International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
Statement of Basis/Proposed Plan for the F-Area Burning/Rubble Pits (231-F, 231-1F, and 231-2F)
International Nuclear Information System (INIS)
Palmer, E.
1996-08-01
The purpose of this source unit Statement of Basis/Proposed Plan is to describe the preferred alternative for addressing the F-Area Burning/Rubble Pits (231-F and 231-1F) and Rubble Pit (231-2F) (FBRP) source unit located at SRS, in southwestern Aiken County, South Carolina and to provide an opportunity for public input into the remedial action selection process
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH231 (Link to dictyBase) - - - Contig-U16382-1 SLH231F (Link to Original site) SLH2...31F 431 - - - - - - Show SLH231 Library SL (Link to library) Clone ID SLH231 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH231Q.Seq.d/ Representative seq. ID SLH23...1F (Link to Original site) Representative DNA sequence >SLH231 (SLH231Q) /CSM/SL/SLH2-B/SLH231Q.Seq.d/ AAAAA...Score E Sequences producing significant alignments: (bits) Value SLH231 (SLH231Q) /CSM/SL/SLH2-B/SLH231Q.Seq
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Purpose. 23.1 Section 23.1 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.1 Purpose. The purpose...-647), are utilized in conformance with the privacy and constitutional rights of individuals. ...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Guidelines. 231.11 Section 231.11 National... PROCEDURES GOVERNING BANKS, CREDIT UNIONS AND OTHER FINANCIAL INSTITUTIONS ON DOD INSTALLATIONS Guidelines for Application of the Privacy Act to Financial Institution Operations § 231.11 Guidelines. (a) The...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Notice. 231.15 Section 231.15 Foreign Relations... WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS § 231.15 Notice. Any communication to USAID pursuant to this Guarantee shall be in writing in the English language...
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Emblem. 403.231 Section 403.231 Public Health... Provisions § 403.231 Emblem. (a) The emblem is a graphic symbol, approved by HHS, that indicates that CMS has... display the emblem on policies certified under the voluntary certification program. (c) The manner in...
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
33 CFR 117.231 - Brandywine Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Brandywine Creek. 117.231 Section 117.231 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.231 Brandywine Creek. The draw of the...
22 CFR 231.16 - Governing law.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 231.16 Section 231.16 Foreign... EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS § 231.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of...
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Flat cars. 231.6 Section 231.6 Transportation... TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.6 Flat cars. (Cars with sides 12 inches or less above the floor may be equipped the same as flat cars.) (a) Hand brakes—(1) Number. Same as specified for...
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
48 CFR 252.231-7000 - Supplemental cost principles.
2010-10-01
... principles. 252.231-7000 Section 252.231-7000 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.231-7000 Supplemental cost principles. As prescribed in 231.100-70, use the following clause: Supplemental Cost Principles (DEC 1991) When the allowability of costs under...
Prospection for natural 231Pa in India
International Nuclear Information System (INIS)
Anupama, P.; Gantayet, L.M.; Verma, R.; Parthasarathy, R.; Anil Kumar, S.; Dingankar, M.V.; Ghosh, S.K.; Patra, R.N.
2001-08-01
Protactinium-231 ( 231 Pa) occurs in nature as a member of the decay chain of naturally occuring 235 U of the 4n+ 3 radioactive series. The expected protactinium concentration in the Jaduguda ore body (with uranium concentration of 0.03-0.06 %) is around 0.2 parts per billion (ppb) and that in monazite ore (uranium concentration 0.3%) is 0.9 ppb. The process at uranium ore processing plant at Jaduguda was studied. 231 Pa content in samples from the process streams of the plant was determined. The gamma ray spectrometry method was chosen and standardised in our laboratory to detect and measure 231 Pa in parts per billion levels in these samples. A concentrated source of protactinium could not be found among the assessed streams of Jaduguda uranium plant. The Monazite processing plant at IRE, Aluva was then studied. From the known chemistry of protactinium, the possible distribution of the 231 Pa was guessed at. Accordingly, the process streams of IRE process plant were selected to prospect for 231 Pa and determine the fractionation of protactinium. For analysis of 231 Pa, the thorium bearing samples were chemically treated to remove the thorium daughter products, which interfere in gamma spectrometry. This report describes the planning for prospecting, sample selection, the standardisation of the analysis procedure for determination of 231 Pa content, and the analysis results. The 231 Pa content in various streams of Indian Rare Earths plant was found in the range 0.2 -6.5 ppb. Some of the streams did not carry any protactinium. The fractionation of 231 Pa in the various streams of the plant and the selection of source for recovery of protactinium are discussed in detail. (author)
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 231.02 Section 231.02 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 231.14 Section 231.14 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 231.01 Section 231.01 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS...
42 CFR 413.231 - Adjustment for wages.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Adjustment for wages. 413.231 Section 413.231... Disease (ESRD) Services and Organ Procurement Costs § 413.231 Adjustment for wages. (a) CMS adjusts the labor-related portion of the base rate to account for geographic differences in the area wage levels...
14 CFR 16.231 - Offer of proof.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Offer of proof. 16.231 Section 16.231... PRACTICE FOR FEDERALLY-ASSISTED AIRPORT ENFORCEMENT PROCEEDINGS Hearings § 16.231 Offer of proof. A party whose evidence has been excluded by a ruling of the hearing officer may offer the evidence on the record...
48 CFR 231.205 - Selected costs.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Selected costs. 231.205... OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 231.205 Selected costs. ...
40 CFR 231.5 - Recommended determination.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended determination. 231.5... 404(c) PROCEDURES § 231.5 Recommended determination. (a) The Regional Administrator or his designee... public notice of the proposed determination, either withdraw the proposed determination or prepare a...
22 CFR 231.04 - Guarantee eligibility.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Guarantee eligibility. 231.04 Section 231.04 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...
49 CFR 231.18 - Cars of special construction.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Cars of special construction. 231.18 Section 231... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.18 Cars of special construction. Cars of construction not covered specifically in the foregoing sections in this part, relative to...
49 CFR 231.7 - Tank cars with side platforms.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Tank cars with side platforms. 231.7 Section 231.7..., DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.7 Tank cars with side platforms. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see § 231.1(a)(1)). (2...
International Nuclear Information System (INIS)
Zal U'yun Wan Mahmood; Zaharudin Ahmad; Abdul Kadir Ishak; Norfaizal Mohamed; Che Abd Rahim Mohamed
2011-01-01
Protactinium and thorium activities were measured in eight surface sediment taken in 2004 to determine effectiveness scavenging of 231 Pa at Sabah-Sarawak coastal waters. The result found that activity ratios of 231 Pa ex / 230 Th ex were ranged from 0.07 to 0.13 at all sampling stations. The high 231 Pa ex / 230 Th ex activity ratio than the production ratio of 0.093 in seawater at station SR 01, SR 02, SR 04, SB 02 and SB 05, revealed that 231 Pa is effectively removed from the water column into the sediment in comparison with 230 Th at those stations. Low percentage of 230 Th ex (90-95%) in comparison with 231 Pa ex at all stations can be attributed to less efficiently scavenged of 230 Th onto particles prior deposited at the marine sediment bed. (author)
22 CFR 231.03 - The Guarantee.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false The Guarantee. 231.03 Section 231.03 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS...
49 CFR 231.11 - Caboose cars without platforms.
2010-10-01
... inches end-ladder clearance, within 30 inches of side of car, until car is shopped for work amounting to... 49 Transportation 4 2010-10-01 2010-10-01 false Caboose cars without platforms. 231.11 Section 231... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.11 Caboose cars without...
27 CFR 25.231 - Finished beer.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Finished beer. 25.231... OF THE TREASURY LIQUORS BEER Beer Purchased From Another Brewer § 25.231 Finished beer. (a) A brewer may obtain beer in barrels and kegs, finished and ready for sale from another brewer. The purchasing...
16 CFR 23.1 - Deception (general).
2010-01-01
... misrepresent the type, kind, grade, quality, quantity, metallic content, size, weight, cut, color, character..., distribution, or any other material aspect of an industry product. Note 1 to § 23.1: If, in the sale or..., the identity of the grading system used should be disclosed. Note 2 to § 23.1: To prevent deception...
40 CFR 795.231 - Pharmacokinetics of isopropanal.
2010-07-01
... 40 Protection of Environment 31 2010-07-01 2010-07-01 true Pharmacokinetics of isopropanal. 795.231 Section 795.231 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... radioactivity in blood and in various tissues, including bone, brain, fat, gastrointestinal tract, gonads, heart...
49 CFR 231.3 - Drop-end high-side gondola cars.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Drop-end high-side gondola cars. 231.3 Section 231... gondola cars. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see § 231.1(a)(1)). (2) Dimensions. Same as specified for “Box and other house cars” (see § 231.1(a)(2)). (3...
49 CFR 231.5 - Drop-end low-side gondola cars.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Drop-end low-side gondola cars. 231.5 Section 231... gondola cars. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see § 231.1(a)(1)). (2) Dimensions. Same as specified for “Box and other house cars” (see § 231.1(a)(2)). (3...
49 CFR 192.231 - Protection from weather.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Protection from weather. 192.231 Section 192.231 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... weather. The welding operation must be protected from weather conditions that would impair the quality of...
49 CFR 231.9 - Tank cars without end sills.
2010-10-01
... clearance, within 30 inches of side of car, until car is shopped for work amounting to practically... 49 Transportation 4 2010-10-01 2010-10-01 false Tank cars without end sills. 231.9 Section 231.9..., DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.9 Tank cars without end sills. (a...
22 CFR 231.11 - Subrogation of USAID.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Subrogation of USAID. 231.11 Section 231.11 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...
22 CFR 231.13 - Change in agreements.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Change in agreements. 231.13 Section 231.13 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...
22 CFR 231.12 - Prosecution of claims.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Prosecution of claims. 231.12 Section 231.12 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...
22 CFR 231.07 - Fiscal Agent obligations.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Fiscal Agent obligations. 231.07 Section 231.07 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...
48 CFR 352.231-70 - Precontract costs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Precontract costs. 352.231... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 352.231-70 Precontract costs. As prescribed in 48 CFR 1331.205-32, insert the following clause: Precontract Costs (APR 2010) The contractor is...
49 CFR 231.15 - Steam locomotives used in road service.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotives used in road service. 231.15 Section 231.15 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.15 Steam locomotives used...
Protactinium-231 found in natural thorium irradiated in JMTR
International Nuclear Information System (INIS)
Suzuki, Susumu; Mitsugashira, Toshiaki; Hara, Mitsuo; Satoh, Isamu; Shiokawa, Yoshinobu; Satoh, Michiko
1987-01-01
Natural thorium dioxides, which differed in the content of 230 Th, were irradiated in JMTR(Japan Material Testing Reactor). 232 U, 233 U, 231 Pa, 233 Pa, and remaining Th were measured radiometrically. High production of 231 Pa and high consumption of 230 Th were observed and it was necessary to assume large resonance capture of 230 Th in order to explain the production of 231 Pa and the consumption of 230 Th. (author)
5 CFR 532.231 - Responsibilities of participating organizations.
2010-01-01
... organizations. 532.231 Section 532.231 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE... organizations. (a) The Office of Personnel Management: (1) Defines the boundaries of wage and survey areas; (2... recommendations of the national headquarters of any agency or labor organization relating to the Office of...
32 CFR Appendix B to Part 231 - In-Store Banking
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false In-Store Banking B Appendix B to Part 231.... 231, App. B Appendix B to Part 231—In-Store Banking A. Selection Process. The purpose of this guidance... provide in-store banking services when such services are desired and approved by the installation...
48 CFR 1352.231-71 - Duplication of effort.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Duplication of effort. 1352.231-71 Section 1352.231-71 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES... benefit of the Government, and not incidental to any other work, pursuit, research, or purpose of the...
Safety analysis report 231-Z Building
Energy Technology Data Exchange (ETDEWEB)
Powers, C.S.
1989-03-01
This report provides an intensive review of the nuclear safety of the operation of the 231-Z Building. For background information complete descriptions of the floor plan, building services, alarm systems, and glove box systems are included in this report. In addition, references are included to The Plutonium Laboratory Radiation Work Procedures, Safety Guides, 231-Z Operating Procedures Manual and Nuclear Materials accountability Procedures. Engineered and administrative features contribute to the overall safety of personnel, the building, and environs. The consequences of credible incidents were considered and are discussed.
29 CFR 500.231 - Appearances; representation of the Department of Labor.
2010-07-01
... Procedures Before Administrative Law Judge § 500.231 Appearances; representation of the Department of Labor... 29 Labor 3 2010-07-01 2010-07-01 false Appearances; representation of the Department of Labor. 500.231 Section 500.231 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT...
Directory of Open Access Journals (Sweden)
V. Villa
2011-01-01
Full Text Available The effects of quinacrine and minocycline on the toxicity induced by hPrP90-231 were studied. By mild thermal denaturation, hPrP90-231 can be converted in a toxic PrPSc-like structure affecting the survival of SH-SY5Y cells. Quinacrine and minocycline prevented hPrP90-231-induced toxicity interfering with different mechanisms: protective effects of quinacrine are mediated by the binding to the fragment that abolished hPrP90-231 structural changes and cell internalization, whereas, minocycline reverted MAP kinase neurotoxic signaling exerted by the prion fragment.
22 CFR 231.05 - Non-impairment of the Guarantee.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Non-impairment of the Guarantee. 231.05 Section 231.05 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD...
12 CFR 231.3 - Qualification as a financial institution.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Qualification as a financial institution. 231.3... RESERVE SYSTEM NETTING ELIGIBILITY FOR FINANCIAL INSTITUTION (REGULATION EE) § 231.3 Qualification as a financial institution. (a) A person qualifies as a financial institution for purposes of sections 401-407 of...
49 CFR 231.22 - Operation of track motor cars.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Operation of track motor cars. 231.22 Section 231... motor cars. On and after August 1, 1963, it shall be unlawful for any railroad subject to the requirements of the Safety Appliance Acts to operate or permit to be operated on its line track motor cars to...
27 CFR 31.231 - Destruction of marks and brands on wine containers.
2010-04-01
... brands on wine containers. 31.231 Section 31.231 Alcohol, Tobacco Products and Firearms ALCOHOL AND... § 31.231 Destruction of marks and brands on wine containers. A dealer who empties any cask, barrel, keg, or other bulk container of wine must scrape or obliterate from the empty container all marks, brands...
30 CFR 250.231 - After receiving the EP, what will MMS do?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false After receiving the EP, what will MMS do? 250.231 Section 250.231 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE... Decision Process for the Ep § 250.231 After receiving the EP, what will MMS do? (a) Determine whether...
Removal of 230Th and 231Pa at ocean margins
International Nuclear Information System (INIS)
Anderson, R.F.; Bacon, M.P.; Brewer, P.G.
1983-01-01
Uranium, thorium and protactinium isotopes were measured in particulate matter collected by sediment traps deployed in the Panama Basin and by in-situ filtration of large volumes of seawater in the Panama and Guatemala Basins. Concentrations of dissolved Th and Pa isotopes were determined by extraction onto MnO 2 adsorbers placed in line behind the filters in the in-situ pumping systems. Concentrations of dissolved 230 Th and 231 Pa in the Panama and Guatemala Basins are lower than in the open ocean, whereas dissolved 230 Th/ 231 Pa ratios are equal to, or slightly greater than, ratios in the open ocean. Particulate 230 Th/ 231 Pa ratios in the sediment trap samples ranged from 4 to 8, in contrast to ratios of 30 or more at the open ocean sites previously studied. Particles collected by filtration in the Panama Basin and nearest to the continental margin in the Guatemala Basin contained 230 Th/ 231 Pa ratios similar to the ratios in the sediment trap samples. The ratios increased with distance away from the continent. Suspended particles near the margin show no preference for adsorption of Th or Pa and therefore must be chemically different from particles in the open ocean, which show a strong preference for adsorption of Th. Ocean margins, as typified by the Panama and Guatemala Basins, are preferential sinks for 231 Pa relative to 230 Th. Furthermore, the margins are sinks for 230 Th and, to a greater extent, 231 Pa transported by horizontal mixing from the open ocean. (orig.)
49 CFR 231.16 - Steam locomotives used in switching service.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotives used in switching service. 231... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.16 Steam..., buffer block, footboard, brake pipe, signal pipe, steam-heat pipe or arms of uncoupling lever shall...
2010-01-01
... ELIGIBILITY FOR FINANCIAL INSTITUTION (REGULATION EE) § 231.2 Definitions. As used in this part, unless the...” contract). (d) Financial market means a market for a financial contract. (e) Gross mark-to-market positions... other person that controls, is controlled by, or is under common control with the person. (c) Financial...
33 CFR 136.231 - Authorized claimants.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.231 Authorized... also involves a claim for injury to, or economic losses resulting from destruction of, real or personal...
16 CFR 2.31 - Opportunity to submit a proposed consent order.
2010-01-01
... order. 2.31 Section 2.31 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND... through the operating Bureau or Regional Office having responsibility in the matter a proposal for disposition of the matter in the form of a consent order agreement executed by the party being investigated...
