consisted in following in a sequential order the kinetic of dissolution, the surface reactivity in presence of isotope tracer {sup 229}Th, and its desorption process. Long time experiments (634 days) allowed to get deeper understanding on the behavior of the surface reactivity in contact with the solution. Solubility values are ranging from 0.3 x 10{sup -7} mol.L{sup -1} to 3 x 10{sup -7} mol.L{sup -1} with a dissolution rate of 10{sup -6}-10{sup -4} g.m{sup -2} day{sup -1}. PHREEQC modeling showed that crystallized ThO{sub 2}(cr, 20 nm) phase controls the equilibrium in solution. Isotope exchange between {sup 229}Th and {sup 232}Th indicated that well-crystallized phase exist as an inert surface regarding to the absence of exchange between surface solid and solution.
Delayed Fission Gamma-ray Characteristics of Th-232 U-233 U-235 U-238 and Pu-239
Energy Technology Data Exchange (ETDEWEB)
Lane, Taylor [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Parma, Edward J. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)
2015-08-01
Delayed fission gamma-rays play an important role in determining the time dependent ioniz- ing dose for experiments in the central irradiation cavity of the Annular Core Research Reactor (ACRR). Delayed gamma-rays are produced from both fission product decay and from acti- vation of materials in the core, such as cladding and support structures. Knowing both the delayed gamma-ray emission rate and the time-dependent gamma-ray energy spectrum is nec- essary in order to properly determine the dose contributions from delayed fission gamma-rays. This information is especially important when attempting to deconvolute the time-dependent neutron, prompt gamma-ray, and delayed gamma-ray contribution to the response of a diamond photo-conducting diode (PCD) or fission chamber in time frames of milliseconds to seconds following a reactor pulse. This work focused on investigating delayed gamma-ray character- istics produced from fission products from thermal, fast, and high energy fission of Th-232, U-233, U-235, U-238, and Pu-239. This work uses a modified version of CINDER2008, a transmutation code developed at Los Alamos National Laboratory, to model time and energy dependent photon characteristics due to fission. This modified code adds the capability to track photon-induced transmutations, photo-fission, and the subsequent radiation caused by fission products due to photo-fission. The data is compared against previous work done with SNL- modified CINDER2008 [ 1 ] and experimental data [ 2 , 3 ] and other published literature, includ- ing ENDF/B-VII.1 [ 4 ]. The ability to produce a high-fidelity (7,428 group) energy-dependent photon fluence at various times post-fission can improve the delayed photon characterization for radiation effects tests at research reactors, as well as other applications.
International Nuclear Information System (INIS)
Schupfner, R.
2016-01-01
The determination of the activity concentration of the radionuclides "1"4C/C and "9"0Sr/Ca and "2"2"8Th/"2"3"2Th applying combined radionuclide analyses methods has been proved to be a suitable tool for the purpose of an unambiguous age determination of elephant ivory [1, 2, 3, 10, 11, 12, 13]. Analysing representative and independently dated samples (N = 28) of ivory the curves fitting the post mortal interval (PMI) versus the activity concentration of the radionuclides mentioned above produced the data base enabling a more unambiguous age determination. Data from these studies origin [1, 2, 3, 10, 11, 12, 13] in analyses of ivory samples which were available up to the 2012. During the last five years there was a gap in information of the future trend of "1"4C/C and "9"0Sr/Ca. Up to this study it was not possible to assess whether the future level of "1"4C/C as well as "9"0Sr/Ca can analytically be distinguished from the level before 1954. At about 1954 the activity concentration of radionuclides from the atmospheric nuclear explosion, as "1"4C and "9"0Sr, increased in ivory significantly. This study aims in closing this information gap. The results of analyses of "1"4C/C, "9"0Sr/Ca, "2"2"8Th/"2"3"2Th in ivory with PMI values ranging from 1 to 5 years are presented and interpreted. These data enable an actualization of the calibration curves of PMI versus specific activities. This is necessary for a better understanding of the effect of blindness of "1"4C/C dating and its prevention. On the base of all available results form independent dated ivory sample available up to 2015 a suitable analytical procedure is suggested which aims in a more precise and reliable age determination of elephant tusks. Results of determining of radionuclides "1"4C/C and "9"0Sr/Ca and "2"2"8Th/"2"3"2Th in ivory are shown from before 1950 to 2015. These results are discussed with respect the purposes of dating as well as their significance to the radiation protection of nonhuman species.
Energy Technology Data Exchange (ETDEWEB)
Vapirev, E I; Jordanov, T; Christoskov, I [Sofia Univ. (Bulgaria). Fizicheski Fakultet
1994-12-31
The idea of conversion of highly enriched uranium (HEU) from warheads without mixing it with natural uranium as well as the utilization of plutonium as fuel component is discussed. A nuclear fuel which is a mixture of 4% {sup 235}U (HEU) as a fissile isotope and 96 % {sup 232}Th (ThO{sub 2}) as a non-fissile isotope in a mixed oxide with thorium fuel is proposed. It is assumed that plutonium can also be used in the proposed fuel in a mixture with {sup 235}U. The following advantages of the use of HEU in LWRs in mixed {sup 235}U - Th fuel are pointed out: (1) No generation of long-living plutonium and americium isotopes (in case of reprocessing the high level radioactive wastes will contain only fission fragments and uranium); (2) The high conversion ratio of Th extends the expected burnup by approximately 1/3 without higher initial enrichment (the same initial enrichment simplifies the problem for compensation of the excess reactivity in the beginning with burnable poison and boric acid); (3) The high conversion ratio of Th allows the fuel utilization with less initial enrichment (by approx. 1/3) for the same burnup; thus less excess reactivity has to be compensated after reloading; in case of fuel reprocessing all fissile materials ({sup 235}U + {sup 233}U) could be chemically extracted. Irrespectively to the optimistic expectations outlined, further work including data on optimal loading and reloading schemes, theoretical calculations of thermal properties of {sup 235}U + Th fuel rods, manufacturing of several test fuel assemblies and investigations of their operational behaviour in a reactor core is still needed. 1 fig., 7 refs.
International Nuclear Information System (INIS)
Raics, P.; Nagy, S.; Daroczy, S.; Kornilov, N.V.
1990-10-01
(n,2n) reaction cross sections have been determined for 238 U and 232 Th by using the activation method. Neutrons were produced in D-T reaction by bombarding a TiT target with analyzed deuteron beam from a Cockcroft-Walton accelerator. Neutron energy was varied by changing the emission angle to the deuteron beam. The activities of the 237 U and 231 Th residual nuclei were measured by a Ge(Li) and a HP Ge gamma-spectrometer, respectively. Several standard reactions were used for the determination of the neutron flux density. An overall precision of 3.5 - 4.5% was estimated and a 1.4 - 3.5% reproducibility was achieved. Comparison of the recent results to literature data and a brief analysis of the monitor reactions are given. (author). 48 refs, 3 figs, 7 tabs
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
Energy Technology Data Exchange (ETDEWEB)
Colmenero Sujo, L.; Montero Cabrera, M.E. E-mail: elena.montero@cimav.edu.mx; Villalba, L.; Renteria Villalobos, M.; Torres Moye, E.; Garcia Leon, M.; Garcia-Tenorio, R.; Mireles Garcia, F.; Herrera Peraza, E.F.; Sanchez Aroche, D
2004-07-01
High-resolution gamma spectrometry was used to determine the concentration of {sup 40}K, {sup 238}U and {sup 232}Th series in soil samples taken from areas surrounding the city of Aldama, in Chihuahua. Results of indoor air short-time sampling, with diffusion barrier charcoal detectors, revealed relatively high indoor radon levels, ranging from 29 to 422 Bq/m{sup 3}; the radon concentrations detected exceeded 148 Bq/m{sup 3} in 76% of the homes tested. Additionally, liquid scintillation counting showed concentrations of radon in drinking water ranging from 4.3 to 42 kBq/m{sup 3}. The high activity of {sup 238}U in soil found in some places may be a result of the uranium milling process performed 20 years ago in the area. High radon concentrations indoor and in water may be explained by assuming the presence of uranium-bearing rocks underneath of the city, similar to a felsic dike located near Aldama. The estimated annual effective dose of gamma radiation from the soil and radon inhalation was 3.83 mSv.
Colmenero Sujo, L; Montero Cabrera, M E; Villalba, L; Rentería Villalobos, M; Torres Moye, E; García León, M; García-Tenorio, R; Mireles García, F; Herrera Peraza, E F; Sánchez Aroche, D
2004-01-01
High-resolution gamma spectrometry was used to determine the concentration of 40K, 238U and 232Th series in soil samples taken from areas surrounding the city of Aldama, in Chihuahua. Results of indoor air short-time sampling, with diffusion barrier charcoal detectors, revealed relatively high indoor radon levels, ranging from 29 to 422 Bq/m3; the radon concentrations detected exceeded 148 Bq/m3 in 76% of the homes tested. Additionally, liquid scintillation counting showed concentrations of radon in drinking water ranging from 4.3 to 42 kBq/m3. The high activity of 238U in soil found in some places may be a result of the uranium milling process performed 20 years ago in the area. High radon concentrations indoor and in water may be explained by assuming the presence of uranium-bearing rocks underneath of the city, similar to a felsic dike located near Aldama. The estimated annual effective dose of gamma radiation from the soil and radon inhalation was 3.83 mSv.
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
Stoop, P.; Lembrechts, J.
1993-04-01
Radiation protection policy in the Netherlands applies to human activities in which ionizing radiation presents a hazard, not to naturally occurring sources of radiation. The risk levels (maximum permissible risk and negligible risk) apply to sources of radiation that cause an additional risk. Translation of these levels into practical environmental quality objectives therefore implies that both the extent and the origin of the risk are determined. The distinction between the natural and the additional radiation dose is of particular interest. In this report various possibilities are described for measuring, explaining and predicting the naturally occurring concentrations of the precursors of the element radon in the two radioactive decay series starting with 238 U and 232 Th. Several methods are given that may be used to derive environmental quality objectives for the soil with respect to these radionuclides. These environmental quality objectives are an important basis for among other things the soil sanitation policy. The nature of the radionuclides considered may have consequences for the choice of sanitation techniques. Because possible sources and cases of soil pollution may have important consequences for the Dutch policy on soil sanitation, a short overview is given of data published on these subjects. The foundation and the control of intervention levels requires insight in the relative importance of pollution pathways. As a result, pathways have been given ample attention. 9 figs., 17 tabs., 66 refs
Energy Technology Data Exchange (ETDEWEB)
Abdullah, Anisa, E-mail: coppering@ymail.com; Hamzah, Zaini; Wood, Ab. Khalik [Faculty of Applied Sciences, Universiti Teknologi MARA, 40450, Shah Alam, Selangor (Malaysia); Saat, Ahmad [Faculty of Applied Sciences, Universiti Teknologi MARA, 40450, Shah Alam, Selangor (Malaysia); Institute of Science, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia)
2016-01-22
Distribution of radionuclides from anthropogenic activities has been widely studied in marine coastal area. Due to rapid population growth and socio-economic development in Manjung area such as coal fired power plant, iron foundries, port development, waste discharged from factories and agriculture runoff may contribute to increase in pollution rate. The radioactive materials from anthropogenic activities could deteriorate the quality of the marine ecosystem and thus lead to possible radiological health risk to the population. Radionuclides ({sup 232}Th, {sup 238}U and {sup 40}K) content in surface and profile sediment from Manjung coastal area was determined in this study. Radionuclides in sediment from seven locations were collected using sediment core sampling and measurements were carried out using Energy Dispersive X-ray Fluorescence (EDXRF) spectroscopy. The results show that the concentration of radionuclides in surface sediment and distribution trend of depth vertical profile sediment generally varies depending on locations. Enrichment factors (EF), geo-accumulation index (I{sub geo}) and pollution index (PI) were applied to determine level of pollution of this study area. The radiological risks related to human exposure were evaluated based on external hazard index (H{sub ex})
International Nuclear Information System (INIS)
Leal, B.; Mireles, F.; Quirino, L.; Davila, I.; Ramirez, F.