MOX-fuel inherent proliferation-protection due to {sup 231}Pa admixture
Energy Technology Data Exchange (ETDEWEB)
Kryuchkov, E.F.; Glebov, V.B.; Apse, V.A.; Shmelev, A.N. [Moscow Engineering Physics Institute (State University), Moscow (Russian Federation)
2003-07-01
The proliferation protection levels of MOX-fuel containing small additions of protactinium are evaluated for equilibrium closed and open cycles of a light-water reactor (LWR).Analysis of the ways to the proliferation protection of MOX-fuel by small {sup 231}Pa addition and comparison of this way with another options for giving MOX-fuel the proliferation self-protection property enable us to make the 3 following conclusions: -1) Unique nature of protactinium as a small addition to MOX-fuel is determined by the following properties: - Protactinium is available in the nature (uranium ore) as a long-lived mono-isotope {sup 231}Pa, - under neutron irradiation, {sup 231}Pa is converted into {sup 232}U, which is a long-term source of high energy gamma-radiation and practically non-separable from main fuel mass, - essentially, {sup 231}Pa is a high-quality burnable neutron absorber. -2) From the proliferation self-protection point of view, nuclear fuel cycle closure with fuel recycle is a preferable option because, under this condition, introduction of protactinium into MOX-fuel allows to create the inherent radiation barrier which is in action during full cycle of fuel management at the level corresponding to the accepted today criterion of the Spent Fuel Standard (SFS). In particular, the considered example of multiple MOX-fuel recycle with small addition of {sup 231}Pa (0.2% HM) at each cycle demonstrates a possibility to reach the proliferation protection level of fresh MOX-fuel corresponding to once irradiated fuel with the same cooling time. In this case, the lethal dose (at 30 cm distance from fuel assembly) is received within the minute range. -3) Introduction of {sup 231}Pa into MOX-fuel composition in amount of 0.5% HM allows to prolong action of the SFS from 100 to 200 years. If {sup 231}Pa content is increased up to 5% HM, then MOX-fuel conserves the proliferation self-protection property in respect to short-term unauthorized actions for 200-year period of its
36 CFR 223.231 - Bidding methods.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.231... methods. The Contracting Officer or designated forest officer shall offer advertised sales of special forest products through sealed bid or sealed bid followed by oral auction. The method selected shall: (a...
Period of Light Variability in BL Lac ON 231 Xu Yun Bing1, Zhang ...
Indian Academy of Sciences (India)
period light variability may be greater than the current observation history and needs further monitoring certification (Zhang et al. 1998). To establish the real periods of ON 231, we employ wavelet analysis and DCF method to search a periodicity in the light curves. 2. Periodicity analysis of ON231. 2.1 Light curve of ON 231.
231Pa and 230Th profiles in the open ocean water column
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Nakanishi, Takashi
1985-01-01
231 Pa and two Th isotopes ( 230 Th and 228 Th) were measured using large-volume water samples from the western North Pacific. Although 231 Pa and 230 Th have uniform source distributions (by decay of uranium) throughout the oceans, their vertical profiles are discernibly different from each other. The 231 Pa profile shows a mid-depth maximum around 2.5 km, while 230 Th increases monotonically with depth. This demonstrates that these nuclides follow different pathways for their transport and removal from seawater to depositional sinks. The activity ratio of 230 Th/ 231 Pa in seawater increases from one at the surface to four at a depth of 4 to 5 km, which is lower by a factor of 10 than the ratios published for open ocean particulate matter at the same depth horizon. The distribution coefficient, Ksub(D) for Pa, and the fractionation factor, Fsub(Th/Pa), between natural marine particulate matter and seawater are constant with depth at approx. 2 x 10 6 and 10, respectively. This implies that the adsorptive characteristics of deep open ocean particles are independent of particle composition or the content of manganese. The mean residence time of 231 Pa is estimated to be 200 years, which is considerably longer than that of 230 Th, but close to that of 210 Pb. (author)
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
EVN observations of the OH megamaser galaxies Mrk 231 and IC 694
Klockner, HR; Baan, WA; Migenes,; Reid, MJ
2002-01-01
We present EVN observations of hydroxyl (OH) main-line emission in two megamaser sources Mrk 231 and IC 694. The observations indicate that the broad maser emission lines originate within the nuclear regions. A single 1667 MHz main-line feature is seen at the nucleus of IC 694. In Mrk 231 both
27 CFR 40.231 - Consumption by employees.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Consumption by employees... Products § 40.231 Consumption by employees. A manufacturer of tobacco products may gratuitously furnish tobacco products, without determination and payment of tax, for personal consumption by employees in the...
Design study of Thorium-232 and Protactinium-231 based fuel for long life BWR
Energy Technology Data Exchange (ETDEWEB)
Trianti, N.; Su' ud, Z.; Riyana, E. S. [Nuclear Physics and Biophysics Research Division Department of Physics - Institut Teknologi Bandung (ITB) Jalan Ganeca 10 Bandung 40132 (Indonesia)
2012-06-06
A preliminary design study for the utilization of thorium added with {sup 231}Pa based fuel on BWR type reactor has been performed. In the previous research utilization of fuel based Thorium-232 and Uranium-233 show 10 years operation time with maximum excess-reactivity about 4.075% dk/k. To increase reactor operation time and reduce excess-reactivity below 1% dk/k, Protactinium (Pa-231) is used as Burnable Poison. Protactinium-231 has very interesting neutronic properties, which enable the core to reduce initial excess-reactivity and simultaneously increase production of {sup 233}U to {sup 231}Pa in burn-up process. Optimizations of the content of {sup 231}Pa in the core enables the BWR core to sustain long period of operation time with reasonable burn-up reactivity swing. Based on the optimization of fuel element composition (Th and Pa) in various moderation ratio we can get reactor core with longer operation time, 20 {approx} 30 years operation without fuel shuffling or refuelling, with average power densities maximum of about 35 watt/cc, and maximum excess-reactivity 0.56% dk/k.
40 CFR 86.231-94 - Vehicle preparation.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Vehicle preparation. 86.231-94 Section... (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES Emission Regulations for 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
231Pa and 230Th in the ocean model of the Community Earth System Model (CESM1.3)
Gu, Sifan; Liu, Zhengyu
2017-12-01
The sediment 231Pa / 230Th activity ratio is emerging as an important proxy for deep ocean circulation in the past. In order to allow for a direct model-data comparison and to improve our understanding of the sediment 231Pa / 230Th activity ratio, we implement 231Pa and 230Th in the ocean component of the Community Earth System Model (CESM). In addition to the fully coupled implementation of the scavenging behavior of 231Pa and 230Th with the active marine ecosystem module (particle-coupled: hereafter p-coupled), another form of 231Pa and 230Th have also been implemented with prescribed particle flux fields of the present climate (particle-fixed: hereafter p-fixed). The comparison of the two forms of 231Pa and 230Th helps to isolate the influence of the particle fluxes from that of ocean circulation. Under present-day climate forcing, our model is able to simulate water column 231Pa and 230Th activity and the sediment 231Pa / 230Th activity ratio in good agreement with available observations. In addition, in response to freshwater forcing, the p-coupled and p-fixed sediment 231Pa / 230Th activity ratios behave similarly over large areas of low productivity on long timescales, but can differ substantially in some regions of high productivity and on short timescales, indicating the importance of biological productivity in addition to ocean transport. Therefore, our model provides a potentially powerful tool to help the interpretation of sediment 231Pa / 230Th reconstructions and to improve our understanding of past ocean circulation and climate changes.
12 CFR 231.1 - Authority, purpose, and scope.
2010-01-01
... markets. This part expands the Act's definition of “financial institution” to allow more financial market... SYSTEM NETTING ELIGIBILITY FOR FINANCIAL INSTITUTION (REGULATION EE) § 231.1 Authority, purpose, and.... 4401-4407). This part does not affect the status of those financial institutions specifically defined...
75 FR 30902 - Supplemental Draft Environmental Impact Statement; U.S. 231 Dubois County, IN
2010-06-02
... Impact Statement; U.S. 231 Dubois County, IN AGENCY: Federal Highway Administration (FHWA), DOT. ACTION: Notice of intent. SUMMARY: The Federal Highway Administration (FHWA), in cooperation with the Indiana... roadway network but serves approximately 40 percent of the nation's highway travel. U.S. 231 is also a...
Guerreiro, Joana; Monteiro, Vitor; Ramos, Carla; Franco, Bernadette Dora Gombossy de Melo; Martinez, Rafael Chacon Ruiz; Todorov, Svetoslav Dimitrov; Fernandes, Paulo
2014-06-01
Bacteriocin B231 produced by Lactobacillus pentosus, isolated from an artisanal raw cow's milk protected designation of origin Portuguese cheese, is a small protein with an apparent relative mass of about 5 kDa and active against a large number of Listeria monocytogenes wild-type strains, Listeria ivanovii and Listeria innocua. Bacteriocin B231 production is highly dependent on the type of the culture media used for growth of Lact. pentosus B231. Replacement of glucose with maltose yielded the highest bacteriocin production from eight different carbon sources. Similar results were recorded in the presence of combination of glucose and maltose or galactose. Production of bacteriocin B231 reached maximal levels of 800 AU/ml during the stationary phase of growth of Lact. pentosus B231 in MRS broth at 30 °C. Bacteriocin B231 (in cell-free supernatant) was sensitive to treatment with trypsin and proteinase K, but not affected by the thermal treatment in range of 55-121 °C, or freezing (-20 °C). Bacteriocin production and inhibitory spectrum were evaluated. Gene encoding plantaricin S has been detected in the genomic DNA. Virulence potential and safety of Lact. pentosus B231 were assessed by PCR targeted the genes gelE, hyl, asa1, esp, cylA, efaA, ace, vanA, vanB, hdc1, hdc2, tdc and odc. The Lact. pentosus B231 strains harbored plantaricin S gene, while the occurrence of virulence, antibiotic resistance and biogenic amine genes was limited to cytolysin, hyaluronidase, aggregation substance, adhesion of collagen protein, gelatinase, tyrosine decarboxylase and vancomycin B genes.
Nucleotide, cytogenetic and expression impact of the human chromosome 8p23.1 inversion polymorphism.
Bosch, Nina; Morell, Marta; Ponsa, Immaculada; Mercader, Josep Maria; Armengol, Lluís; Estivill, Xavier
2009-12-14
The human chromosome 8p23.1 region contains a 3.8-4.5 Mb segment which can be found in different orientations (defined as genomic inversion) among individuals. The identification of single nucleotide polymorphisms (SNPs) tightly linked to the genomic orientation of a given region should be useful to indirectly evaluate the genotypes of large genomic orientations in the individuals. We have identified 16 SNPs, which are in linkage disequilibrium (LD) with the 8p23.1 inversion as detected by fluorescent in situ hybridization (FISH). The variability of the 8p23.1 orientation in 150 HapMap samples was predicted using this set of SNPs and was verified by FISH in a subset of samples. Four genes (NEIL2, MSRA, CTSB and BLK) were found differentially expressed (pinversion occurred. Moreover, an impact of 8p23.1 inversion on gene expression levels cannot be ruled out, since four genes from this region have statistically significant different expression levels depending on the inversion status. FISH results in lymphoblastoid cell lines suggest the presence of mosaicism regarding the 8p23.1 inversion.
49 CFR 231.4 - Fixed-end low-side gondola and low-side hopper cars.
2010-10-01
... cars. 231.4 Section 231.4 Transportation Other Regulations Relating to Transportation (Continued... Fixed-end low-side gondola and low-side hopper cars. (Cars with sides 36 inches or less above the floor are low-side cars.) (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see...
Testing the 231Pa/230Th paleo-circulation proxy: A data versus 2D model comparison
International Nuclear Information System (INIS)
Lippold, Jorg; Gherardi, Jeanne-Marie; Luo, Yiming
2011-01-01
Variations of the Atlantic Meridional Overturning Circulation (AMOC) are believed to have crucially influenced Earth's climate due to its key role in the inter-hemispheric redistribution of heat and carbon. To assess its past strength, the sedimentary 231 Pa/ 230 Th proxy has been developed and improved but also contested due to its sensitivity to other factors beyond ocean circulation. In order to provide a better basis for the understanding of the Atlantic 231 Pa/ 230 Th system, and therefore to shed light on the controversy, we compare new measurements of Holocene sediments from the north Brazilian margin to water column data and the output of a two-dimensional scavenging-circulation model, based on modern circulation patterns and reversible scavenging parameters. We show that sedimentary 231 Pa/ 230 Th data from one specific area of the Atlantic are in very good agreement with model results suggesting that sedimentary 231 Pa/ 230 Th is predominantly driven by the AMOC. Therefore, 231 Pa/ 230 Th represents an appropriate method to reconstruct past AMOC at least qualitatively along the western margin. (authors)
The distribution and behaviour of 230Th and 231 Pa at an ocean margin, Baja California, Mexico
International Nuclear Information System (INIS)
Shimmield, G.B.; Price, N.B.; Bacon, M.P.; Anderson, R.F.
1986-01-01
Uranium, Th and Pa isotopes were measured in sediments collected by box core along a transect normal to the Baja California continental margin. Six cores were analysed, ranging in depositional environment from manganese nodule-bearing, pelagic, red clay to hemipelagic sediments displaying Mn reduction in the upper 5 cm. In the hemipelagic cores, solid-phase Mn peaks due to diagenetic remobilisation occur within the upper layers which are well mixed with respect to unsupported 230 Th and 231 Pa. The fact that 230 Th and 231 Pa are not concentrated at the Mn peaks suggests that little mobility of these nuclides occurs within the sediment column. Unsupported 230 Th/ 231 Pa activity ratios in the biomixed layer of the sediments range from 10.9 to 6.6, generally decreasing towards the inshore stations. The flux of 230 Th and 231 Pa across the sediment/water interface is almost in balance with the theoretical water column supply in the most distal core, but rapidly increases inshore. This evidence from the sediment column confirms that enhanced 230 Th and 231 Pa removal occurs at ocean margins, and that 231 Pa is removed from the water column to the sediments in preference to 230 Th. (author)
Directory of Open Access Journals (Sweden)
Ceuci Nunes
1998-10-01
Full Text Available Neste estudo foram avaliados 231 pacientes com meningoencefalite tuberculosa, sendo que 62 casos tiveram diagnóstico comprovado e 169 apresentavam quadro clínico e laboratorial compatíveis com este diagnóstico. Foram 127 (55% pacientes do sexo masculino, a idade variou de 1 mês a 68 anos, com 97 (42% na faixa etária igual ou inferior a um ano. As características clínicas, demográficas e liquóricas foram estudadas e comparadas entre os casos confirmados e os de diagnóstico provável. Em conclusão reafirmamos a gravidade desta doença, com altas taxas de letalidade principalmente na faixa etária de zero a quatro anos e a possibilidade de erros diagnósticos nas apresentações com formas agudas e predominância de neutrófilos no líquor.This study assessed 231 cases of tuberculous meningitis of which 62 (26.8% had diagnostic confirmation against 169 (73.2% with only clinical picture and laboratorial indication for this diagnosis. Fifty-five percent of the sample was male; ages ranged from one month to 68 years, 42% comprising children below four years.Clinical, demographic and liquoric characteristics were investigated and compared amongst those with likely and confirmed diagnosis. In conclusion, atention is drawn to the severity of this desease with high rates of lethality mainly within the age-range of 0-4 years, and to the possibility of misdiagnosis in the presentation of acute forms and predominance of neutrophils in the liquor.
49 CFR 231.1 - Box and other house cars built or placed in service before October 1, 1966.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Box and other house cars built or placed in... APPLIANCE STANDARDS § 231.1 Box and other house cars built or placed in service before October 1, 1966. Except for box and other house cars that comply with either § 231.27 or § 231.28, each box and other...
30 CFR 285.231 - How will MMS process my unsolicited request for a noncompetitive lease?
2010-07-01
... a noncompetitive lease? 285.231 Section 285.231 Mineral Resources MINERALS MANAGEMENT SERVICE... described in §§ 285.640 through 285.648. (e) The MMS will coordinate and consult with affected Federal.... (1) Within 10 business days after you receive the lease copies you must: (i) Execute the lease; (ii...
International Nuclear Information System (INIS)
Wilcke, W.; Felix, W.; Elze, Th.W.; Huizenga, J.R.; Thompson, R.C.; Dreisler, R.M.
1977-01-01
Tables of spectroscopic information are given for the nuclei 233 , 235 , 237 Pa, and 229 , 231 Ac studied in the reactions 234 , 236 , 238 U, and 230 , 232 Th(t,α), including spin, parity, differential cross sections, and spectra. These quantities are discussed and plotted
22 CFR 231.09 - No acceleration of Eligible Notes.
2010-04-01
... Section 231.09 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11... have the right to pay any amounts in respect of the Eligible Notes other than in accordance with the...
46 CFR 169.231 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 169.231... hull examinations. As used in the part— (a) Drydock examination means hauling out a vessel or placing a... and all through-hull fittings, sea chests, sea valves, sea strainers, and valves for the emergency...
PBMC and MDAMB-231 cellular viability after telecobalt irradiation
International Nuclear Information System (INIS)
Andrade, Lidia M.; Campos, Tarcisio P.R.