2003-01-01
The necessity to report the changes in the contained radionuclides in the terrestrial crust, or those deposited by the atomic tests around the world, becomes clear when observing the use of material of waste of those mines. With the purpose of quantifying the concentration in activity its were meet a series of waste samples in mines of the municipalities of Zacatecas, Fresnillo, Guadalupe and Veta Grande of the state of Zacatecas, Mexico. The analysis was carried out by gamma spectrometry with a HPGe detector with a resolution of 1.9 keV corresponding to an energy of 1.33 MeV calibrated in efficiency and energy by means of a certified standard multi nuclide in activity with identical geometry to that of the samples. The times of count are of 80000 seconds, with the purpose of to reduce the relative uncertainties and to define well the interest regions. The activity of 226 Ra and 232 Th is obtained through the one 214 Bi and 228 Ac respectively, the concentration was also measured in activity of the one 40 K and the 137 Cs in units of Bq kg -1 . (Author)
International Nuclear Information System (INIS)
Demirel, H.; Parmaksiz, A.; Vural, M.; Cakir, I.T.; Demircioglu, B.; Yucel, H.
2004-01-01
Full text: Phosphatic fertilizers are produced from the industrial processing of rock phosphate ores which are known to contain naturally occurring radionuclides such as 238 U and its daughter products. A high volume by-product known as phosphogypsum (PG) from the production of phosphoric acid and phosphate fertilizer causes serious storage and environmental problems in phosphoric acid industries. During the phosphoric acid production process, 226 Ra (t 1/2 =1600 y) ends up in PG which has chemical analogous to calcium element. Since the stockpiles of PG near the phosphatic fertilizer plants are huge amounts, the radioactivity contained in PG has measured in view of environmental radioactivity problem. In this work, the natural radioactivity in eighty PG samples taken from a stock near Samsun phosphoric fertilizer plant was measured by a high resolution gamma ray spectrometer. The mean activity of 226 Ra in PG samples has been found to be 546 Bq.kg -1 . However, the activities of 232 Th and 40 K measured in PG samples are negligibly small. In the presented paper, the gamma spectrometric method employed for this work is discussed and the radiological risk impact of radon gas emanation from 226 Ra mainly contained in PG, has been assessed
Energy Technology Data Exchange (ETDEWEB)
Leal, B.; Mireles, F.; Quirino, L.; Davila, I.; Ramirez, F. [UAZ, A.P. 579C, 98068 Zacatecas (Mexico)
2003-07-01
The necessity to report the changes in the contained radionuclides in the terrestrial crust, or those deposited by the atomic tests around the world, becomes clear when observing the use of material of waste of those mines. With the purpose of quantifying the concentration in activity its were meet a series of waste samples in mines of the municipalities of Zacatecas, Fresnillo, Guadalupe and Veta Grande of the state of Zacatecas, Mexico. The analysis was carried out by gamma spectrometry with a HPGe detector with a resolution of 1.9 keV corresponding to an energy of 1.33 MeV calibrated in efficiency and energy by means of a certified standard multi nuclide in activity with identical geometry to that of the samples. The times of count are of 80000 seconds, with the purpose of to reduce the relative uncertainties and to define well the interest regions. The activity of {sup 226} Ra and {sup 232} Th is obtained through the one {sup 214} Bi and {sup 228} Ac respectively, the concentration was also measured in activity of the one {sup 40} K and the {sup 137} Cs in units of Bq kg{sup -1}. (Author)
Energy Technology Data Exchange (ETDEWEB)
Chel, Arvind; Tiwari, G.N. [Center for Energy Studies (CES), Indian Institute of Technology, Hauz Khas, New Delhi 110 016 (India)
2011-04-15
This paper presents rigorous experimental outdoor performance of a 2.32 kW{sub P} stand-alone photovoltaic (SAPV) system in New Delhi (India) for four weather types in each month such as clear, hazy, partially cloudy/foggy and fully cloudy/foggy weather conditions respectively. The daily power generated from the existing SAPV system was experimentally found in the range of 4-6 kW h/day depending on the prevailing sky conditions. The number of days and daily power generated corresponding to four weather types in each month were used to determine monthly and subsequently annual power generation from the existing SAPV system. There are three daily load profiles with and without earth to air heat exchanger suitable for three seasons like summer (3.75-6.15 kW h/day), winter (2.79-5.19 kW h/day) and rainy (3.75 kW h/day). The hourly efficiency of the SAPV system components are determined and presented in this paper. The life cycle cost (LCC) analysis for the existing typical SAPV system is carried out to determine unit cost of electricity. The effect of annual degradation rate of PV system efficiency is also presented in this paper. The energy production factor (EPF) and the energy payback time (EPBT) of the SAPV system was also determined and presented in this paper. (author)
Viktrup, Lars; Rortveit, Guri; Lose, Gunnar
2008-07-01
Assess the impact of subsequent urinary incontinence risk factors in women with different urinary incontinence history. In a cohort study 232 women answered validated questions about urinary incontinence after the first delivery and 12 years later. Women who were continent during the first pregnancy or postpartum period (group 1) or who became incontinent during these periods (group 2) were identified. Urinary incontinence symptoms 12 years after the first delivery were reported by 32.6% (44/135) in group 1 and 66.0% (64/97) in group 2. Overweight and to a minor extent pelvic organ prolapse symptoms or heavy lifting at work was associated with higher relative risk of urinary incontinence in group 1 compared with group 2. Other risk factors such as age, breastfeeding 6 months or longer after both the first and second deliveries, bowel movements or urinary infections were not associated differentially with urinary incontinence in the 2 groups. Subsequent risk factors had a more significant impact in women without initial urinary incontinence.
Directory of Open Access Journals (Sweden)
Clint L Miller
Full Text Available Coronary heart disease (CHD is the leading cause of mortality in both developed and developing countries worldwide. Genome-wide association studies (GWAS have now identified 46 independent susceptibility loci for CHD, however, the biological and disease-relevant mechanisms for these associations remain elusive. The large-scale meta-analysis of GWAS recently identified in Caucasians a CHD-associated locus at chromosome 6q23.2, a region containing the transcription factor TCF21 gene. TCF21 (Capsulin/Pod1/Epicardin is a member of the basic-helix-loop-helix (bHLH transcription factor family, and regulates cell fate decisions and differentiation in the developing coronary vasculature. Herein, we characterize a cis-regulatory mechanism by which the lead polymorphism rs12190287 disrupts an atypical activator protein 1 (AP-1 element, as demonstrated by allele-specific transcriptional regulation, transcription factor binding, and chromatin organization, leading to altered TCF21 expression. Further, this element is shown to mediate signaling through platelet-derived growth factor receptor beta (PDGFR-β and Wilms tumor 1 (WT1 pathways. A second disease allele identified in East Asians also appears to disrupt an AP-1-like element. Thus, both disease-related growth factor and embryonic signaling pathways may regulate CHD risk through two independent alleles at TCF21.