2002-01-01
Radiotherapy by gamma rays are used for cancer treatment. Ionizing radiation effects on cells has been investigated. Studies in vitro were developed using tumor cell lines and ionizing radiation. The aim of this research was to test the cellular viability response of two cell types through MTT assay: human peripheral blood mononuclear cell (PBMC) and human breast carcinoma cell line MDAMB-231. These cells were irradiated with 60 Co source Theratron 80 radiotherapy machine from Atomic Energy Canada Limited with 20 x 20 cm field at 136.4 cGy/min, surface source distance 70 cm. Culture flasks contained 10 4 , 10 5 and 10 6 cells were irradiated with 100 Gy, 25 Gy, and 50 Gy using non fractionated doses. Cellular viability were evaluated 1h, 24h, 48h and 72h after irradiation and samples were measured by optical density at 595nm. Our results show that PBMC cells present lower cellular viability post irradiation. On the other hand, MDAMB-231 cells maintain viability after 50 Gy irradiation at 72h indicating cellular radioresistance. (author)
48 CFR 231.205-1 - Public relations and advertising costs.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Public relations and... PROCEDURES Contracts With Commercial Organizations 231.205-1 Public relations and advertising costs. (e) See... public relations and advertising costs also include monies paid to the Government associated with the...
DEFF Research Database (Denmark)
Longoni, Mauro; Hansen, Kasper Lage; Russell, Meaghan K.
2012-01-01
Chromosome 8p23.1 is a common hotspot associated with major congenital malformations, including congenital diaphragmatic hernia (CDH) and cardiac defects. We present findings from high‐resolution arrays in patients who carry a loss (n = 18) or a gain (n = 1) of sub‐band 8p23.1. We confirm a region...
48 CFR 752.231-71 - Salary supplements for HG employees.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Salary supplements for HG....231-71 Salary supplements for HG employees. As prescribed in 731.205-71, for use in all contracts with... sub-contracts. Salary Supplements for HG Employees (OCT 1998) (a) Salary supplements are payments made...
49 CFR 231.31 - Drawbars for freight cars; standard height.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Drawbars for freight cars; standard height. 231.31... cars; standard height. (a) Except on cars specified in paragraph (b) of this section— (1) On standard gage (561/2-inch gage) railroads, the maximum height of drawbars for freight cars (measured...
[Knock-down of BCL11A expression in breast cancer cells promotes MDA-MB-231 cell apoptosis].
Li, Hongli; Gui, Chen; Yan, Lijun
2016-11-01
Objective To detect the expression and pathological significance of B-cell CLL/lymphoma 11A (BCL11A) in breast cancer and investigate the effect of its silencing on the apoptosis of human MDA-MB-231 breast cancer cells. MethodsImmunohistochemistry was used to detect the expression of BCL11A in 62 cases of human breast cancer tissues and 8 cases of normal tissues. We synthesized siRNA targeting BCL11A, and then siRNA was transfected into MDA-MB-231 cells. Forty-eight hours later, the suppression effect of siRNA on BCL11A was determined by quantitative real-time PCR and Western blotting. The apoptosis of MDA-MB-231 cells was detected by flow cytometry. Results The BCL11A protein was mainly expressed in cytoplasm. The expression level of BCL11A in breast cancer tissues was higher than that in paracancerous tissues. The expression had correlations with tumor grade, tumor stage, while it had no correlations with the patients' age and tumor size. BCL11A-siRNA significantly suppressed the expression of BCL11A mRNA and protein as compared with the control group. MDA-MB-231 cells transfected with BCL11A-siRNA had higher apoptosis rate compared with the control group. Conclusion The BCL11A protein is highly expressed in breast cancer and knock-down of BCL11A promotes the apoptosis of MDA-MB-231 cells.
Directory of Open Access Journals (Sweden)
Qiu-Lin Ke
2016-02-01
Full Text Available Objective: To explore the effect that miR-101 inhibits breast cancer MDA-MB-231 cell proliferation and increases the chemosensitivity of paclitaxel to breast cancer MDA-MB-231 cells and its influence on protein expression level of target gene Bcl2. Methods: miR-101 was artificially synthesized, it used liposome 3000 to transfect MDA-MB-231 cells, and experiment was divided into three groups: blank control group, negative control group and miR-101 group. MTT assay was used to detect the effect of miR-101 on MDA-MB-231 cell proliferation and chemosensitivity of paclitaxel-mediated MDA-MB-231 cells; flow cytometer was used to detect cell apoptosis. Real-time PCR and Western bloting were used to detect the changes of mRNA and protein expression levels of Bcl2. Results: After miR-101 transfected MDA-MB- 231 cells, cell proliferation ability significantly decreased compared with negative control group, and differences had statistical significance (P<0.01; after paclitaxel was used to process cells, IC50 of miR-101-processing group decreased by 2.45 times compared with blank control group, differences had statistical significance (P<0.05 and differences between blank control group and negative control group had no statistical significance; detection results by flow cytometer showed that both early-stage and late-stage apoptosis rates of MDA-MB-231 cells of miR-101 group were significantly higher than those of negative control group (P<0.05, and early-stage apoptosis rate was more significant (P<0.01; after transfection of miR-101, mRNA and protein levels of Bcl2 of MDA-MB-231 cells significantly decreased, and differences had statistical significance (P<0.05. Conclusion: miR-101 can inhibit breast cancer MDAMB- 231 cell proliferation through targeting and downregulating Bcl2, thereby increasing the chemosensitivity of breast cancer cells to paclitaxel and promoting cell apoptosis.
Production of 231Pa and 232U by irradiation of 230Th/232Th mixtures
International Nuclear Information System (INIS)
Kluge, E.; Lieser, K.H.
1981-01-01
The production of 231 Pa and of 232 U by irradiating a 230 Th/ 232 Th mixture (containing 12 mol per cent 230 Th) in form of ThO 2 at a thermal neutron flux of 6.9 x 10 13 cm -2 s -1 for 4 months was investigated. Pa, U and Th were separated and the chemical yields were determined. 2.6% of the 230 Th were transformed into 231 Pa and 0.13% into 232 U. These values are higher than those calculated for a thermal flux, but lower than those calculated for a flux ratio epithermal to thermal = 0.03. 231 Pa and 232 U were isolated in form of a protactinium solution and of U 3 O 8 with 94.9 and 89.1% chemical yields, respectively. Foreign activities were not detected. Thorium was recuperated and isolated as ThO 2 , with a chemical yield of 93.6%. (orig.)
Distribution of Pa-231 and Ra-226 in rock. An indicator of rock matrix diffusion
International Nuclear Information System (INIS)
Saarinen, L.; Suksi, J.
1995-01-01
Distribution of Ra-226 and Pa-231 in rock has been studied to find signatures that may be attributed to diffusion. The idea of studying these nuclides originated from the need to obtain interpretative support to the findings of U movement in rock. Concentration profiles of Ra-226 and Pa-231 with other U series nuclides were measured across the secondary U accumulations observed in altered rock close to a fracture in the vicinity of U deposit, and in a radioactivity anomaly. (27 refs., 10 figs., 2 tabs.)
Energy Technology Data Exchange (ETDEWEB)
Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires
1965-07-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)
27 CFR 24.231 - Receipt of spirits in sealed bulk containers.
2010-04-01
... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.231 Receipt of spirits in sealed bulk containers. The proprietor shall examine sealed bulk containers (packages) of spirits... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of spirits in...
International Nuclear Information System (INIS)
Siegrist, R.L.; Morris, M.I.; Donaldson, T.L.; Palumbo, A.V.; Herbes, S.E.; Jenkins, R.A.; Morrissey, C.M.; Harris, M.T.
1993-08-01
The Portsmouth Gaseous Diffusion Plant (Ports) is located approximately 70 miles south of Columbus in southern Ohio. Among the several waste management units on the facility, the X-231B unit consists of two adjacent oil biodegradation plots. The plots encompass ∼ 0.8 acres and were reportedly used from 1976 to 1983 for the treatment and disposal of waste oils and degreasing solvents, some containing uranium-235 and technetium-99. The X-231B unit is a regulated solid waste management unit (SWMU) under the Resource Conservation and Recovery Act (RCRA). The X-231B unit is also a designated SWMU located within Quadrant I of the site as defined in an ongoing RCRA Facilities Investigation and Corrective Measures Study (RFI/CMS). Before implementing one or more Technology Demonstration Project must be completed. The principal goal of this project was to elect and successfully demonstrate one ore more technologies for effective treatment of the contaminated soils associated with the X-231B unit at PORTS. The project was divided into two major phases. Phase 1 involved a technology evaluation and screening process. The second phase (i.e., Phase 2) was to involve field demonstration, testing and evaluation of the technology(s) selected during Phase 1. This report presents the methods, results, and conclusions of the technology evaluation and screening portion of the project
Reciprocal deletion and duplication at 2q23.1 indicates a role for MBD5 in autism spectrum disorder.
Mullegama, Sureni V; Rosenfeld, Jill A; Orellana, Carmen; van Bon, Bregje W M; Halbach, Sara; Repnikova, Elena A; Brick, Lauren; Li, Chumei; Dupuis, Lucie; Rosello, Monica; Aradhya, Swaroop; Stavropoulos, D James; Manickam, Kandamurugu; Mitchell, Elyse; Hodge, Jennelle C; Talkowski, Michael E; Gusella, James F; Keller, Kory; Zonana, Jonathan; Schwartz, Stuart; Pyatt, Robert E; Waggoner, Darrel J; Shaffer, Lisa G; Lin, Angela E; de Vries, Bert B A; Mendoza-Londono, Roberto; Elsea, Sarah H
2014-01-01
Copy number variations associated with abnormal gene dosage have an important role in the genetic etiology of many neurodevelopmental disorders, including intellectual disability (ID) and autism. We hypothesize that the chromosome 2q23.1 region encompassing MBD5 is a dosage-dependent region, wherein deletion or duplication results in altered gene dosage. We previously established the 2q23.1 microdeletion syndrome and report herein 23 individuals with 2q23.1 duplications, thus establishing a complementary duplication syndrome. The observed phenotype includes ID, language impairments, infantile hypotonia and gross motor delay, behavioral problems, autistic features, dysmorphic facial features (pinnae anomalies, arched eyebrows, prominent nose, small chin, thin upper lip), and minor digital anomalies (fifth finger clinodactyly and large broad first toe). The microduplication size varies among all cases and ranges from 68 kb to 53.7 Mb, encompassing a region that includes MBD5, an important factor in methylation patterning and epigenetic regulation. We previously reported that haploinsufficiency of MBD5 is the primary causal factor in 2q23.1 microdeletion syndrome and that mutations in MBD5 are associated with autism. In this study, we demonstrate that MBD5 is the only gene in common among all duplication cases and that overexpression of MBD5 is likely responsible for the core clinical features present in 2q23.1 microduplication syndrome. Phenotypic analyses suggest that 2q23.1 duplication results in a slightly less severe phenotype than the reciprocal deletion. The features associated with a deletion, mutation or duplication of MBD5 and the gene expression changes observed support MBD5 as a dosage-sensitive gene critical for normal development.
Opportunistic infections and malignancies in 231 Danish AIDS patients
DEFF Research Database (Denmark)
Pedersen, C; Gerstoft, J; Tauris, P
1990-01-01
diseases caused by cytomegalovirus and atypical mycobacteria tended to occur later in the course of AIDS. Compared with all other AIDS patients, homosexual men were more likely to develop Kaposi's sarcoma, cytomegalovirus chorioretinitis and mucocutaneous herpes simplex virus infection. The proportion......We analysed cumulative disease frequencies in the first 231 adult Danish AIDS patients with life tables. There was a certain hierarchical pattern in the occurrence of complicating diseases. Herpes zoster, Kaposi's sarcoma and Pneumocystis carinii pneumonia were early manifestations, whereas...
Energy Technology Data Exchange (ETDEWEB)
Dalvi, Aditi A. [Bhabha Atomic Research Centre, Mumbai (India). Analytical Chemistry Div.; Homi Bhabha National Institute, Mumbai (India); Verma, Rakesh
2017-07-01
A simple and fast radiochemical method for the separation of protactinium ({sup 231}Pa) from siliceous cake for its determination by gamma ray spectrometry is described. The method involves (a) a novel approach, the fusion of the siliceous cake with sodium peroxide, (b) the dissolution of the fused mass in nitric acid and (c) the co-precipitation of {sup 231}Pa with manganese dioxide formed in-situ by the addition of solid manganous sulfate and potassium permanganate to the solution. The fusion, effected in a single step, is simpler and highly effective in comparison to methods reported hitherto in literature. The radiochemical yield of {sup 231}Pa, determined using 311.9 keV gamma ray of {sup 233}Pa radiotracer is quantitative (∝90%). The decontamination factors calculated using gamma ray spectrometry and energy dispersive X-ray fluorescence measurements show that the separation from the interfering radionuclides is high whereas separation from major and minor elements is good. Separation by ion-exchange method in hydrochloric acid, hydrofluoric acid and oxalic acid media have comparatively much lower yields. The concentration of {sup 231}Pa in the siliceous cake measured using interference-free 283.6 keV gamma ray was found to be (6.4 ± 0.33) μg kg{sup -1}. The measured concentration of {sup 231}Pa was well above the limit of quantitation whereas the coefficient of variation was ∝5%. The improvement in the limit of detection was due to the reduction in spectral background. Systematic evaluation of various uncertainty parameters showed that the major contributors to the combined uncertainty were efficiency of the high purity germanium detector and the counting statistics. The present sample decomposition and separation methods are robust, simple to perform and can be effectively used for the determination and hence source prospecting of protactinium.
49 CFR 231.8 - Tank cars without side sills and tank cars with short side sills and end platforms.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Tank cars without side sills and tank cars with... APPLIANCE STANDARDS § 231.8 Tank cars without side sills and tank cars with short side sills and end platforms. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see § 231.1(a)(1...
Alvarado, David M; Aferol, Hyuliya; McCall, Kevin; Huang, Jason B; Techy, Matthew; Buchan, Jillian; Cady, Janet; Gonzales, Patrick R; Dobbs, Matthew B; Gurnett, Christina A
2010-07-09
Clubfoot is a common musculoskeletal birth defect for which few causative genes have been identified. To identify the genes responsible for isolated clubfoot, we screened for genomic copy-number variants with the Affymetrix Genome-wide Human SNP Array 6.0. A recurrent chromosome 17q23.1q23.2 microduplication was identified in 3 of 66 probands with familial isolated clubfoot. The chromosome 17q23.1q23.2 microduplication segregated with autosomal-dominant clubfoot in all three families but with reduced penetrance. Mild short stature was common and one female had developmental hip dysplasia. Subtle skeletal abnormalities consisted of broad and shortened metatarsals and calcanei, small distal tibial epiphyses, and thickened ischia. Several skeletal features were opposite to those described in the reciprocal chromosome 17q23.1q23.2 microdeletion syndrome associated with developmental delay and cardiac and limb abnormalities. Of note, during our study, we also identified a microdeletion at the locus in a sibling pair with isolated clubfoot. The chromosome 17q23.1q23.2 region contains the T-box transcription factor TBX4, a likely target of the bicoid-related transcription factor PITX1 previously implicated in clubfoot etiology. Our result suggests that this chromosome 17q23.1q23.2 microduplication is a relatively common cause of familial isolated clubfoot and provides strong evidence linking clubfoot etiology to abnormal early limb development. Copyright 2010 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.
Synergistic action of cisplatin and echistatin in MDA-MB-231 breast cancer cells.
Czarnomysy, Robert; Surażyński, Arkadiusz; Popławska, Bożena; Rysiak, Edyta; Pawłowska, Natalia; Czajkowska, Anna; Bielawski, Krzysztof; Bielawska, Anna
2017-03-01
The aim of our study was to determine whether the use of cisplatin in the presence echistatin in MDA-MB-231 breast cancer cells leads to a reduction of toxic effects associated with the use of cisplatin. The expression of β 1 -integrin and insulin-like growth factor 1 receptor (IGF-IR), signaling pathway protein expression: protein kinase B (AKT), mitogen-activated protein kinases (ERK1/ERK2), nuclear factor kappa B (NFκB), and caspase-3 and -9 activity was measured after 24 h of incubation with tested compounds to explain detailed molecular mechanism of induction of apoptosis. The viability of MDA-MB-231 breast cancer cells was determined by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Annexin V-FITC/propidium iodide staining assay was performed to detect the induction of apoptosis. Inhibition DNA biosynthesis was determined by [ 3 H]thymidine incorporation into DNA. The expression of of β 1 -integrin, IGF-IR, AKT, ERK1/ERK2, NFκB, caspase-3 and -9 was evaluated using Western blot. The results suggest that treatment of MDA-MB-231 breast cancer cells for 24 h cisplatin plus echistatin severely inhibits cell growth and activates apoptosis by upregulation of caspase-3 and -9 expressions. The effect was stronger than treatment cisplatin and echistatin alone. In this study, we have found that cisplatin plus echistatin treatment decreases collagen biosynthesis in MDA-MB-231 breast cancer cells stronger than the individual compounds. The inhibition was found to be dependent on the β 1 -integrin and IGF receptor activation. A significant reduction of ERK1/ERK2, AKT expression in cancer cells after cisplatin plus echistatin treatment was also found. The cancer cells treated by echistatin, cisplatin, and in particular the combination of both compounds drastically increased expression of NFκB transcription factor. Our results suggest that combined therapy cisplatin plus echistatin is a possible way to improve selectiveness of cisplatin. This
Dun, Matthew D.; Chalkley, Robert J.; Faulkner, Sam; Keene, Sheridan; Avery-Kiejda, Kelly A.; Scott, Rodney J.; Falkenby, Lasse G.; Cairns, Murray J.; Larsen, Martin R.; Bradshaw, Ralph A.; Hondermarck, Hubert
2015-01-01
Brain metastases are a devastating consequence of cancer and currently there are no specific biomarkers or therapeutic targets for risk prediction, diagnosis, and treatment. Here the proteome of the brain metastatic breast cancer cell line 231-BR has been compared with that of the parental cell line MDA-MB-231, which is also metastatic but has no organ selectivity. Using SILAC and nanoLC-MS/MS, 1957 proteins were identified in reciprocal labeling experiments and 1584 were quantified in the two cell lines. A total of 152 proteins were confidently determined to be up- or down-regulated by more than twofold in 231-BR. Of note, 112/152 proteins were decreased as compared with only 40/152 that were increased, suggesting that down-regulation of specific proteins is an important part of the mechanism underlying the ability of breast cancer cells to metastasize to the brain. When matched against transcriptomic data, 43% of individual protein changes were associated with corresponding changes in mRNA, indicating that the transcript level is a limited predictor of protein level. In addition, differential miRNA analyses showed that most miRNA changes in 231-BR were up- (36/45) as compared with down-regulations (9/45). Pathway analysis revealed that proteome changes were mostly related to cell signaling and cell cycle, metabolism and extracellular matrix remodeling. The major protein changes in 231-BR were confirmed by parallel reaction monitoring mass spectrometry and consisted in increases (by more than fivefold) in the matrix metalloproteinase-1, ephrin-B1, stomatin, myc target-1, and decreases (by more than 10-fold) in transglutaminase-2, the S100 calcium-binding protein A4, and l-plastin. The clinicopathological significance of these major proteomic changes to predict the occurrence of brain metastases, and their potential value as therapeutic targets, warrants further investigation. PMID:26041846
Teng, Stacy H.; Brandt. W. N.; Harrison, F. A.; Luo, B.; Alexander, D. M.; Bauer, F. E.; Boggs, S. E.; Christensen, F. E.; Comastri, A.; Craig, W. W.;
2014-01-01
We present high-energy (3-30 keV) NuSTAR observations of the nearest quasar, the ultraluminous infrared galaxy (ULIRG) Markarian 231 (Mrk 231), supplemented with new and simultaneous low-energy (0.5-8 keV) data from Chandra. The source was detected, though at much fainter levels than previously reported, likely due to contamination in the large apertures of previous non-focusing hard X-ray telescopes. The full band (0.5-30 keV) X-ray spectrum suggests the active galactic nucleus (AGN) in Mrk 231 is absorbed by a patchy and Compton-thin N(sub H) approx. 1.2(sup +0.3) sub-0.3) x 10(exp 23) / sq cm) column. The intrinsic X-ray luminosity L(sub 0.5-30 Kev) approx. 1.0 x 10(exp 43) erg /s) is extremely weak relative to the bolometric luminosity where the 2-10 keV to bolometric luminosity ratio is approx. 0.03% compared to the typical values of 2-15%. Additionally, Mrk 231 has a low X-ray-to-optical power law slope alpha(sub 0X) approx. -1.7. It is a local example of a low-ionization broad absorption line (LoBAL) quasar that is intrinsically X-ray weak. The weak ionizing continuum may explain the lack of mid-infrared [O IV], [Ne V], and [Ne VI] fine-structure emission lines which are present in sources with otherwise similar AGN properties. We argue that the intrinsic X-ray weakness may be a result of the super-Eddington accretion occurring in the nucleus of this ULIRG, and may also be naturally related to the powerful wind event seen in Mrk 231, a merger remnant escaping from its dusty cocoon.
International Nuclear Information System (INIS)
West, O.R.; Siegrist, R.L.; Mitchell, T.J.; Pickering, D.A.; Muhr, C.A.; Greene, D.W.; Jenkins, R.A.
1993-11-01
Fine-textured soils and sediments contaminated by trichloroethylene (TCE) and other chlorinated organics present a serious environmental restoration challenge at US Department of Energy (DOE) sites. DOE and Martin Marietta Energy Systems, Inc. initiated a research and demonstration project at Oak Ridge National Laboratory. The goal of the project was to demonstrate a process for closure and environmental restoration of the X-231B Solid Waste Management Unit at the DOE Portsmouth Gaseous Diffusion Plant. The X-231B Unit was used from 1976 to 1983 as a land disposal site for waste oils and solvents. Silt and clay deposits beneath the unit were contaminated with volatile organic compounds and low levels of radioactive substances. The shallow groundwater was also contaminated, and some contaminants were at levels well above drinking water standards. This document begins with a summary of the subsurface physical and contaminant characteristics obtained from investigative studies conducted at the X-231B Unit prior to January 1992 (Sect. 2). This is then followed by a description of the sample collection and analysis methods used during the baseline sampling conducted in January 1992 (Sect. 3). The results of this sampling event were used to develop spatial models for VOC contaminant distribution within the X-231B Unit
29 CFR 779.231 - Franchise arrangements which do not create a larger enterprise.
2010-07-01
... Apply; Enterprise Coverage Leased Departments, Franchise and Other Business Arrangements § 779.231... is clear that he retains the control of the management of his business in those respects which... control with respect to the management of his business, the determination of his employment practices, the...
Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231
International Nuclear Information System (INIS)
Guillot, Ph.
1965-01-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through α,n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [fr
Bergasa-Caceres, Fernando; Rabitz, Herschel A.
2014-01-01
A model of protein folding kinetics is applied to study the combined effects of protein flexibility and macromolecular crowding on protein folding rate and stability. It is found that the increase in stability and folding rate promoted by macromolecular crowding is damped for proteins with highly flexible native structures. The model is applied to the folding dynamics of the murine prion protein (121-231). It is found that the high flexibility of the native isoform of the murine prion protein (121-231) reduces the effects of macromolecular crowding on its folding dynamics. The relevance of these findings for the pathogenic mechanism are discussed.
Thellung, Stefano; Gatta, Elena; Pellistri, Francesca; Villa, Valentina; Corsaro, Alessandro; Nizzari, Mario; Robello, Mauro; Florio, Tullio
2017-10-01
Glia over-stimulation associates with amyloid deposition contributing to the progression of central nervous system neurodegenerative disorders. Here we analyze the molecular mechanisms mediating microglia-dependent neurotoxicity induced by prion protein (PrP)90-231, an amyloidogenic polypeptide corresponding to the protease-resistant portion of the pathological prion protein scrapie (PrP Sc ). PrP90-231 neurotoxicity is enhanced by the presence of microglia within neuronal culture, and associated to a rapid neuronal [Ca ++ ] i increase. Indeed, while in "pure" cerebellar granule neuron cultures, PrP90-231 causes a delayed intracellular Ca ++ entry mediated by the activation of NMDA receptors; when neuron and glia are co-cultured, a transient increase of [Ca ++ ] i occurs within seconds after treatment in both granule neurons and glial cells, then followed by a delayed and sustained [Ca ++ ] i raise, associated with the induction of the expression of inducible nitric oxide synthase and phagocytic NADPH oxidase. [Ca ++ ] i fast increase in neurons is dependent on the activation of multiple pathways since it is not only inhibited by the blockade of voltage-gated channel activity and NMDA receptors but also prevented by the inhibition of nitric oxide and PGE 2 release from glial cells. Thus, Ca ++ homeostasis alteration, directly induced by PrP90-231 in cerebellar granule cells, requires the activation of NMDA receptors, but is greatly enhanced by soluble molecules released by activated glia. In glia-enriched cerebellar granule cultures, the activation of inducible nitric oxide (iNOS) and NADPH oxidase represents the main mechanism of toxicity since their pharmacological inhibition prevented PrP90-231 neurotoxicity, whereas NMDA blockade by D(-)-2-amino-5-phosphonopentanoic acid is ineffective; conversely, in pure cerebellar granule cultures, NMDA blockade but not iNOS inhibition strongly reduced PrP90-231 neurotoxicity. These data indicate that amyloidogenic peptides
THE BINARY BLACK HOLE MODEL FOR MRK 231 BITES THE DUST
Energy Technology Data Exchange (ETDEWEB)
Leighly, Karen M. [Homer L. Dodge Department of Physics and Astronomy, The University of Oklahoma, 440 W. Brooks Street, Norman, OK 73019 (United States); Terndrup, Donald M. [Department of Astronomy, The Ohio State University, 140 W. 18th Avenue, Columbus, OH 43210 (United States); Gallagher, Sarah C. [Department of Physics and Astronomy and Centre for Planetary and Space Exploration, The University of Western Ontario, London, ON N6A 3K7 (Canada); Lucy, Adrian B. [Department of Astronomy, Columbia University, 550 W. 120th Street, New York, NY 10027 (United States)
2016-09-20
Mrk 231 is a nearby quasar with an unusually red near-UV-to-optical continuum, generally explained as heavy reddening by dust. Yan et al. proposed that Mrk 231 is a milliparsec black hole binary with little intrinsic reddening. We show that if the observed FUV continuum is intrinsic, as assumed by Yan et al., it fails by a factor of about 100 in powering the observed strength of the near-infrared emission lines and the thermal near and mid-infrared continuum. In contrast, the line and continuum strengths are typical for a reddened AGN spectral energy distribution (SED). We find that the He i*/P β ratio is sensitive to the SED for a one-zone model. If this sensitivity is maintained in general broadline region models, then this ratio may prove a useful diagnostic for heavily reddened quasars. Analysis of archival Hubble Space Telescope STIS and Faint Object Camera data revealed evidence that the far-UV continuum emission is resolved on size scales of ∼40 pc. The lack of broad absorption lines in the far-UV continuum might be explained if it were not coincident with the central engine. One possibility is that it is the central engine continuum reflected from the receding wind on the far side of the quasar.
The influence of nepheloid layers on global model simulations of 231Pa and 230Th.
Basak, C.; Plancherel, Y.; Khatiwala, S.; Anderson, R. F.
2016-12-01
231Pa and 230Th in the ocean are produced at a constant ratio by Uranium decay but adsorption onto particles removes these tracers differentially. This fractionation process makes it possible to use the elemental 231Pa/230Th ratio as a paleoceanography proxy, frequently used for deriving the strength of Atlantic Meridional Overturning Circulation. The removal process, however, is further complicated by the abundance and composition of the available particle types. Understanding how dissolved tracers interact with the particle field in the ocean is key to better understand the biogeochemical cycling of these particle-reactive elements and their use as a flux tracer in present and past oceans. We here present simulations of the 231Pa/230Th ratio using the Transport Matrix Method (TMM, Khatiwala, 2007), focusing especially on the role of the nepheloid layer in controlling the distribution of these radiotracers. The model simulates each tracer separately, with advective-diffusive transport based on the ECCO ocean state estimate (Stammer et al., 2004). Sources include production by Uranium decay and dust dissolution. Radioactive decay and importantly, reversible scavenging and sedimentation are the main sinks that control the removal of the radiotracers. Similar to previous studies, we consider particle fields consisting of calcium carbonate, opal, particle organic matter, and dust. A novelty is that we explicitly consider the influence of an additional bottom particle layer (nepheloid). Simulations that include a nepheloid layer produce vertical profiles that better fit the observed distribution of 230Th and 231Pa. Specifically, observational data in the South Atlantic and eastern South Pacific indicate a mid-depth inflection (for both Pa and Th), a feature that can only be obtained if a nepheloid layer is included in the simulation. Our simulations reinforce the idea that nepheloid layers play an important role in Pa and Th cycling in the ocean (Deng et al., 2014
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
A novel HLA-A*24 allele, A*24:231, was identified by sequencing-based typing.
Li, G Y; Liu, Y Y; Wu, K L; Tang, Z H
2018-05-22
HLA-A*24:231 has 1 nucleotide change from HLA-A*24:02:01:01 at position 784 G>C This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Directory of Open Access Journals (Sweden)
LATIFAH SAIFUL YAZAN
2009-01-01
Full Text Available Betulinic acid (BA is a pentacyclic triterpene found in several botanical sources that has been shown to cause apoptosis in a number of cell lines. This study was undertaken to determine the in vitro cytotoxic properties of BA towards the human mammary carcinoma cell line MDA-MB-231 and the human promyelocytic leukaemia cell line HL-60 and the mode of the induced cell death. The cytotoxicity and mode of cell death of BA were determined using the MTT assay and DNAfragmentation analysis, respectively. In our study, the compound was found to be cytotoxic to MDA-MB-231 and HL-60 cells with IC50 values of 58 μg/mL and 134 μg/mL, respectively. Cells treated with high concentrations of BA exhibited features characteristic of apoptosis such as blebbing, shrinking and a number of small cytoplasm body masses when viewed under an inverted light microscope after 24 h. The incidence of apoptosis in MDA-MB-231 was further confirmed bythe DNA fragmentation analysis, with the formation of DNA fragments of oligonucleosomal size (180-200 base pairs, giving a ladder-like pattern on agarose gel electrophoresis. BA was more cytotoxic towards MDA-MB-231 than HL-60 cells, and induced apoptosis in MDA-MB-231 cells.
Estanislao Gómez, C C; Aquino Carreño, A; Pérez Ishiwara, D G; San Martín Martínez, E; Morales López, J; Pérez Hernández, N; Gómez García, M C
2016-08-05
Decatropis bicolor (Zucc.)Radlk is a plant that has been traditionally used for the treatment of breast cancer in some communities of Mexico. So, the aim of this study was to determine the cytotoxic and apoptotic effect of the essential oil of Decatropis bicolor against breast cancer cell line, MDA-MB-231. The essential oil obtained from hydrodestillation of leaves of Decatropis bicolor was studied for its biological activity against breast cancer cells MDA-MB-231 by MTT assay, Hematoxylin-eosin stain, Annexin V-FITC, TUNEL and western blot assays and for its chemical composition by GC-MS. The results showed a relevant cytotoxic effect of the essential oil towards MDA-MB-231 cells in a dose- and time- dependent manner, with an IC50 of 53.81 ± 1.691 μg/ml but not in the epithelial mammary cell line MCF10A (207.51 ± 3.26 μg/ml). Morphological examination displayed apoptotic characteristics in the treated cells like cell size reduction, membrane blebbing and apoptotic bodies. In addition, the apoptotic rate significantly increased as well as DNA fragmentation and western blot analysis revealed that the essential oil induced apoptosis in the MDA-MB-231 cells via intrinsic pathways due to the activation of Bax, caspases 9 and 3. Phytochemical analysis of the Decatropis bicolor essential oil showed the presence of twenty-three compounds. Major components of the oil were 1,5-cyclooctadiene,3-(methyl-2)propenyl (18.38 %), β-terpineol (8.16 %) and 1-(3-methyl-cyclopent-2-enyl)-cyclohexene (6.12 %). This study suggests that essential oil of Decatropis bicolor has a potential cytotoxic and antitumoral effect against breast cancer cells, with the presence of potential bioactive compounds. Our results contribute to the validation of the anticancer activity of the plant in Mexican traditional medicine.
Li, Xiaobin; Top, Eva M; Wang, Yafei; Brown, Celeste J; Yao, Fei; Yang, Shan; Jiang, Yong; Li, Hui
2014-01-01
A self-transmissible broad-host-range (BHR) plasmid pSFA231 was isolated from petroleum-contaminated sediment in Shen-fu wastewater irrigation zone, China, using the triparental mating exogenous plasmid capture method. Based on its complete sequence the plasmid has a size of 41.5 kb and codes for 50 putative open reading frames (orfs), 29 of which represent genes involved in replication, partitioning and transfer functions of the plasmid. Phylogenetic analysis grouped pSFA231 into the newly defined PromA plasmid family, which currently includes five members. Further comparative genomic analysis shows that pSFA231 shares the common backbone regions with the other PromA plasmids, i.e., genes involved in replication, maintenance and control, and conjugative transfer. Nevertheless, phylogenetic divergence was found in specific gene products. We propose to divide the PromA group into two subgroups, PromA-α (pMRAD02, pSB102) and PromA-β (pMOL98, pIPO2T, pSFA231, pTer331), based on the splits network analysis of the RepA protein. Interestingly, a cluster of hypothetical orfs located between parA and traA of pSFA231 shows high similarity with the corresponding regions on pMOL98, pIPO2T, and pTer331, suggesting these hypothetical orfs may represent "essential" plasmid backbone genes for the PromA-β subgroup. Alternatively, they may also be accessory genes that were first acquired and then stayed as the plasmid diverged. Our study increases the available collection of complete genome sequences of BHR plasmids, and since pSFA231 is the only characterized PromA plasmid from China, our findings also enhance our understanding of the genetic diversity of this plasmid group in different parts of the world.