Energy Technology Data Exchange (ETDEWEB)
Jung, Yoon Hee; Lim, Jong Myoung; Ji, Young Yong; Kim, Hyun Cheol; Kim, Chang Jong; Park, Ji Yong; Chung, Kun Ho; Kang, Mun Ja [KAERI, Daejeon (Korea, Republic of)
2016-05-15
In this study, radio-activities of {sup 238}U, {sup 232}Th, {sup 40}K, and {sup 226}Ra occurring in raw materials and by-products at phosphate processing facility were complementally determined using ED-XRF, γ-spectrometry and ICP-MS method. Although the degree of immersion in the human body varies depending on the particle size and density, the particle size is especially used as a key factor in assessing dose. Thus, size distribution characteristics of {sup 238}U concentrations in airborne particulates collected at the phosphate processing facility were also evaluated. The naturally occurring radioactive materials (NORM) are widely spread throughout the environment, it occupies the largest part of public radioactivity exposure. According to report of the US National Academy of Sciences, 82% of the human radiation dose received annually comes from the natural radionuclides. Radiation exposure doses from natural radionuclides is not significantly concerned level compared to those from artificial radionuclides which could be released into the environment by nuclear tests and power plant accident. It could make a serious risk problem to unspecific public when exposed to the natural radionuclides during long-term period at high activity concentration levels. Therefore, it is essential to make a professional and systematic approach for the proper handling and diminution.
International Nuclear Information System (INIS)
Damatto, Sandra Regina
2010-01-01
Baixada Santista is the region of higher population of the coast of Sao Paulo State, where it is located the largest port in Latin America, in the city of Santos, and the most important industrial complex of Latin America, in the city of Cubatao. This region has received in recent years a considerable load of industrial and domestic effluents in its water bodies, as a direct result of the industrial and port activities and the large population growth in recent decades, and is considered nowadays highly impacted. In the present study sediment cores were collected in the estuary of Santos-Cubatao, in the estuary of Sao Vicente, in the channel of Bertioga and Santos Bay, in order to determine the concentration of trace and major elements and natural radionuclides from the 238 U and 232 Th series. The techniques used were neutron activation analysis, X-ray fluorescence and gamma spectrometry, respectively. The obtained values for the elements Cr, Sb, Ta and Zn in some cores, are higher than data from literature, and can indicate a possible anthropic contribution. Comparing the obtained values of Cr and Zn elements determined in the sediment cores with the values of TEL and PEL index for sediment quality, it was verified that the studied region presents Cr levels higher than TEL in Santos-Cubatao estuary and Bertioga channel and Zn element presented values higher than TEL for some core slices of Santos-Cubatao estuary, for one core of Sao Vicente estuary, one core in Bertioga channel and Santos Bay. For the other elements, the values obtained in this study can be considered as reference values for the region. Although the element As presented higher values than the TEL in all the studied environments, the concentrations obtained are of the same order of magnitude as literature data and, therefore, can be considered also as reference values for the region. No enrichment was found for the major elements in all the ecosystems studied, with the exception for the element P
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
Directory of Open Access Journals (Sweden)
Zilton A. Andrade
1983-09-01
Full Text Available Uma análise de 232 necrópsias completas realizadas em portadores de esquistossomose hepática avançada evidenciou em todos a lesão constante e característica de fibrose periportal com alterações destrutivas e obstrutivas de ramos intra-hepáticos da veia porta. Geralmente esta lesão estava associada a sinais de hipertensão porta (esplenomegalia e varizes do esôfago, constitutindo-se na forma hépato-esplênica mas em 12 casos estes sinais não existiam (a forma hepática avançada. Ao passar para a fase descompensada da esquistossomose hépato-esplênica, o fígado geralmente exibia uma acentuação da fibrose ao lado de sinais de inflamação crônica ativa, mas não mostrava uma evolução para a cirrose difusa. A esplenomegalia se acompanhou de lesões congestivas crônicas e de evidências de hiperplasia celular, especialmente no setor fagocítico mononucelar. Excepecionalmente se superajuntou a tais lesões um linfoma tipo nodular, o qual tende a ocorrer em mulheres após os 45 anos de idade. O envolvimento intestinal foi muito menor do que se poderia esperar. As lesões mais salientes foram a fibrose peri-intestinal, qua não parece ter maior repercussão clínica, e, raramente, as lesões pseudoneoplásicas e os polipos. Uma complicação freqüente foi o cor pulmonale secundário às elsões de arterite pulmonar esquistossomótica, que apareceu em 44 casos (18,9%. O aparecimento de doença renal associada se deu em 15% dos casos e foi geralmente representada por glomerulonefrite crônica, o que se presume seja devido a um processo mediado por complexos imunes na esquistossomose. Muitos dos casos exibiam infecções intercorrentes, com algumas delas, como a salmonelose e a hepatite viral, tendendo a ter um curso mais prolongado. Assim a esquistossomose avançada se apresentou um processo que atinge fundamentalmente of fígado, mas que repercute em vários outros órgãos através uma patogenia variada, complexa, ainda não bem
Energy Technology Data Exchange (ETDEWEB)
Michel, H.; Levent, D.; Barci, V.; Barci-Funel, G.; Hurel, C. [Laboratoire de Radiochimie, Sciences Analytiques et Environnement (LRSAE), Universite de Nice Sophia-Antipolis 06108 Nice Cedex (France)
2008-07-01
A new sequential method for the determination of both natural (U, Th) and anthropogenic (Sr, Cs, Pu, Am) radionuclides has been developed for application to soil and sediment samples. The procedure was optimised using a reference sediment (IAEA-368) and reference soils (IAEA-375 and IAEA-326). Reference materials were first digested using acids (leaching), 'total' acids on hot plate, and acids in microwave in order to compare the different digestion technique. Then, the separation and purification were made by anion exchange resin and selective extraction chromatography: Transuranic (TRU) and Strontium (SR) resins. Natural and anthropogenic alpha radionuclides were separated by Uranium and Tetravalent Actinide (UTEVA) resin, considering different acid elution medium. Finally, alpha and gamma semiconductor spectrometer and liquid scintillation spectrometer were used to measure radionuclide activities. The results obtained for strontium-90, cesium-137, thorium-232, uranium- 238, plutonium-239+240 and americium-241 isotopes by the proposed method for the reference materials provided excellent agreement with the recommended values and good chemical recoveries. (authors)
International Nuclear Information System (INIS)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs
48 CFR 1852.232-70 - NASA modification of FAR 52.232-12.
2010-10-01
... AND SPACE ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of... accepted accounting principles, subject to any applicable subparts of part 31 of the Federal Acquisition... marked “Small Business Innovation Research Contract” or “Small Business Technology Transfer Contract,” as...
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Aparin, B. F.; Mingareeva, E. V.; Sanzharova, N. I.; Sukhacheva, E. Yu.
2017-12-01
Data on the concentrations of natural (226Ra, 232Th and 40K) and artificial (137Cs) radionuclides and on the physicochemical properties of chernozems sampled in different years are presented. In 1952, upon the creation of the Penza-Kamensk state shelterbelt, three deep (up to 3 m) soil pits were examined within the former arable field under two-year-old plantations of ash and maple along the transect crossing the territory of the Beloprudskaya Experimental Station of the USSR Academy of Sciences in Volgograd oblast. The samples from these pits were included into the collection of dated soil samples of the Dokuchaev Central Soil Science Museum. Five pits were examined along the same transect in 2009: three pits under shelterbelts (analogues of the pits studied in 1952) and two pits on arable fields between the shelterbelts. In the past 57 years, certain changes took place in the soil structure, bulk density, and the content and composition of humus. The salt profile of soils changed significantly under the forests. The comparison of distribution patterns of natural soil radionuclides in 1952 and 2009 demonstrated their higher contents at the depth of 10-20 cm in 2009 (except for the western shelterbelt). Background concentrations of natural radionuclides in parent materials and relationships between their distributions and the salt profiles of soils have been determined; they are most clearly observed is the soils under shelterbelts. Insignificant contamination with 137Cs (up to 34 Bq/kg) has been found in the samples of 2009 from the upper (0-20 cm) horizon. The activity of 137Cs regularly decreases from the east to the west; the highest concentrations of this radionuclide are found in the topmost 10 cm. This allows us to suppose that 137Cs was brought with aerial dust by eastern winds, and the shelterbelts served as barriers to the wind flow.
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
African Journals Online (AJOL)
AKA BOKO
The electric conductivity average of groundwaters studied shows important variations of 1.7 mS/cm (south east part) to 7 mS/cm (coastal areas). Indeed it shows ... Cependant, l'exploitation de ces nappes pose des problèmes complexes car elle associe la notion des réserves des eaux souterraines à celle de leur qualité ...
Wang, Jingyuan; Tatsumoto, M.; Li, X.; Premo, W.R.; Chao, E.C.T.
1994-01-01
We have obtained precise Th-Pb internal isochron ages on monazite and bastnaesite for the world's largest known rare earth elements (REE)-Fe-Nb ore deposit, the Bayan Obo of Inner Mongolia, China. The monazite samples, collected from the carbonate-hosted ore zone, contain extremely small amounts of uranium (less than 10 ppm) but up to 0.7% ThO2. Previous estimates of the age of mineralization ranged from 1.8 to 0.255 Ga. Magnetic fractions of monazite and bastnaesite samples (<60-??m size) showed large ranges in 232Th 204Pb values (900-400,000) and provided precise Th-Pb internal isochron ages for paragenetic monazite mineralization ranging from 555 to 398 Ma within a few percent error (0.8% for two samples). These results are the first indication that REE mineralization within the giant Bayan Obo ore deposit occurred over a long period of time. The initial lead isotopic compositions (low 206Pb 204Pb and high 208Pb 204Pb) and large negative ??{lunate}Nd values for Bayan Obo ore minerals indicate that the main source(s) for the ores was the lower crust which was depleted in uranium, but enriched in thorium and light rare earth elements for a long period of time. Zircon from a quartz monzonite, located 50 km south of the ore complex and thought to be related to Caledonian subduction, gave an age of 451 Ma, within the range of monazite ages. Textural relations together with the mineral ages favor an epigenetic rather than a syngenetic origin for the orebodies. REE mineralization started around 555 Ma (disseminated monazite in the West, the Main, and south of the East Orebody), but the main mineralization (banded ores) was related to the Caledonian subduction event ca. 474-400 Ma. ?? 1994.