Directory of Open Access Journals (Sweden)
Xiaobin eLi
2015-01-01
Full Text Available A self-transmissible broad-host-range (BHR plasmid pSFA231 was isolated from petroleum-contaminated sediment in Shen-fu wastewater irrigation zone, China, using the triparental mating exogenous plasmid capture method. Based on its complete sequence the plasmid has a size of 41.5 kb and codes for 50 putative open reading frames (orfs, 28 of which represent genes involved in replication, partitioning and transfer functions of the plasmid. Phylogenetic analysis grouped pSFA231 into the newly defined PromA plasmid family, which currently includes five members. Further comparative genomic analysis shows that pSFA231 shares the common backbone regions with the other PromA plasmids, i.e., genes involved in replication, maintenance and control, and conjugative transfer. Nevertheless, phylogenetic divergence was found in specific gene products. We propose to divide the PromA group into two subgroups, PromA-α (pMRAD02, pSB102 and PromA-β (pMOL98, pIPO2T, pSFA231, pTer331, based on the splits network analysis of the RepA protein. Interestingly, a cluster of hypothetical orfs located between parA and traA of pSFA231 shows high similarity with the corresponding regions on pMOL98, pIPO2T and pTer331, suggesting these hypothetical orfs may represent ‘‘essential’’ plasmid backbone genes for the PromA-β subgroup. Alternatively, they may also be accessory genes that were first acquired and then stayed as the plasmid diverged. Our study increases the available collection of complete genome sequences of BHR plasmids, and since pSFA231 is the only characterized PromA plasmid from China, our findings also enhance our understanding of the genetic diversity of this plasmid group in different parts of the world.
International Nuclear Information System (INIS)
Talhouk, Rabih S.; Fares, Mohamed-Bilal; Rahme, Gilbert J.; Hariri, Hanaa H.; Rayess, Tina; Dbouk, Hashem A.; Bazzoun, Dana; Al-Labban, Dania; El-Sabban, Marwan E.
2013-01-01
Connexins (Cx), gap junction (GJ) proteins, are regarded as tumor suppressors, and Cx43 expression is often down regulated in breast tumors. We assessed the effect of Cx43 over-expression in 2D and 3D cultures of two breast adenocarcinoma cell lines: MCF-7 and MDA-MB-231. While Cx43 over-expression decreased proliferation of 2D and 3D cultures of MCF-7 by 56% and 80% respectively, MDA-MB-231 growth was not altered in 2D cultures, but exhibited 35% reduction in 3D cultures. C-terminus truncated Cx43 did not alter proliferation. Untransfected MCF-7 cells formed spherical aggregates in 3D cultures, and MDA-MB-231 cells formed stellar aggregates. However, MCF-7 cells over-expressing Cx43 formed smaller sized clusters and Cx43 expressing MDA-MB-231 cells lost their stellar morphology. Extravasation ability of both MCF-7 and MDA-MB-231 cells was reduced by 60% and 30% respectively. On the other hand, silencing Cx43 in MCF10A cells, nonneoplastic human mammary cell line, increased proliferation in both 2D and 3D cultures, and disrupted acinar morphology. Although Cx43 over-expression did not affect total levels of β-catenin, α-catenin and ZO-2, it decreased nuclear levels of β-catenin in 2D and 3D cultures of MCF-7 cells, and in 3D cultures of MDA-MB-231 cells. Cx43 associated at the membrane with α-catenin, β-catenin and ZO-2 in 2D and 3D cultures of MCF-7 cells, and only in 3D conditions in MDA-MB-231 cells. This study suggests that Cx43 exerts tumor suppressive effects in a context-dependent manner where GJ assembly with α-catenin, β-catenin and ZO-2 may be implicated in reducing growth rate, invasiveness, and, malignant phenotype of 2D and 3D cultures of MCF-7 cells, and 3D cultures of MDA-MB-231 cells, by sequestering β-catenin away from nucleus. - Highlights: • Cx43 over-expressing MCF-7 and MDA-MB-231 were grown in 2D and 3D cultures. • Proliferation and growth morphology were affected in a context dependent manner. • Extravasation ability of both MCF
Energy Technology Data Exchange (ETDEWEB)
Talhouk, Rabih S., E-mail: rtalhouk@aub.edu.lb [Department of Biology, Faculty of Arts and Sciences, American University of Beirut, P.O. Box 11-0236, Beirut (Lebanon); Fares, Mohamed-Bilal; Rahme, Gilbert J.; Hariri, Hanaa H.; Rayess, Tina; Dbouk, Hashem A.; Bazzoun, Dana; Al-Labban, Dania [Department of Biology, Faculty of Arts and Sciences, American University of Beirut, P.O. Box 11-0236, Beirut (Lebanon); El-Sabban, Marwan E., E-mail: me00@aub.edu.lb [Department of Anatomy, Cell Biology and Physiology, Faculty of Medicine, American University of Beirut, P.O. Box 11-0236, Beirut (Lebanon)
2013-12-10
Connexins (Cx), gap junction (GJ) proteins, are regarded as tumor suppressors, and Cx43 expression is often down regulated in breast tumors. We assessed the effect of Cx43 over-expression in 2D and 3D cultures of two breast adenocarcinoma cell lines: MCF-7 and MDA-MB-231. While Cx43 over-expression decreased proliferation of 2D and 3D cultures of MCF-7 by 56% and 80% respectively, MDA-MB-231 growth was not altered in 2D cultures, but exhibited 35% reduction in 3D cultures. C-terminus truncated Cx43 did not alter proliferation. Untransfected MCF-7 cells formed spherical aggregates in 3D cultures, and MDA-MB-231 cells formed stellar aggregates. However, MCF-7 cells over-expressing Cx43 formed smaller sized clusters and Cx43 expressing MDA-MB-231 cells lost their stellar morphology. Extravasation ability of both MCF-7 and MDA-MB-231 cells was reduced by 60% and 30% respectively. On the other hand, silencing Cx43 in MCF10A cells, nonneoplastic human mammary cell line, increased proliferation in both 2D and 3D cultures, and disrupted acinar morphology. Although Cx43 over-expression did not affect total levels of β-catenin, α-catenin and ZO-2, it decreased nuclear levels of β-catenin in 2D and 3D cultures of MCF-7 cells, and in 3D cultures of MDA-MB-231 cells. Cx43 associated at the membrane with α-catenin, β-catenin and ZO-2 in 2D and 3D cultures of MCF-7 cells, and only in 3D conditions in MDA-MB-231 cells. This study suggests that Cx43 exerts tumor suppressive effects in a context-dependent manner where GJ assembly with α-catenin, β-catenin and ZO-2 may be implicated in reducing growth rate, invasiveness, and, malignant phenotype of 2D and 3D cultures of MCF-7 cells, and 3D cultures of MDA-MB-231 cells, by sequestering β-catenin away from nucleus. - Highlights: • Cx43 over-expressing MCF-7 and MDA-MB-231 were grown in 2D and 3D cultures. • Proliferation and growth morphology were affected in a context dependent manner. • Extravasation ability of both MCF
Cytotoxic effect of sanguiin H-6 on MCF-7 and MDA-MB-231 human breast carcinoma cells.
Park, Eun-Ji; Lee, Dahae; Baek, Seon-Eun; Kim, Ki Hyun; Kang, Ki Sung; Jang, Tae Su; Lee, Hye Lim; Song, Ji Hoon; Yoo, Jeong-Eun
2017-09-15
Sanguiin H-6 is a dimer of casuarictin linked by a bond between the gallic acid residue and one of the hexahydroxydiphenic acid units. It is an effective compound extracted from Rubus coreanus. It has an anticancer effect against several human cancer cells; however, its effect on breast cancer cells has not been clearly demonstrated. Thus, we aimed to investigate the anticancer effect and mechanism of action of sanguiin H-6 against two human breast carcinoma cell lines (MCF-7 and MDA-MB-231). We found that sanguiin H-6 significantly reduced cell viability in a concentration-dependent manner. It also increased the rates at which MCF-7 and MDA-MB-231 cells underwent apoptosis. Furthermore, sanguiin H-6 induced the cleavage of caspase-8, caspase-3, and poly(ADP-ribose) polymerase, which resulted in apoptosis. However, cleavage of caspase-9 was only detectable in MCF-7 cells. In addition, sanguiin H-6 increased the ratio of Bax to Bcl-2 in both MCF-7 and MDA-MB-231 cells. These findings suggest that sanguiin H-6 is a potent therapeutic agent against breast cancer cells. In addition, it exerts its anticancer effect in an estrogen-receptor-independent manner. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Shih-Shin Liang
2014-11-01
Full Text Available Phthalates are a class of plasticizers that have been characterized as endocrine disrupters, and are associated with genital diseases, cardiotoxicity, hepatotoxicity, and nephrotoxicity in the GeneOntology gene/protein database. In this study, we synthesized phthalic acid chemical probes and demonstrated differing protein–protein interactions between MCF-7 cells and MDA-MB-231 breast cancer cell lines. Phthalic acid chemical probes were synthesized using silicon dioxide particle carriers, which were modified using the silanized linker 3-aminopropyl triethoxyslane (APTES. Incubation with cell lysates from breast cancer cell lines revealed interactions between phthalic acid and cellular proteins in MCF-7 and MDA-MB-231 cells. Subsequent proteomics analyses indicated 22 phthalic acid-binding proteins in both cell types, including heat shock cognate 71-kDa protein, ATP synthase subunit beta, and heat shock protein HSP 90-beta. In addition, 21 MCF-7-specific and 32 MDA-MB-231 specific phthalic acid-binding proteins were identified, including related proteasome proteins, heat shock 70-kDa protein, and NADPH dehydrogenase and ribosomal correlated proteins, ras-related proteins, and members of the heat shock protein family, respectively.
5 CFR 9701.231 - Conversion of positions and employees to the DHS classification system.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Conversion of positions and employees to... Provisions § 9701.231 Conversion of positions and employees to the DHS classification system. (a) This... from the GS system, a prevailing rate system, the SL/ST system, or the SES system, as provided in...
Ghafari, Fereshteh; Rajabi, Mohammad Reza; Mazoochi, Tahereh; Taghizadeh, Mohsen; Nikzad, Hossein; Atlasi, Mohammad Ali; Taherian, Aliakbar
2017-03-01
Objective: Breast cancer is a heterogeneous disease and very common malignancy in women worldwide. The efficacy of chemotherapy as an important part of breast cancer treatment is limited due to its side effects. While pharmaceutical companies are looking for better chemicals, research on traditional medicines that generally have fewer side effects is quite interesting. In this study, apoptosis and necrosis effect of Arctium lappa and doxorubicin was compared in MCF7, and MDA-MB-231 cell lines. Materials and Methods: MCF7 and MDA-MB-231 cells were cultured in RPMI 1640 containing 10% FBS and 100 U/ml penicillin/streptomycin. MTT assay and an annexin V/propidium iodide (AV/PI) kit were used respectively to compare the survival rate and apoptotic effects of different concentrations of doxorubicin and Arctium lappa root extract on MDA-MB-231 and MCF7 cells. Results: Arctium lappa root extract was able to reduce cell viability of the two cell lines in a dose and time dependent manner similar to doxorubicin. Flow cytometry results showed that similar to doxorubicin, Arctium Lappa root extract had a dose and time dependent apoptosis effect on both cell lines. 10μg/mL of Arctium lappa root extract and 5 μM of doxorubicin showed the highest anti-proliferative and apoptosis effect in MCF7 and MDA231 cells. Conclusion: The MCF7 (ER/PR-) and MDA-MB-231 (ER/PR+) cell lines represent two major breast cancer subtypes. The similar anti-proliferative and apoptotic effects of Arctium lappa root extract and doxorubicin (which is a conventional chemotherapy drug) on two different breast cancer cell lines strongly suggests its anticancer effects and further studies. Creative Commons Attribution License
Directory of Open Access Journals (Sweden)
Youn Kyung Choi
2014-01-01
Full Text Available Cancer inflammation promotes cancer progression, resulting in a high risk of cancer. Here, we demonstrate that our new herbal extract, SH003, suppresses both tumor growth and metastasis of MDA-MB-231 breast cancer cells via inhibiting STAT3-IL-6 signaling path. Our new herbal formula, SH003, mixed extract from Astragalus membranaceus, Angelica gigas, and Trichosanthes kirilowii Maximowicz, suppressed MDA-MB-231 tumor growth and lung metastasis in vivo and reduced the viability and metastatic abilities of MDA-MB-231 cells in vitro. Furthermore, SH003 inhibited STAT3 activation, which resulted in a reduction of IL-6 production. Therefore, we conclude that SH003 suppresses highly metastatic breast cancer growth and metastasis by inhibiting STAT3-IL-6 signaling path.
Antitumor Activity of Chinese Propolis in Human Breast Cancer MCF-7 and MDA-MB-231 Cells
Directory of Open Access Journals (Sweden)
Hongzhuan Xuan
2014-01-01
Full Text Available Chinese propolis has been reported to possess various biological activities such as antitumor. In present study, anticancer activity of ethanol extract of Chinese propolis (EECP at 25, 50, 100, and 200 μg/mL was explored by testing the cytotoxicity in MCF-7 (human breast cancer ER(+ and MDA-MB-231 (human breast cancer ER(− cells. EECP revealed a dose- and time-dependent cytotoxic effect. Furthermore, annexin A7 (ANXA7, p53, nuclear factor-κB p65 (NF-κB p65, reactive oxygen species (ROS levels, and mitochondrial membrane potential were investigated. Our data indicated that treatment of EECP for 24 and 48 h induced both cells apoptosis obviously. Exposure to EECP significantly increased ANXA7 expression and ROS level, and NF-κB p65 level and mitochondrial membrane potential were depressed by EECP dramatically. The effects of EECP on p53 level were different in MCF-7 and MDA-MB-231 cells, which indicated that EECP exerted its antitumor effects in MCF-7 and MDA-MB-231 cells by inducing apoptosis, regulating the levels of ANXA7, p53, and NF-κB p65, upregulating intracellular ROS, and decreasing mitochondrial membrane potential. Interestingly, EECP had little or small cytotoxicity on normal human umbilical vein endothelial cells (HUVECs. These results suggest that EECP is a potential alternative agent on breast cancer treatment.
International Nuclear Information System (INIS)
Gupta, Chanchal; Kaur, Jasmine; Tikoo, Kulbhushan
2014-01-01
Hyperglycemia is a critical risk factor for development and progression of breast cancer. We have recently reported that high glucose induces phosphorylation of histone H3 at Ser 10 as well as de-phosphorylation of GSK-3β at Ser 9 in MDA-MB-231 cells. Here, we elucidate the mechanism underlying hyperglycemia-induced proliferation in MDA-MB-231 breast cancer cells. We provide evidence that hyperglycemia led to increased DNA methylation and DNMT1 expression in MDA-MB-231 cells. High glucose condition led to significant increase in the expression of PCNA, cyclin D1 and decrease in the expression of PTPN 12, p21 and PTEN. It also induced hypermethylation of DNA at the promoter region of PTPN 12, whereas hypomethylation at Vimentin and Snail. Silencing of GSK-3β by siRNA prevented histone H3 phosphorylation and reduced DNMT1 expression. We show that chromatin obtained after immunoprecipitation with phospho-histone H3 was hypermethylated under high glucose condition, which indicates a cross-talk between DNA methylation and histone H3 phosphorylation. ChIP-qPCR analysis revealed up-regulation of DNMT1 and metastatic genes viz. Vimentin, Snail and MMP-7 by phospho-histone H3, which were down-regulated upon GSK-3β silencing. To the best of our knowledge, this is the first report which shows that interplay between GSK-3β activation, histone H3 phosphorylation and DNA methylation directs proliferation of breast cancer cells. - Highlights: • High glucose induces phosphorylation of histone H3 and dephosphorylation of GSK-3β. • Moreover, hyperglycemia also leads to increased DNA methylation in MDA-MB-231 cells. • Inhibition of GSK-3β prevented histone H3 phosphorylation and reduced DNMT1 levels. • Interplay exists between GSK-3β, histone H3 phosphorylation and DNA methylation
Energy Technology Data Exchange (ETDEWEB)
Gupta, Chanchal; Kaur, Jasmine; Tikoo, Kulbhushan, E-mail: tikoo.k@gmail.com
2014-05-15
Hyperglycemia is a critical risk factor for development and progression of breast cancer. We have recently reported that high glucose induces phosphorylation of histone H3 at Ser 10 as well as de-phosphorylation of GSK-3β at Ser 9 in MDA-MB-231 cells. Here, we elucidate the mechanism underlying hyperglycemia-induced proliferation in MDA-MB-231 breast cancer cells. We provide evidence that hyperglycemia led to increased DNA methylation and DNMT1 expression in MDA-MB-231 cells. High glucose condition led to significant increase in the expression of PCNA, cyclin D1 and decrease in the expression of PTPN 12, p21 and PTEN. It also induced hypermethylation of DNA at the promoter region of PTPN 12, whereas hypomethylation at Vimentin and Snail. Silencing of GSK-3β by siRNA prevented histone H3 phosphorylation and reduced DNMT1 expression. We show that chromatin obtained after immunoprecipitation with phospho-histone H3 was hypermethylated under high glucose condition, which indicates a cross-talk between DNA methylation and histone H3 phosphorylation. ChIP-qPCR analysis revealed up-regulation of DNMT1 and metastatic genes viz. Vimentin, Snail and MMP-7 by phospho-histone H3, which were down-regulated upon GSK-3β silencing. To the best of our knowledge, this is the first report which shows that interplay between GSK-3β activation, histone H3 phosphorylation and DNA methylation directs proliferation of breast cancer cells. - Highlights: • High glucose induces phosphorylation of histone H3 and dephosphorylation of GSK-3β. • Moreover, hyperglycemia also leads to increased DNA methylation in MDA-MB-231 cells. • Inhibition of GSK-3β prevented histone H3 phosphorylation and reduced DNMT1 levels. • Interplay exists between GSK-3β, histone H3 phosphorylation and DNA methylation.