Energy Technology Data Exchange (ETDEWEB)
Flores, Osvaldo Brigido; Barreras Caballero, Aldo A.; Montalvan Estrada, Adelmo; Queipo Garcia, Maite [Ministerio da Ciencia, Tecnologia y Medio Ambiente, Camaguey (Cuba). Centro de Atencion a la Actividad Nuclear. Lab. de Vigilancia Radiologica Ambiental]. E-mail: sean@caonao.cmw.inf.cu; Zerquera, Juan Tomas [Centro de Proteccion y Higiene de las Radiaciones, La Habana (Cuba)
2001-07-01
A survey programme aimed at studying the environmental radioactivity in the Province of Camaguey in the eastern region of Cuba was undertaken. The average concentrations of {sup 226} Ra, {sup 232} Th, and {sup 40} K in the surveyed soils were 26.4, 11.5 and 210 Bq.kg{sup -1}, respectively. The man-made radionuclide found was {sup 137} Cs and its concentration was similar to those reported in regions affected only by global radioactive fallout, (7.9 Bq.kg{sup -1}). Radiological measurements carried out with a portable ionization chamber RSS-112 at the sampled sites revealed an average outdoor absorbed dose rate of 59.0 nGy.h{sup -1} due to cosmic rays and terrestrial gamma radiation. Computed dose rates obtained through the UNSCEAR(1993) dose coefficients range from 4-182 nGy.h{sup -1}, with a mean value of 27.8 nGy.h{sup -1}, due to natural terrestrial gamma radiation. Ratio of Indoor to Outdoor absorbed dose rates in air was 1.75. The average value of absorbed dose rate in air for the ionizing component of cosmic rays was 31.8 nGy.h{sup -1} at sea level. Because of the 95% of the Camaguey population lives at altitudes close to sea level (10-100 m), the absorbed dose rate in outdoor air from ionizing component of cosmic rays was estimated to be 32.3 nGy.h{sup -1}. An annual average effective dose equivalent of 510 {mu}Sv was estimated for Camaguey population due to the ionizing component of cosmic and gamma terrestrial radiation. This value is lower than the 760 {mu}Sv.year{sup -1} estimated as a world average by UNSCEAR (1993). (author)
Temporal variation and provenance of thorium deposition observed at Tsukuba, Japan
International Nuclear Information System (INIS)
Hirose, Katsumi; Kikawada, Yoshikazu; Igarashi, Yasuhito
2012-01-01
Temporal variations of monthly thorium (Th) deposition observed at Tsukuba, Japan during the period 1990–2007, comparing with plutonium deposition, was studied. The monthly 232 Th deposition as did 239,240 Pu, varied according to season and inter-annually. In particular, 232 Th deposition increased significantly in spring coinciding with Asian dust (Kosa) events. The 230 Th/ 232 Th activity ratios vary according to sources and can therefore be used to differentiate between locally derived and remotely derived 232 Th. The 230 Th/ 232 Th activity ratios in deposition samples showed large variability with high ratios occurring in early spring. These high 230 Th/ 232 Th ratios in deposition can be attributed to local dust storms, especially in early spring, that cause resuspension of soils from cultivated fields which are characterized by high 230 Th/ 232 Th activity ratios. The results reveal that both locally and remotely derived 232 Th deposition showed seasonal variations with maxima in spring, although the remotely derived fraction is dominant rather than the locally derived one. The 232 Th deposition maxima later in spring is attributable to the remotely derived fraction, corresponding to the Kosa events. Annual 232 Th deposition exhibited an increasing trend, suggesting the presence of sources other than soil dust such as fly ash from increasing coal burning. - Highlights: ► We show monthly Th deposition observed at Tsukuba, Japan from 1990 to 2007. ► The Th deposition shows a seasonal variation and inter-annual variability. ► Th isotope ratios ( 230 Th/ 232 Th) are used to identify its sources. ► The long-term trend of Th deposition is related to increasing anthropogenic input.
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
International Nuclear Information System (INIS)
Ngachin, M; Njock, M G Kwato; Garavaglia, M; Giovani, C; Scruzzi, E; Nourreddine, A; Lagos, L
2008-01-01
This work deals with the measurement of radioactivity and radon exhalation rate from building materials manufactured in Douala city from geological materials. Nine types of building material were surveyed for their natural radioactivity contents using high-resolution gamma-ray spectrometry. The activity concentrations for 226 Ra, 232 Th and 40 K varied from 11.5 to 49 Bq kg -1 , 16 to 37 Bq kg -1 and 306 to 774 Bq kg -1 , respectively. The absorbed dose rate in the samples investigated at 1 m above ground level ranged from 28.5 to 66.6 nGy h -1 . External and internal hazard indices were also estimated as defined by the European Commission. The Ra equivalents of the materials studied ranged from 57.5 to 133 Bq kg -1 and are much smaller than the recommended limit of 370 Bq kg -1 for construction materials for dwellings. Polycarbonate nuclear track detectors (NTDs), type CR-39, were used for measuring the radon concentration from different materials. In fact, knowledge of the radon exhalation rate from building materials is important for understanding the individual contribution of each material to the total indoor radon exposure. Samples were hermetically closed in glass vessels and the radon growth was followed as a function of time. The radon exhalation rate was therefore derived from the experimental measurement of α-track densities. The radon exhalation varied from (5.77 ± 0.06) x 10 -5 to (7.61 ± 0.07) x 10 -5 Bq cm -2 h -1 in bricks, from (5.79 ± 0.05) x 10 -5 to (11.6 ± 0.12) x 10 -5 in tiles, and was (6.95 ± 0.03) x 10 -5 Bq cm -2 h -1 in concrete. A correlation (correlation coefficient approx. = 0.8) was found between radium concentration measured with a HPGe detector and the radon exhalation rate obtained using nuclear track detectors
Radiologic evaluation of colorectal cancer
International Nuclear Information System (INIS)
Lee, Young Joong; Kang, Hee Tae; Kim, Jong Deok; Rhee, Hak Song
1984-01-01
The incidence of colorectal cancer of Korea is much lower than that of Western countries, but has shown a tendency to a slight increase recently. Barium enema is the most valuable, noninvasive and inexpensive method available to evaluate the size, shape and site of colorectal cancer. The authors reviewed and radiologically classified barium enema studies of 232 cases of colorectal cancer from Aug. 1967 to July 1982 at Presbyterian Medical Center, Jeonju, Confirmed clinically, operatively and pathologically. The results were as follows; 1. The ratio of male and female was 1.3:1, and youngest was 13 year-old and the oldest 86 year-old. 2. The peak incidence occurred from 5th to 7th decades, accounting for 78% of all cases (181/232), and there was a relatively high incidence of the disease in patients below 30 years of age at 7.8% (18/232). 3. Rectum and rectosigmoid region are the most frequently involved regions (127/232:54.8%). 4. The positivity of barium enema examination was 4.0% (232/5807), and its accuracy was 96.5% (224/232). 5. The radiologic findings were classified into 4 groups, and they were annular encircling 62.9% (146/232). polypoid fungating 26.8% (62/232), infiltrating 8.6% (20/232), and primary ulcerating 1.7% (4/232) in order of frequency. 6. The linear length of the cancer ranged from 1.5 Cm to 15 Cm, and the average length was 5.5 Cm. 7. There was no statistical correlation between the length of lesion, the site, and the radiologic findings, and stages of the lesion (P:0.750-0.250). 8. The majority of colorectal cancers was adenocarcinoma (217/232:93.6%)
2013-11-15
... DFARS 252.232-7007, Limitation of Government's Obligation. DFARS subpart 232.7, Contract [[Page 68830...; Defense Federal Acquisition Regulation Supplement; Contract Financing AGENCY: Defense Acquisition... and OMB Number: Defense Federal Acquisition Regulation Supplement (DFARS) Part 232, Contract Financing...
International Nuclear Information System (INIS)
Paiva, Eduardo de
1997-04-01
Fission reactions induced in 235 U, 238 U, 232 Th, 209 Bi nat Pb, 197 Au, nat Pt, nat W, 181 Ta. and 27 Al nuclei by monochromatic photons of 69 MeV produced at the LADON facility of the Frascati National Laboratories (INFN-LNF, Frascati, Italy) have been analyzed on the basis of a simplified two-step model. In the first step of the reaction the incoming photon is considered to be absorbed by a neutron-proton pair ('quasi-deuteron') leading to excitation of the nucleus, followed, in the second step, by a mechanism of particle evaporation-fission competition for the excited residual nucleus. Estimates of nuclear fissility at 69 MeV show to be critically dependent on the parameter r (ratio of the level-density parameter at the fission saddle point to the level-density parameter of the residual nucleus after neutron evaporation), which can be determined in a semiempirical way from induced fission reaction data for various nuclei obtained at 60 - 80 MeV of excitation energy. Fissilities calculated by means of the simplified photofission reactions model are then compared with experimental data available in the literature. (author)
Uranium production in thorium/denatured uranium fueled PWRs
International Nuclear Information System (INIS)
Arthur, W.B.
1977-01-01
Uranium-232 buildup in a thorium/denatured uranium fueled pressurized water reactor, PWR(Th), was studied using a modified version of the spectrum-dependent zero dimensional depletion code, LEOPARD. The generic Combustion Engineering System 80 reactor design was selected as the reactor model for the calculations. Reactors fueled with either enriched natural uranium and self-generated recycled uranium or uranium from a thorium breeder and self-generated recycled uranium were considered. For enriched natural uranium, concentrations of 232 U varied from about 135 ppM ( 232 U/U weight basis) in the zeroth generation to about 260 ppM ( 232 U/U weight basis) at the end of the fifth generation. For the case in which thorium breeder fuel (with its relatively high 232 U concentration) was used as reactor makeup fuel, concentrations of 232 U varied from 441 ppM ( 232 U/U weight basis) at discharge from the first generation to about 512 ppM ( 232 U/U weight basis) at the end of the fifth generation. Concentrations in freshly fabricated fuel for this later case were 20 to 35% higher than the discharge concentration. These concentrations are low when compared to those of other thorium fueled reactor types (HTGR and MSBR) because of the relatively high 238 U concentration added to the fuel as a denaturant. Excellent agreement was found between calculated and existing experimental values. Nevertheless, caution is urged in the use of these values because experimental results are very limited, and the relevant nuclear data, especially for 231 Pa and 232 U, are not of high quality
International Nuclear Information System (INIS)
Yan, Xun
2016-01-01
Highlights: • Screen dominant plants grown in uranium mill tailings soils. • Quantify the content of "2"3"2Th of soil samples from uranium mill tailings. • Quantify the transfer factor, bioconcentration factor and phytoremediation factor. • Screen out the plant species capable of remediating radionuclide contaminated soils. • Guide the reuse of study area in future. - Abstract: The concentrations of thorium ("2"3"2Th) in soil from a uranium mill tailings repository in South China were analyzed. The results showed that all the soil samples were acidic and the concentrations of "2"3"2Th in all the soil samples were more than the natural radionuclide content in soil of China. Through the field investigation, twelve kinds of dominant plants were discovered. The total quantity of "2"3"2Th in the whole plant is highest in rice flat sedge. We also found that Miscanthus floridulus has the greatest transfer factor (TF) for "2"3"2Th, rice flat sedge has the greatest bioconcentration factor (BF) for "2"3"2Th. At the mean time, M. floridulus has the greatest phytoremediation factor (PF) for "2"3"2Th. On the basis of the above conclusions and the definition for hyperaccumulator, rice flat sedge and M. floridulus could be the candidates of phytoremediation for radionuclide "2"3"2Th in the soil.
Energy Technology Data Exchange (ETDEWEB)
Yan, Xun, E-mail: m13836295186@163.com
2016-08-01
Highlights: • Screen dominant plants grown in uranium mill tailings soils. • Quantify the content of {sup 232}Th of soil samples from uranium mill tailings. • Quantify the transfer factor, bioconcentration factor and phytoremediation factor. • Screen out the plant species capable of remediating radionuclide contaminated soils. • Guide the reuse of study area in future. - Abstract: The concentrations of thorium ({sup 232}Th) in soil from a uranium mill tailings repository in South China were analyzed. The results showed that all the soil samples were acidic and the concentrations of {sup 232}Th in all the soil samples were more than the natural radionuclide content in soil of China. Through the field investigation, twelve kinds of dominant plants were discovered. The total quantity of {sup 232}Th in the whole plant is highest in rice flat sedge. We also found that Miscanthus floridulus has the greatest transfer factor (TF) for {sup 232}Th, rice flat sedge has the greatest bioconcentration factor (BF) for {sup 232}Th. At the mean time, M. floridulus has the greatest phytoremediation factor (PF) for {sup 232}Th. On the basis of the above conclusions and the definition for hyperaccumulator, rice flat sedge and M. floridulus could be the candidates of phytoremediation for radionuclide {sup 232}Th in the soil.
Studies about the assimilation of thorium by plants in Morro do Ferro (MG)
International Nuclear Information System (INIS)
Dotto, R.M.
1985-01-01
The following aspects of thorium mobilization and bioassimilation are studied: the determination of Th-232 concentrations in typical plants indigenous to the Morro do Ferro environment; the behaviour of different complexing agents, including humic acids, to assess their effectiveness in solubilizing Th-232 from soils and weathered ore; assessment of the importance of these complexing agents in the bioassimilation of Th-232. Leaching experiments with soil and weathered ore samples demonstrate that Th-232 release increases in the order: water [pt
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
2010-01-01
... specifically permitted or contemplated by Federal statute. (4) When acquiring replacement equipment, the...) Management requirements. Procedures for managing equipment (including replacement equipment), whether... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no...