Kwiatkowska, Ewa; Wojtala, Martyna; Gajewska, Agnieszka; Soszyński, Mirosław; Bartosz, Grzegorz; Sadowska-Bartosz, Izabela
2016-02-01
Novel approaches to cancer chemotherapy employ metabolic differences between normal and tumor cells, including the high dependence of cancer cells on glycolysis ("Warburg effect"). 3-Bromopyruvate (3-BP), inhibitor of glycolysis, belongs to anticancer drugs basing on this principle. 3-BP was tested for its capacity to kill human non-invasive MCF-7 and invasive MDA-MB-231 breast cancer cells. We found that 3-BP was more toxic for MDA-MB-231 cells than for MCF-7 cells. In both cell lines, a statistically significant decrease of ATP and glutathione was observed in a time- and 3-BP concentration-dependent manner. Transient increases in the level of reactive oxygen species and reactive oxygen species was observed, more pronounced in MCF-7 cells, followed by a decreasing tendency. Activities of glutathione peroxidase, glutathione reductase (GR) and glutathione S-transferase (GST) decreased in 3-BP treated MDA-MB-231 cells. For MCF-7 cells decreases of GR and GST activities were noted only at the highest concentration of 3-BP.These results point to induction of oxidative stress by 3-BP via depletion of antioxidants and inactivation of antioxidant enzymes, more pronounced in MDA-MB-231 cells, more sensitive to 3-BP.
Opportunistic infections and malignancies in 231 Danish AIDS patients
DEFF Research Database (Denmark)
Pedersen, C; Gerstoft, J; Tauris, P
1990-01-01
We analysed cumulative disease frequencies in the first 231 adult Danish AIDS patients with life tables. There was a certain hierarchical pattern in the occurrence of complicating diseases. Herpes zoster, Kaposi's sarcoma and Pneumocystis carinii pneumonia were early manifestations, whereas...... diseases caused by cytomegalovirus and atypical mycobacteria tended to occur later in the course of AIDS. Compared with all other AIDS patients, homosexual men were more likely to develop Kaposi's sarcoma, cytomegalovirus chorioretinitis and mucocutaneous herpes simplex virus infection. The proportion...... of patients who developed particular diseases changed with calendar time. Most striking was a three to fourfold decrease in diseases caused by cytomegalovirus. In conclusion, the study showed that disease frequencies in patients with AIDS may vary with the patients risk behaviour and duration of AIDS...
The Effect of Histone Hyperacetylation on Viability of Basal-Like Breast Cancer Cells MDA-MB-231
Directory of Open Access Journals (Sweden)
Aliasghar Rahimian
2017-06-01
Full Text Available Background The Basal-Like breast cancer, is always known for lack of expression of estrogen receptor (ER, progesterone receptor (PR and as well, absence of epidermal growth factor receptor 2 (HER2 gene amplification. Improper expression pattern of ER, PR, and Her2, makes Basal-Like breast tumors resistant to the current hormonal and anti HER2 treatments. In recent decades, several studies have been conducted to investigate the regulatory role of chemical modifications of core histones in gene expression. Their results have shown that histone acetylation is involved in regulation of cell survival. Acetylation of core histones is regulated by the epigenetic-modifying enzymes named Histone Deacetylases (HDACs. As a new approach to control the viability of breast tumor cells resistant to the hormonal and anti-HER2 treatments, we have targeted the HDACs. Using Trichostatin A (TSA as a known HDACs inhibitor, we have tried to hyperacetylate the core histones of MDA-MB-231 cells as an in vitro model of Basal-Like breast tumors. Then we have investigated the effect of histone hyperacetylation on viability of MDA-MB-231 cells. Methods MDA-MB-231 cells were cultured in RPMI 1640 medium containing 10% fetal bovine serum (FBS and were incubated at 37°C, in a humidified incubator with 5% CO2 atmosphere. Then cells were treated with different concentrations of TSA including: 50, 100, 200, 400, 800 and 1000 nM or control (1% DMSO. After 24 and 48 hours, viability of cells was evaluated by MTT assay. Results After 24 and 48h exposure to different concentrations of TSA, MDA-MB-231 cells showed a maximum tolerable dose. At higher concentrations, TSA decreased the percentage of cell viability through a time-dose dependent manner. IC50 value for 48h treatment was 600 nM. Conclusions Our results indicate that HDACs inhibition and subsequently hyperacetylation of histones, leads to cytotoxic effects on breast tumor cells resistant to the current treatments. Following
PEA3 activates CXCR4 transcription in MDA-MB-231 and MCF7 breast cancer cells
Institute of Scientific and Technical Information of China (English)
Shengmei Gu; Li Chen; Qi Hong; Tingting Yan; Zhigang Zhuang; Qiaoqiao wang; Wei Jin; Hua Zhu; Jiong Wu
2011-01-01
CXC chemokine receptor 4 (CXCR4) is a cell surface receptor that has been shown to mediate the metastasis of many solid tumors including lung,breast,kidney,and prostate tumors.In this study,we found that overexpression of ets variant gene 4 (PEA3) could elevate CXCR4 mRNA level and CXCR4 promoter activity in human MDA-MB-231 and MCF-7 breast cancer cells.PEA3 promoted CXCR4 expression and breast cancer metastasis.Chromatin immunoprecipitation assay demonstrated that PEA3 could bind to the CXCR4 promoter in the cells transfected with PEA3 expression vector.PEA3 siRNA attenuated CXCR4 promoter activity and the binding of PEA3 to the CXCR4 promoter in MDA-MB-231 and MCF-7 cells.These results indicated that PEA3 could activate CXCR4 promoter transcription and promote breast cancer metastasis.
Directory of Open Access Journals (Sweden)
Mohsen Marvibaigi
Full Text Available Scurrula ferruginea (Jack Danser is one of the mistletoe species belonging to Loranthaceae family, which grows on the branches of many deciduous trees in tropical countries. This study evaluated the antioxidant activities of S. ferruginea extracts. The cytotoxic activity of the selected extracts, which showed potent antioxidant activities, and high phenolic and flavonoid contents, were investigated in human breast cancer cell line (MDA-MB-231 and non-cancer human skin fibroblast cells (HSF-1184. The activities and characteristics varied depending on the different parts of S. ferruginea, solvent polarity, and concentrations of extracts. The stem methanol extract showed the highest amount of both phenolic (273.51 ± 4.84 mg gallic acid/g extract and flavonoid contents (163.41 ± 4.62 mg catechin/g extract and strong DPPH• radical scavenging (IC50 = 27.81 μg/mL and metal chelation activity (IC50 = 80.20 μg/mL. The stem aqueous extract showed the highest ABTS•+ scavenging ability. The stem methanol and aqueous extracts exhibited dose-dependent cytotoxic activity against MDA-MB-231 cells with IC50 of 19.27 and 50.35 μg/mL, respectively. Furthermore, the extracts inhibited the migration and colony formation of MDA-MB-231 cells in a concentration-dependent manner. Morphological observations revealed hallmark properties of apoptosis in treated cells. The methanol extract induced an increase in ROS generation and mitochondrial depolarization in MDA-MB-231 cells, suggesting its potent apoptotic activity. The present study demonstrated that the S. ferruginea methanol extract mediated MDA-MB-231 cell growth inhibition via induction of apoptosis which was confirmed by Western blot analysis. It may be a potential anticancer agent; however, its in vivo anticancer activity needs to be investigated.
2010-04-01
... SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.231...
Radio-sensitization by Piper longumine of human breast adenoma MDA-MB-231 cells in vitro.
Yao, Jian-Xin; Yao, Zhi-Feng; Li, Zhan-Feng; Liu, Yong-Biao
2014-01-01
The current study investigated the effects of Piper longumine on radio-sensitization of human breast cancer MDA-MB-231 cells and underlying mechanisms. Human breast cancer MDA-MB-231 cells were cultured in vitro and those in logarithmic growth phase were selected for experiments divided into four groups: control, X-ray exposed, Piper longumine, and Piper longumine combined with X-rays. Conogenic assays were performed to determine the radio-sensitizing effects. Cell survival curves were fitted by single-hit multi-target model and then the survival fraction (SF), average lethal dose (D0), quasi-threshold dose (Dq) and sensitive enhancement ratio (SER) were calculated. Cell apoptosis was analyzed by flow cytometry (FCM).Western blot assays were employed for expression of apoptosis-related proteins (Bc1-2 and Bax) after treatment with Piper longumine and/or X-ray radiation. The intracellular reactive oxygen species (ROS) level was detected by FCM with a DCFH-DA probe. The cloning formation capacity was decreased in the group of piperlongumine plus radiation, which displayed the values of SF2, D0, Dq significantly lower than those of radiation alone group and the sensitive enhancement ratio (SER) of D0 was1.22 and 1.29, respectively. The cell apoptosis rate was increased by the combination treatment of Piper longumine and radiation. Piper longumine increased the radiation-induced intracellular levels of ROS. Compared with the control group and individual group, the combination group demonstrated significantly decreased expression of Bcl-2 with increased Bax. Piper longumine at a non-cytotoxic concentration can enhance the radio-sensitivity of MDA- MB-231cells, which may be related to its regulation of apoptosis-related protein expression and the increase of intracellular ROS level, thus increasing radiation-induced apoptosis.
Byrne, A. R.; Benedik, L.
1999-01-01
Neutron activation analysis (NAA), being essentially an isotopic and not an elemental method of analysis, is capable of determining a number of important radionuclides of radioecological interest by transformation into another, more easily quantifiable radionuclide. The nuclear characteristics which favour this technique may be summarized in an advantage factor relative to radiometric analysis of the original radioanalyte. Well known or hardly known examples include235U,238U,232Th,230Th,129I,99Tc,237Np and231Pa; a number of these are discussed and illustrated in analysis of real samples of environmental and biological origin. In particular, determination of231Pa by RNAA was performed using both postirradiation and preseparation methods. Application of INAA to enable the use of238U and232Th as endogenous (internal) radiotracers in alpha spectrometric analyses of uranium and thorium radioisotopes in radioecological studies is described, also allowing independent data sets to be obtained for quality control.
Energy Technology Data Exchange (ETDEWEB)
Falcao, Patricia L.; Campos, Tarcisio P.R., E-mail: campos@nuclear.ufmg.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear; Sarmento, Eduardo V. [Centro de Desenvolvimento de Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Cuperschmid, Ethel M. [Universidade Federal de Minas Gerais (CEMEMOR/UFMG), Belo Horizonte, BR (Brazil). Fac. de Medicina. Centro de Memoria da Medicina
2011-07-01
Herein, the deleterious effect of ionizing radiation provided by Ho-166 radioactive seeds at low activity were addressed, based on experimental in vitro assays at the MDA MB231 cell lineage, a breast adenocarcinoma, compared to PBMC - peripheral blood cells. The methodology involves of the MDBMB-231 and PBMC expansion in culture in suitable environment in 30mm well plates and T-25 flasks. Seeds were synthesized with Ho-165 incorporated and characterized previously. Activation was processed at IPR1 reactor at the peripheral table, at 8h exposition. Three groups of seeds were tested: 0,34 mCi, 0,12 mCi activity, and control group. Such seeds were placed on culture and held to a period of 05 half-lives of the radionuclide. The biological responses at these exposure were documented by inverse microscopic photographic in time. Also, MTT essay were performed. A fast response in producing deleterious effects at cancer cell was observed even if for the low activity seeds. Also, a biological response dependent to a radial distance of the seed was observed. At conclusion, viability clonogenic control of MDAMB231 is identified at the exposition to Ho-166 ceramic seeds, even if at low activity of 0,1 to 0,3mCi. (author)
International Nuclear Information System (INIS)
Falcao, Patricia L.; Campos, Tarcisio P.R.; Cuperschmid, Ethel M.
2011-01-01
Herein, the deleterious effect of ionizing radiation provided by Ho-166 radioactive seeds at low activity were addressed, based on experimental in vitro assays at the MDA MB231 cell lineage, a breast adenocarcinoma, compared to PBMC - peripheral blood cells. The methodology involves of the MDBMB-231 and PBMC expansion in culture in suitable environment in 30mm well plates and T-25 flasks. Seeds were synthesized with Ho-165 incorporated and characterized previously. Activation was processed at IPR1 reactor at the peripheral table, at 8h exposition. Three groups of seeds were tested: 0,34 mCi, 0,12 mCi activity, and control group. Such seeds were placed on culture and held to a period of 05 half-lives of the radionuclide. The biological responses at these exposure were documented by inverse microscopic photographic in time. Also, MTT essay were performed. A fast response in producing deleterious effects at cancer cell was observed even if for the low activity seeds. Also, a biological response dependent to a radial distance of the seed was observed. At conclusion, viability clonogenic control of MDAMB231 is identified at the exposition to Ho-166 ceramic seeds, even if at low activity of 0,1 to 0,3mCi. (author)
Chiu, Jen-Hwey; Chen, Fang-Pey; Tsai, Yi-Fang; Lin, Man-Ting; Tseng, Ling-Ming; Shyr, Yi-Ming
2017-08-12
Our previous study demonstrated that an up-regulation of the Brain-Derived Neurotrophic Factor (BDNF) signaling pathway is involved the mechanism causing the recurrence of triple negative breast cancer. The aim of this study is to investigate the effects of commonly used Chinese medicinal herbs on MDA-MB-231 and HUVEC cells and how they interact with BDNF. Human TNBC MDA-MB-231 cells and human endothelial HUVEC cells were used to explore the effect of commonly used Chinese herbal medicines on cancer cells alone, on endothelial cells alone and on cancer cell/endothelial cell interactions; this was done via functional studies, including migration and invasion assays. Furthermore, Western blot analysis and real-time PCR investigations were also used to investigate migration signal transduction, invasion signal transduction, and angiogenic signal transduction in these systems. Finally, the effect of the Chinese medicinal herbs on cancer cell/endothelial cell interactions was assessed using co-culture and ELISA. In terms of autoregulation, BDNF up-regulated TrkB gene expression in both MDA-MB-231 and HUVEC cells. Furthermore, BDNF enhanced migration by MDA-MB-231 cells via Rac, Cdc42 and MMP, while also increasing the migration of HUVEC cells via MMP and COX-2 expression. As measured by ELISA, the Chinese herbal medicinal herbs A. membranaceus, P. lactiflora, L. chuanxiong, P. suffruticosa and L. lucidum increased BDNF secretion by MDA-MB-231 cells. Similarly, using a co-culture system with MDA-MB-231 cells, A. membranaceus and L. lucidum modulated BDNF-TrkB signaling by HUVEC cells. We conclude that BDNF plays an important role in the metastatic interaction between MDA-MB-231 and HUVEC cells. Some Chinese medicinal herbs are able to enhance the BDNF-related metastatic potential of the interaction between cancer cells and endothelial cells. These findings provide important information that should help with the development of integrated medical therapies for breast
Flavokawain A induces apoptosis in MCF-7 and MDA-MB231 and inhibits the metastatic process in vitro.
Directory of Open Access Journals (Sweden)
Nadiah Abu
Full Text Available The kava-kava plant (Piper methsyticum is traditionally known as the pacific elixir by the pacific islanders for its role in a wide range of biological activities. The extract of the roots of this plant contains a variety of interesting molecules including Flavokawain A and this molecule is known to have anti-cancer properties. Breast cancer is still one of the leading diagnosed cancers in women today. The metastatic process is also very pertinent in the progression of tumorigenesis.MCF-7 and MDA-MB231 cells were treated with several concentrations of FKA. The apoptotic analysis was done through the MTT assay, BrdU assay, Annexin V analysis, cell cycle analysis, JC-1 mitochondrial dye, AO/PI dual staining, caspase 8/9 fluorometric assay, quantitative real time PCR and western blot. For the metastatic assays, the in vitro scratch assay, trans-well migration/invasion assay, HUVEC tube formation assay, ex vivo rat aortic ring assay, quantitative real time PCR and western blot were employed.We have investigated the effects of FKA on the apoptotic and metastatic process in two breast cancer cell lines. FKA induces apoptosis in both MCF-7 and MDA-MB231 in a dose dependent manner through the intrinsic mitochondrial pathway. Additionally, FKA selectively induces a G2/M arrest in the cell cycle machinery of MDA-MB231 and G1 arrest in MCF-7. This suggests that FKA's anti-cancer activity is dependent on the p53 status. Moreover, FKA also halted the migration and invasion process in MDA-MB231. The similar effects can be seen in the inhibition of the angiogenesis process as well.FKA managed to induce apoptosis and inhibit the metastatic process in two breast cancer cell lines, in vitro. Overall, FKA may serve as a promising candidate in the search of a new anti-cancer drug especially in halting the metastatic process but further in vivo evidence is needed.
Human Sulfatase 2 inhibits in vivo tumor growth of MDA-MB-231 human breast cancer xenografts
International Nuclear Information System (INIS)
Peterson, Sarah M; Concino, Michael F; Liaw, Lucy; Martini, Paolo GV; Iskenderian, Andrea; Cook, Lynette; Romashko, Alla; Tobin, Kristen; Jones, Michael; Norton, Angela; Gómez-Yafal, Alicia; Heartlein, Michael W
2010-01-01
Extracellular human sulfatases modulate growth factor signaling by alteration of the heparin/heparan sulfate proteoglycan (HSPG) 6-O-sulfation state. HSPGs bind to numerous growth factor ligands including fibroblast growth factors (FGF), epidermal growth factors (EGF), and vascular endothelial growth factors (VEGF), and are critically important in the context of cancer cell growth, invasion, and metastasis. We hypothesized that sulfatase activity in the tumor microenvironment would regulate tumor growth in vivo. We established a model of stable expression of sulfatases in the human breast cancer cell line MDA-MB-231 and purified recombinant human Sulfatase 2 (rhSulf2) for exogenous administration. In vitro studies were performed to measure effects on breast cancer cell invasion and proliferation, and groups were statistically compared using Student's t-test. The effects of hSulf2 on tumor progression were tested using in vivo xenografts with two methods. First, MDA-MB-231 cells stably expressing hSulf1, hSulf2, or both hSulf1/hSulf2 were grown as xenografts and the resulting tumor growth and vascularization was compared to controls. Secondly, wild type MDA-MB-231 xenografts were treated by short-term intratumoral injection with rhSulf2 or vehicle during tumor growth. Ultrasound analysis was also used to complement caliper measurement to monitor tumor growth. In vivo studies were statistically analyzed using Student's t test. In vitro, stable expression of hSulf2 or administration of rhSulf2 in breast cancer cells decreased cell proliferation and invasion, corresponding to an inhibition of ERK activation. Stable expression of the sulfatases in xenografts significantly suppressed tumor growth, with complete regression of tumors expressing both hSulf1 and hSulf2 and significantly smaller tumor volumes in groups expressing hSulf1 or hSulf2 compared to control xenografts. Despite significant suppression of tumor volume, sulfatases did not affect vascular
Zhu, Xue; Wang, Ke; Zhang, Kai; Zhang, Ting; Yin, Yongxiang; Xu, Fei
2016-11-22
Due to the aggressive clinical behavior, poor outcome, and lack of effective specific targeted therapies, triple-negative breast cancer (TNBC) has currently been recognized as one of the most malignant types of tumors. In the present study, we investigated the cytotoxic effect of ziyuglycoside I, one of the major components extracted from Chinese anti-tumor herbal Radix Sanguisorbae , on the TNBC cell line MDA-MB-231. The underlying molecular mechanism of the cytotoxic effect ziyuglycoside I on MDA-MB-231 cells was investigated with cell viability assay, flow cytometric analysis and Western blot. Compared to normal mammary gland Hs 578Bst cells, treatment of ziyuglycoside I resulted in a significant growth inhibitory effect on MDA-MB-231 cells. Ziyuglycoside I induced the G2/M phase arrest and apoptosis of MDA-MB-231 cells in a dose-dependent manner. These effects were found to be partially mediated through the up-regulation of p53 and p21 WAF1 , elevated Bax/Bcl-2 ratio, and the activation of both intrinsic (mitochondrial-initiated) and extrinsic (Fas/FasL-initiated) apoptotic pathways. Furthermore, the p53 specific siRNA attenuated these effects. Our study suggested that ziyuglycoside I-triggered MDA-MB-231 cell cycle arrest and apoptosis were probably mediated by p53. This suggests that ziyuglycoside I might be a potential drug candidate for treating TNBC.
Models of the Hydrodynamic Histories of Post-AGB Stars. I. Multiflow Shaping of OH 231.8+04.2
Energy Technology Data Exchange (ETDEWEB)
Balick, Bruce [Department of Astronomy, University of Washington, Seattle, WA 98195-1580 (United States); Frank, Adam; Liu, Baowei [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627 (United States); Huarte-Espinosa, Martín, E-mail: balick@uw.edu, E-mail: afrank@pas.rochester.edu, E-mail: baowei.liu@rochester.edu, E-mail: mhuartee@central.uh.edu [Center for Advanced Comp and Data Systems, University of Houston, 4718 Calhoun Rd., Houston, TX 77204-3058 (United States)
2017-07-10
We present a detailed hydrodynamic model that matches the present structure of the well-observed preplanetary nebula (“pPN”) OH 231.8+04.2 (“OH231”). The purpose of the model is to present a physically justified and coherent picture of its evolutionary history from about 100 years from the start of the formation of its complex outer structures to the present. We have adopted a set of initial conditions that are heavily constrained by high-quality observations of its present structure and kinematics. The shaping of the nebula occurs while the densities of the flows are “light,” i.e., less than the surrounding AGB-wind environment. The simulations show that pairs of essentially coeval clumps and sprays of the same extent and density, but different outflow speeds, sculpted both the pair of thin axial flow “or spine” and the bulbs. The total ejected mass and momentum in the best-fit model are surprisingly large—3 M {sub ⊙} and 2.2 × 10{sup 41} gm cm s{sup −1}, respectively—however, these values are reduced by up to a factor of 10 in other models that fit the data almost as well. Our ultimate goal is to combine the present model results of masses, momenta, flow speeds, and flow geometries for OH231 with those of other models to be published in the future in order to find common attributes of their ejection histories.
International Nuclear Information System (INIS)
Turturro, Francesco; Friday, Ellen; Welbourne, Tomas
2007-01-01
We studied the RNA expression of the genes in response to glucose from 5 mM (condition of normoglycemia) to 20 mM (condition of hyperglycemia/diabetes) by microarray analysis in breast cancer derived cell line MDA-MB-231. We identified the thioredoxin-interacting protein (TXNIP), whose RNA level increased as a gene product particularly sensitive to the variation of the level of glucose in culture media. We investigated the kinesis of the TXNIP RNA and protein in response to glucose and the relationship between this protein and the related thioredoxin (TRX) in regulating the level of reactive oxygen species (ROS) in MDA-MB-231 cells. MDA-MB-231 cells were grown either in 5 or 20 mM glucose chronically prior to plating. For glucose shift (5/20), cells were plated in 5 mM glucose and shifted to 20 mM at time 0. Cells were analyzed with Affymetrix Human U133A microarray chip and gene expression profile was obtained. Semi-quantitative RT-PCR and Western blot was used to validate the expression of TXNIP RNA and protein in response to glucose, respectively. ROS were detected by CM-H2DCFDA (5–6-chloromethyl-2',7'-dichlorodihydrofluorescein diacetate) and measured for mean fluorescence intensity with flow cytometry. TRX activity was assayed by the insulin disulfide reducing assay. We found that the regulation of TXNIP gene expression by glucose in MDA-MB-231 cells occurs rapidly within 6 h of its increased level (20 mM glucose) and persists through the duration of the conditions of hyperglycemia. The increased level of TXNIP RNA is followed by increased level of protein that is associated with increasing levels of ROS and reduced TRX activity. The inhibition of the glucose transporter GLUT1 by phloretin notably reduces TXNIP RNA level and the inhibition of the p38 MAP kinase activity by SB203580 reverses the effects of TXNIP on ROS-TRX activity. In this study we show that TXNIP is an oxidative stress responsive gene and its expression is exquisitely regulated by
Directory of Open Access Journals (Sweden)
Friday Ellen
2007-06-01
Full Text Available Abstract Background We studied the RNA expression of the genes in response to glucose from 5 mM (condition of normoglycemia to 20 mM (condition of hyperglycemia/diabetes by microarray analysis in breast cancer derived cell line MDA-MB-231. We identified the thioredoxin-interacting protein (TXNIP, whose RNA level increased as a gene product particularly sensitive to the variation of the level of glucose in culture media. We investigated the kinesis of the TXNIP RNA and protein in response to glucose and the relationship between this protein and the related thioredoxin (TRX in regulating the level of reactive oxygen species (ROS in MDA-MB-231 cells. Methods MDA-MB-231 cells were grown either in 5 or 20 mM glucose chronically prior to plating. For glucose shift (5/20, cells were plated in 5 mM glucose and shifted to 20 mM at time 0. Cells were analyzed with Affymetrix Human U133A microarray chip and gene expression profile was obtained. Semi-quantitative RT-PCR and Western blot was used to validate the expression of TXNIP RNA and protein in response to glucose, respectively. ROS were detected by CM-H2DCFDA (5–6-chloromethyl-2',7'-dichlorodihydrofluorescein diacetate and measured for mean fluorescence intensity with flow cytometry. TRX activity was assayed by the insulin disulfide reducing assay. Results We found that the regulation of TXNIP gene expression by glucose in MDA-MB-231 cells occurs rapidly within 6 h of its increased level (20 mM glucose and persists through the duration of the conditions of hyperglycemia. The increased level of TXNIP RNA is followed by increased level of protein that is associated with increasing levels of ROS and reduced TRX activity. The inhibition of the glucose transporter GLUT1 by phloretin notably reduces TXNIP RNA level and the inhibition of the p38 MAP kinase activity by SB203580 reverses the effects of TXNIP on ROS-TRX activity. Conclusion In this study we show that TXNIP is an oxidative stress responsive
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
Directory of Open Access Journals (Sweden)
Patrícia Lima Falcão
2015-06-01
Full Text Available Abstract Objective: In the present study, the authors investigated the in vitro behavior of radio-resistant breast adenocarcinoma (MDA-MB-231 cells line and radiosensitive peripheral blood mononuclear cells (PBMC, as a function of different radiation doses, dose rates and postirradiation time kinetics, with a view to the interest of clinical radiotherapy. Materials and Methods: The cells were irradiated with Co-60, at 2 and 10 Gy and two different exposure rates, 339.56 cGy.min–1 and the other corresponding to one fourth of the standard dose rates, present over a 10-year period of cobalt therapy. Post-irradiation sampling was performed at pre-established kinetics of 24, 48 and 72 hours. The optical density response in viability assay was evaluated and a morphological analysis was performed. Results: Radiosensitive PBMC showed decrease in viability at 2 Gy, and a more significant decrease at 10 Gy for both dose rates. MDAMB- 231 cells presented viability decrease only at higher dose and dose rate. The results showed MDA-MB-231 clone expansion at low dose rate after 48–72 hours post-radiation. Conclusion: Low dose rate shows a possible potential clinical impact involving decrease in management of radio-resistant and radiosensitive tumor cell lines in cobalt therapy for breast cancer.
Chen, Xiao-Xin; Leung, George Pak-Heng; Zhang, Zhang-Jin; Xiao, Jian-Bo; Lao, Li-Xing; Feng, Feng; Mak, Judith Choi-Wo; Wang, Ying; Sze, Stephen Cho-Wing; Zhang, Kalin Yan-Bo
2017-09-01
Breast cancer is the most frequently diagnosed cancer and cause of cancer death in women worldwide. Current treatments often result in systematic toxicity and drug resistance. Combinational use of non-toxic phytochemicals with chemotherapeutic agents to enhance the efficacy and reduce toxicity would be one promising approach. In this study, bioactive proanthocyanidins from Uncaria rhynchophylla (UPAs) were isolated and their anti-breast cancer effects alone and in combination with 5- fluorouracil (5-FU) were investigated in MDA-MB-231 breast cancer cells. The results showed that UPAs significantly inhibited cell viability and migration ability in a dose-dependent manner. Moreover, UPAs induced apoptosis in a dose-dependent manner which was associated with increased cellular reactive oxygen species production, loss of mitochondrial membrane potential, increases of Bax/Bcl-2 ratio and levels of cleaved caspase 3. Treatments of the cells with UPAs resulted in an increase in G2/M cell cycle arrest. Cytotoxic effects of 5-FU against MDA-MB-231 cells were enhanced by UPAs. The combination treatment of UPAs and 5-FU for 48 h elicited a synergistic cytotoxic effect on MDA-MB-231 cells. Altogether, these data suggest that UPAs are potential therapeutic agents for breast cancer. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Gillberg-Wickman, M.
1983-03-01
To be able to judge whether protactinium 231 might represent a major contribution to the human radiation risk from high level radioactive waste a literature study of the geochemical behavior of protactinium has been made. The interest in protactinium determinations has, as far, been in the field of marine geochemistry and geochronology. These investigations show that thorium may be used as a chemical analogue. The content of protactinium 231 is determined by the 235 U content and consequently the occurrence of protactinium in nature is directly associated to the geochemistry of uranium. The pronounced hydrolytic tendency of protactinium and its great sorption and coprecipitation capacity ought to prevent or at least appreciably delay its transport from a back-filled nuclear waste vault to the uppermost surface of the earth. It also has a tendency to form colloids or particulates which may be strongly fixed on a rock surface. In adsorption and desorption processes kinetics must play an important role. Our knowledge in this field is quite limited. Under the physico-chemical conditions in the sea, protactinium is rapidly scavenged from the water column by particulates. It accumulates in the sediments. (author)
Teryutin, F M; Barashkov, N A; Kunel'skaya, N L; Pshennikova, V G; Solov'ev, A V
2016-01-01
In the course of previous investigations carried out in the Republic of Sakha (Yakutiya), we have identified the main molecular-genetic factor responsible for the hereditary impairment of hearing among the indigenous population (mostly the Yakuts).The disease was shown to be attributable to the c.-23+1G>A mutation localized in the splice donor site (exon 1) of the GJB2 (Cx26) gene. The present study involved the comprehensive audiological analysis of the patients homozygous for the c.-23+1G>A mutation in the GJB2 gene based on the results of the study of a large sample of the patients residing in Yakutiya. All individuals with the GJB2 genotype c.-23+1G>A/c.-23-1G>A (n=108) at the mean age of 14.32±4.7 years (all ethnic Yakuts)were examined with the use oftonal threshold audiometry for air conduction testing at the frequencies of 0.25, 0.5, 1.0, 2.0, 4.0, and 8.0 kHz and bone conduction testing at the frequencies of 0.25, 0.5, 1.0, and 4.0 with a step of 5.0 dB.The results of the ASSR test were used whenever tonal threshold audiometry proved impracticable The data obtained in the study characterize the allelic form of the disease associated with the GJB2 genotype c.-23+1G>A/c.-23-1G>A as the congenital bilateral symmetric (90.1%), sensorineural (90.1%) form of hearing impairment of variable severity (from grade 1 to complete deafness) with the «flat» audiological profile (median slope not more than 5.0 dB in the extended frequency range (EFR) of 0.5, 1.0, 2.0, and 4.0, kHz). It is concluded that the results of the audiological analysis performed in the present study give evidence of relatively homogeneous but variable in terms of severity impairment of hearing in the patients homozygous for the c.-23+1G>A mutation in the GJB2 (Cx26) gene. It may serve as a positive prognostic sign to be used in the development and prescription of hearing aids.
International Nuclear Information System (INIS)
Aguilar-Rojas, Arturo; Huerta-Reyes, Maira; Maya-Núñez, Guadalupe; Arechavaleta-Velásco, Fabián; Conn, P Michael; Ulloa-Aguirre, Alfredo; Valdés, Jesús
2012-01-01
Gonadotropin-releasing hormone (GnRH) and its receptor (GnRHR) are both expressed by a number of malignant tumors, including those of the breast. In the latter, both behave as potent inhibitors of invasion. Nevertheless, the signaling pathways whereby the activated GnRH/GnRHR system exerts this effect have not been clearly established. In this study, we provide experimental evidence that describes components of the mechanism(s) whereby GnRH inhibits breast cancer cell invasion. Actin polymerization and substrate adhesion was measured in the highly invasive cell line, MDA-MB-231 transiently expressing the wild-type or mutant DesK191 GnRHR by fluorometry, flow cytometric analysis, and confocal microscopy, in the absence or presence of GnRH agonist. The effect of RhoA-GTP on stress fiber formation and focal adhesion assembly was measured in MDA-MB-231 cells co-expressing the GnRHRs and the GAP domain of human p190Rho GAP-A or the dominant negative mutant GAP-Y1284D. Cell invasion was determined by the transwell migration assay. Agonist-stimulated activation of the wild-type GnRHR and the highly plasma membrane expressed mutant GnRHR-DesK191 transiently transfected to MDA-MB-231 cells, favored F-actin polymerization and substrate adhesion. Confocal imaging allowed detection of an association between F-actin levels and the increase in stress fibers promoted by exposure to GnRH. Pull-down assays showed that the effects observed on actin cytoskeleton resulted from GnRH-stimulated activation of RhoA GTPase. Activation of this small G protein favored the marked increase in both cell adhesion to Collagen-I and number of focal adhesion complexes leading to inhibition of the invasion capacity of MDA-MB-231 cells as disclosed by assays in Transwell Chambers. We here show that GnRH inhibits invasion of highly invasive breast cancer-derived MDA-MB-231 cells. This effect is mediated through an increase in substrate adhesion promoted by activation of RhoA GTPase and formation of
Directory of Open Access Journals (Sweden)
Zhenyu Zhong
2018-06-01
Full Text Available The KIAA0100 gene was identified in the human immature myeloid cell line cDNA library. Recent studies have shown that its expression is elevated in breast cancer and associated with more aggressive cancer types as well as poor outcomes. However, its cellular and molecular function is yet to be understood. Here we show that silencing KIAA0100 by siRNA in the breast cancer cell line MDA-MB-231 significantly reduced the cancer cells’ aggressive behavior, including cell aggregation, reattachment, cell metastasis and invasion. Most importantly, silencing the expression of KIAA0100 particularly sensitized the quiescent cancer cells in suspension culture to anoikis. Immunoprecipitation, mass spectrometry and immunofluorescence analysis revealed that KIAA0100 may play multiple roles in the cancer cells, including stabilizing microtubule structure as a microtubule binding protein, and contributing to MDA-MB-231 cells Anoikis resistance by the interaction with stress protein HSPA1A. Our study also implies that the interaction between KIAA0100 and HSPA1A may be targeted for new drug development to specifically induce anoikis cell death in the cancer cell.