2010-07-01
..., unless the person demonstrates to the satisfaction of the Corps, or EPA as appropriate, prior to..., corporation, municipality, State or Federal agency, or an agent or employee thereof. Regional Administrator... normal circumstances do support, a prevalence of vegetation typically adapted for life in saturated soil...
2010-04-01
... Commissioner in consideration of the contract of insurance. (c)(1) Fire safety equipment means equipment that... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED LIVING...
2010-04-01
... the CBERA which the President also has designated as a beneficiary country for purposes of... by the President or his designee, published in the Federal Register, that the beneficiary country has... entered into by the United States, Canada, and Mexico on December 17, 1992. Preferential tariff treatment...
BDML Metadata: 232 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available 22-efb1-4a87-93b7-0b7216a58137 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/...source/Ce_KK_P002/RNAi_T26G10.1_070222_01/ http://ssbd.qbic.riken.jp/data/bdml/Ce..._KK_P002/RNAi_T26G10.1_070222_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.05.xml ...http://ssbd.qbic.riken.jp/search/45ebf022-efb1-4a87-93b7-0b7216a58137/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-166 ...
DEFF Research Database (Denmark)
Pedersen, Morten Videbæk; Heide, Janus; Vingelmann, Peter
2013-01-01
Creating efficient finite field implementations has been an active research topic for several decades. Many appli- cations in areas such as cryptography, signal processing, erasure coding and now also network coding depend on this research to deliver satisfactory performance. In this paper we...... from a benchmark application written in C++. These results are finally compared to different binary and binary extension field implementations. The results show that the prime field implementation offers a large field size while maintaining a very good performance. We believe that using prime fields...
2010-10-01
...; placing of locomotives and cars for repair or storage; or moving of rail equipment in connection with work..., or by increased friction. Brake, dynamic means a train braking system whereby the kinetic energy of a... dissipated through resistor grids or into the catenary or third rail system. Brake, effective means a brake...
2010-04-01
... foster home or institution after the termination of parental rights, but prior to or in lieu of adoptive placement; (4) Adoptive placement, which shall mean the permanent placement of an Indian child for adoption... an adequate level of services within the area. Extended family member shall be as defined by the law...
Consultants' Meeting on Review Benchmarking of Nuclear Data for the Th/U Fuel Cycle. Summary Report
International Nuclear Information System (INIS)
Capote Noy, R.
2011-02-01
A summary is given of the Consultants' Meeting (CM) on Review and Benchmarking of Nuclear Data for the Th/U Fuel Cycle. An IAEA Coordinated Research Project (CRP) on 'Nuclear Data for Th/U Fuel Cycle' was concluded in 2005. The CRP activities resulted in new evaluated nuclear data files for 232 Th, 231 , 233 Pa (later adopted for the ENDF/B-VII.0 library) and improvements to existing evaluations for 232 , 233 , 234 , 236 U. Available nuclear data evaluations for 230 - 232 Th, 231,233 Pa and 232 , 233 , 234 U were reviewed including ROSFOND2010, CENDL-3.1, JENDL-4, JEFF-3.1.1, MINSKACT, and ENDF/B-VII.0 libraries. Benchmark results of available evaluations for 232 Th and 233 U were also discussed. (author)
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
Energy Technology Data Exchange (ETDEWEB)
Ngachin, M; Njock, M G Kwato [Center for Atomic, Molecular Physics and Quantum Optics, University of Douala, PO Box 8580, Douala (Cameroon); Garavaglia, M; Giovani, C; Scruzzi, E [Regional Agency for Environmental Protection (ARPA), 91 via Tavagnacco, 33100 Udine (Italy); Nourreddine, A [Institut Pluridisciplinaire Hubert-Curien, UMR7178 CNRS-IN2P3 and Universite Louis Pasteur, 23 rue de Loess, BP 28, F-67037, Strasbourg cedex 02 (France); Lagos, L [Applied Research Center, Florida International University, 10555 W Flagler Street, EC 2100, Miami, FL 33174 (United States)], E-mail: mngachin@yahoo.com
2008-09-01
This work deals with the measurement of radioactivity and radon exhalation rate from building materials manufactured in Douala city from geological materials. Nine types of building material were surveyed for their natural radioactivity contents using high-resolution gamma-ray spectrometry. The activity concentrations for {sup 226}Ra, {sup 232}Th and {sup 40}K varied from 11.5 to 49 Bq kg{sup -1}, 16 to 37 Bq kg{sup -1} and 306 to 774 Bq kg{sup -1}, respectively. The absorbed dose rate in the samples investigated at 1 m above ground level ranged from 28.5 to 66.6 nGy h{sup -1}. External and internal hazard indices were also estimated as defined by the European Commission. The Ra equivalents of the materials studied ranged from 57.5 to 133 Bq kg{sup -1} and are much smaller than the recommended limit of 370 Bq kg{sup -1} for construction materials for dwellings. Polycarbonate nuclear track detectors (NTDs), type CR-39, were used for measuring the radon concentration from different materials. In fact, knowledge of the radon exhalation rate from building materials is important for understanding the individual contribution of each material to the total indoor radon exposure. Samples were hermetically closed in glass vessels and the radon growth was followed as a function of time. The radon exhalation rate was therefore derived from the experimental measurement of {alpha}-track densities. The radon exhalation varied from (5.77 {+-} 0.06) x 10{sup -5} to (7.61 {+-} 0.07) x 10{sup -5} Bq cm{sup -2} h{sup -1} in bricks, from (5.79 {+-} 0.05) x 10{sup -5} to (11.6 {+-} 0.12) x 10{sup -5} in tiles, and was (6.95 {+-} 0.03) x 10{sup -5} Bq cm{sup -2} h{sup -1} in concrete. A correlation (correlation coefficient approx. = 0.8) was found between radium concentration measured with a HPGe detector and the radon exhalation rate obtained using nuclear track detectors.
Energy Technology Data Exchange (ETDEWEB)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.