International Nuclear Information System (INIS)
Andrade, Lidia Maria; Campos, Tarcisio Passos Ribeiro de; Leite, M.F.; Goes, A.M.
2005-01-01
Radiotherapy using gamma rays is a common modality of breast cancer treatment. The aim of this research is to investigate the biological response of the human breast cancer cell line MDAMB-231 and human peripheral blood mononuclear cells (PBMC) exposed in vitro to 60 Co irradiation at a single fraction of 10 Gy, 25 Gy and 50 Gy doses at 136,4 cGy.min -1 rate. Cells were irradiated at room temperature by the Theratron 80 radiotherapy system. Biological response was evaluated through cellular viability using MTT assay and nucleus damages visualized by Propidium Iodide assay and electrophoresis agarose gel after gamma irradiation. Nucleus damages induced by 60 Co irradiation were compared to damage caused by cell exposure to 10% methanol. The 50 Gy dose of irradiation did not stimulate nucleus damages at the same level as that affected by 10% methanol induction in the MDAMB-231. Further studies are necessary to understand these mechanisms in the MDAMB-231 human breast carcinoma cell line.(author)
Weng, Yuanqi; Yan, Fei; Chen, Runkang; Qian, Ming; Ou, Yun; Xie, Shuhong; Zheng, Hairong; Li, Jiangyu
2018-05-01
Mechanical stimuli drives many physiological processes through mechanically activated channels, and the recent discovery of PIEZO channel has generated great interests in its mechanotransduction. Many previous researches investigated PIEZO proteins by transcribing them in cells that originally have no response to mechanical stimulation, or by forming PIEZO-combined complexes in vitro, and few studied PIEZO protein's natural characteristics in cells. In this study we show that MDA-MB-231, a malignant cell in human breast cancer cell line, expresses the mechanosensitive behavior of PIEZO in nature without extra treatment, and we report its characteristics in response to localized mechanical stimulation under an atomic force microscope, wherein a correlation between the force magnitude applied and the channel opening probability is observed. The results on PIEZO of MDA-MB-231 can help establish a basis of preventing and controlling of human breast cancer cell via mechanical forces.
Reciprocal deletion and duplication at 2q23.1 indicates a role for MBD5 in autism spectrum disorder
Mullegama, S.V.; Rosenfeld, J.A.; Orellana, C.; Bon, B.W.M. van; Halbach, S.; Repnikova, E.A.; Brick, L.; Li, C.; Dupuis, L.; Rosello, M.; Aradhya, S.; Stavropoulos, D.J.; Manickam, K.; Mitchell, E.; Hodge, J.C.; Talkowski, M.E.; Gusella, J.F.; Keller, K.; Zonana, J.; Schwartz, S.; Pyatt, R.E.; Waggoner, D.J.; Shaffer, L.G.; Lin, A.E.; Vries, B. de; Mendoza-Londono, R.; Elsea, S.H.
2014-01-01
Copy number variations associated with abnormal gene dosage have an important role in the genetic etiology of many neurodevelopmental disorders, including intellectual disability (ID) and autism. We hypothesize that the chromosome 2q23.1 region encompassing MBD5 is a dosage-dependent region, wherein
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
Controlli societari e posizioni di garanzia. Un'indagine alla luce del d.lgs. 231/2001
Molinaro, Claudia
2016-01-01
The research aims to examine the impact of Legislative Decree 231/2001, which has established a regulation of criminal compliance and liability of corporations, on the responsibility for the omission to prevent crimes of the members of corporate bodies entrusted to adopt and put into effects compliance programs, and to monitor the operation of such programs. The first part of the thesis contains a doctrinal analysis, which intends to define the requirements of omission to act, with particu...
Directory of Open Access Journals (Sweden)
Banerjee PP
2017-04-01
Full Text Available Prajna Paramita Banerjee,1 Arindam Bandyopadhyay,1 Singapura Nagesh Harsha,2 Rudragoud S Policegoudra,3 Shelley Bhattacharya,4 Niranjan Karak,2 Ansuman Chattopadhyay1 1Molecular Genetics Laboratory, Department of Zoology, Visva-Bharati, Santiniketan, West Bengal, 2Advanced Polymer and Nanomaterial Laboratory, Department of Chemical Sciences, Center for Polymer Science and Technology, Tezpur University, Napaam, 3Division of Pharmaceutical Technology, Defence Research Laboratory, Tezpur, Assam, 4Environmental Toxicology Laboratory, Department of Zoology, Visva-Bharati, Santiniketan, West Bengal, India Introduction: Leaf extract of Mentha arvensis or mint plant was used as reducing agent for the synthesis of green silver nanoparticles (GSNPs as a cost-effective, eco-friendly process compared to that of chemical synthesis. The existence of nanoparticles was characterized by ultraviolet–visible spectrophotometry, dynamic light scattering, Fourier transform infrared spectroscopy, X-ray diffraction, energy-dispersive X-ray analysis, atomic-force microscopy and transmission electron microscopy analyses, which ascertained the formation of spherical GSNPs with a size range of 3–9 nm. Anticancer activities against breast cancer cell lines (MCF7 and MDA-MB-231 were studied and compared with those of chemically synthesized (sodium borohydride [NaBH4]-mediated silver nanoparticles (CSNPs. Materials and methods: Cell survival of nanoparticle-treated and untreated cells was studied by 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT assay. Cell-cycle analyses were carried out using fluorescence-activated cell sorting. Cell morphology was observed by fluorescence microscopy. Expression patterns of PARP1, P53, P21, Bcl2, Bax and cleaved caspase 9 as well as caspase 3 proteins in treated and untreated MCF7 and MDA-MB-231 cells were studied by Western blot method. Results: MTT assay results showed that Mentha arvensis-mediated GSNPs
Withaferin A Induces ROS-Mediated Paraptosis in Human Breast Cancer Cell-Lines MCF-7 and MDA-MB-231.
Directory of Open Access Journals (Sweden)
Kamalini Ghosh
Full Text Available Advancement in cancer therapy requires a better understanding of the detailed mechanisms that induce death in cancer cells. Besides apoptosis, themode of other types of cell death has been increasingly recognized in response to therapy. Paraptosis is a non-apoptotic alternative form of programmed cell death, morphologically distinct from apoptosis and autophagy. In the present study, Withaferin-A (WA induced hyperpolarization of mitochondrial membrane potential and formation of many cytoplasmic vesicles. This was due to progressive swelling and fusion of mitochondria and dilation of endoplasmic reticulum (ER, forming large vacuolar structures that eventually filled the cytoplasm in human breast cancer cell-lines MCF-7 and MDA-MB-231. The level of indigenous paraptosis inhibitor, Alix/AIP-1 (Actin Interacting Protein-1 was down-regulated by WA treatment. Additionally, prevention of WA-induced cell death and vacuolation on co-treatment with protein-synthesis inhibitor indicated requirement of de-novo protein synthesis. Co-treatment with apoptosis inhibitor resulted in significant augmentation of WA-induced death in MCF-7 cells, while partial inhibition in MDA-MB-231 cells; implyingthat apoptosis was not solely responsible for the process.WA-mediated cytoplasmic vacuolationcould not be prevented by autophagy inhibitor wortmanninas well, claiming this process to be a non-autophagic one. Early induction of ROS (Reactive Oxygen Speciesby WA in both the cell-lines was observed. ROS inhibitorabrogated the effect of WA on: cell-death, expression of proliferation-associated factor andER-stress related proteins,splicing of XBP-1 (X Box Binding Protein-1 mRNA and formation of paraptotic vacuoles.All these results conclusively indicate thatWA induces deathin bothMCF-7 and MDA-MB-231 cell lines byROS-mediated paraptosis.
Directory of Open Access Journals (Sweden)
Shuang LONG
2012-11-01
Full Text Available Objective To investigate the effects of exosomes derived from breast cancer cell line MDA-MB-231 on proliferation of human umbilical cord vein endothelial cells (HUVECs, and evaluate the role of MAPK/ERK and PI3K/Akt signal transduction pathway during the process. Methods Exosomes were derived and purified from MDA-MB-231 by cryogenic ultracentrifugation and density gradient centrifugation. MTT assay was carried out for measurement of cell proliferation in HUVECs with exosome of 50, 100, 200 and 400μg/ml. The states of cell cycle of HUVECs co-cultured with 200μg/ml exosomes were detected by flow cytometry. The effects of 200μg/ml exosomes on the expression of ERK, Akt and phosphorylated ERK, Akt in HUVECs were detected with Western blotting. Results Exosomes derived from MDA-MB-231 significantly promoted HUVECs proliferation in a classical time-and dose-dependent manner. Flow cytometry revealed that, co-cultured with 200μg/ml exosomes for 24h, S-phase cells in HUVECs increased, while G1/S phase cells in HUVECs decreased. Western blotting showed that, cocultured with 200μg/ml exosomes for 24h, 48h and 72h, the expressions of phosphorylated ERK and Akt were up-regulated in a time-dependent manner. Conclusion Exosomes derived from breast cancer cell line MDA-MB-231 may promote HUVECs proliferation, the changes in cell cycle and the continuous activation of the MAPK/ERK and PI3K/Akt signal transduction pathways may be the underlying mechanism.
Directory of Open Access Journals (Sweden)
Lídia Maria Andrade
2005-10-01
Full Text Available Radiotherapy using gamma rays is a common modality of breast cancer treatment. The aim of this research is to investigate the biological response of the human breast cancer cell line MDAMB-231 and human peripheral blood mononuclear cells (PBMC exposed in vitro to 60 Co irradiation at a single fraction of 10 Gy, 25 Gy and 50 Gy doses at 136,4 cGy.min-1 rate. Cells were irradiated at room temperature by the Theratron 80 radiotherapy system. Biological response was evaluated through cellular viability using MTT assay and nucleus damages visualized by Propidium Iodide assay and electrophoresis agarose gel after gamma irradiation. Nucleus damages induced by 60Co irradiation were compared to damage caused by cell exposure to 10% methanol. The 50 Gy dose of irradiation did not stimulate nuclus damages at the same level as that affected by 10% methanol induction in the MDAMB-231. Further studies are necessary to understand these mechanisms in the MDAMB-231 human breast carcinoma cell line.Radioterapia utilizando radiação gama é uma modalidade comum no tratamento do câncer de mama. A proposta deste estudo é investigar a resposta biológica in vitro da linhagem celular MDAMB-231 de câncer de mama humano e células do sangue periférico humano (PBMC expostas à irradiação pelo Co60 em frações simples de 10Gy, 25Gy e 50Gy e 136,4cGy min-1 rate. As células foram irradiadas a temperatura ambiente usando o equipamento de radioterapia Theratron 80 radiotherapy system. A resposta biológica, após irradiação gama, foi avaliada através do ensaio do MTT para viabilidade celular e o do ensaio com Iodeto de Propídio para visualização do dano nuclear, além da eletroforese em gel de agarose. Os danos nucleares induzidos pelo Co60 foram comparados aos danos causados pela exposição das células à solução de metanol a 10%. Nós observamos que a dose de 50Gy não estimulou a mesma quantidade de danos nucleares que a solução de metanol a 10% nas c
Keitges, Elisabeth A; Pasion, Romela; Burnside, Rachel D; Mason, Carla; Gonzalez-Ruiz, Antonio; Dunn, Teresa; Masiello, Meredith; Gebbia, Joseph A; Fernandez, Carlos O; Risheg, Hiba
2013-07-01
Microdeletions of 8p23.1 are mediated by low copy repeats and can cause congenital diaphragmatic hernia (CDH) and cardiac defects. Within this region, point mutations of the GATA4 gene have been shown to cause cardiac defects. However, the cause of CDH in these deletions has been difficult to determine due to the paucity of mutations that result in CDH, the lack of smaller deletions to refine the region and the reduced penetrance of CDH in these large deletions. Mice deficient for one copy of the Gata4 gene have been described with CDH and heart defects suggesting mutations in Gata4 can cause the phenotype in mice. We report on the SNP microarray analysis on two fetuses with deletions of 8p23.1. The first had CDH and a ventricular septal defect (VSD) on ultrasonography and a family history of a maternal VSD. Microarray analysis detected a 127-kb deletion which included the GATA4 and NEIL2 genes which was inherited from the mother. The second fetus had an incomplete atrioventricular canal defect on ultrasonography. Microarray analysis showed a 315-kb deletion that included seven genes, GATA4, NEIL2, FDFT1, CTSB, DEFB136, DEFB135, and DEFB134. These results suggest that haploinsufficiency of the two genes in common within 8p23.1; GATA4 and NEIL2 can cause CDH and cardiac defects in humans. Copyright © 2013 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Andrade, Lidia Maria; Campos, Tarcisio Passos Ribeiro de [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear]. E-mail: lidia.andrade@unifenas.br; Leite, M.F. [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Fisiologia e Biofisica; Goes, A.M. [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Bioquimica e Imunologia
2005-10-15
Radiotherapy using gamma rays is a common modality of breast cancer treatment. The aim of this research is to investigate the biological response of the human breast cancer cell line MDAMB-231 and human peripheral blood mononuclear cells (PBMC) exposed in vitro to {sup 60} Co irradiation at a single fraction of 10 Gy, 25 Gy and 50 Gy doses at 136,4 cGy.min{sup -1} rate. Cells were irradiated at room temperature by the Theratron 80 radiotherapy system. Biological response was evaluated through cellular viability using MTT assay and nucleus damages visualized by Propidium Iodide assay and electrophoresis agarose gel after gamma irradiation. Nucleus damages induced by {sup 60} Co irradiation were compared to damage caused by cell exposure to 10% methanol. The 50 Gy dose of irradiation did not stimulate nucleus damages at the same level as that affected by 10% methanol induction in the MDAMB-231. Further studies are necessary to understand these mechanisms in the MDAMB-231 human breast carcinoma cell line.(author)
Russo-Abrahão, Thais; Lacerda-Abreu, Marco Antônio; Gomes, Tainá; Cosentino-Gomes, Daniela; Carvalho-de-Araújo, Ayra Diandra; Rodrigues, Mariana Figueiredo; Oliveira, Ana Carolina Leal de; Rumjanek, Franklin David; Monteiro, Robson de Queiroz; Meyer-Fernandes, José Roberto
2018-01-01
Recent studies demonstrate that interstitial inorganic phosphate is significantly elevated in the breast cancer microenvironment as compared to normal tissue. In addition it has been shown that breast cancer cells express high levels of the NaPi-IIb carrier (SLC34A2), suggesting that this carrier may play a role in breast cancer progression. However, the biochemical behavior of inorganic phosphate (Pi) transporter in this cancer type remains elusive. In this work, we characterize the kinetic parameters of Pi transport in the aggressive human breast cancer cell line, MDA-MB-231, and correlated Pi transport with cell migration and adhesion. We determined the influence of sodium concentration, pH, metabolic inhibitors, as well as the affinity for inorganic phosphate in Pi transport. We observed that the inorganic phosphate is dependent on sodium transport (K0,5 value = 21.98 mM for NaCl). Furthermore, the transport is modulated by different pH values and increasing concentrations of Pi, following the Michaelis-Menten kinetics (K0,5 = 0.08 mM Pi). PFA, monensin, furosemide and ouabain inhibited Pi transport, cell migration and adhesion. Taken together, these results showed that the uptake of Pi in MDA-MB-231 cells is modulated by sodium and by regulatory mechanisms of intracellular sodium gradient. General Significance: Pi transport might be regarded as a potential target for therapy against tumor progression.
International Nuclear Information System (INIS)
Rose, Peter; Huang, Qing; Ong, Choon Nam; Whiteman, Matt
2005-01-01
A high dietary intake of cruciferous vegetables has been associated with a reduction in numerous human pathologies particularly cancer. In the current study, we examined the inhibitory effects of broccoli (Brassica oleracea var. italica) and watercress (Rorripa nasturtium aquaticum) extracts on 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced cancer cell invasion and matrix metalloproteinase-9 activity using human MDA-MB-231 breast cancer cells. Aberrant overexpression of matrix metalloproteinases, including metalloproteinase-9, is associated with increased invasive potential in cancer cell lines. Our results demonstrate that extracts of broccoli and Rorripa suppressed TPA-induced MMP-9 activity and invasiveness in a concentration dependant manner as determined by zymographic analysis. Furthermore, fractionation of individual extracts followed by liquid chromatography mass spectroscopy analysis (LC-MS) revealed that the inhibitory effects of each vegetable were associated with the presence of 4-methysulfinylbutyl (sulforaphane) and 7-methylsulphinylheptyl isothiocyanates. Taken together, our data indicate that isothiocyanates derived form broccoli and Rorripa inhibit metalloproteinase 9 activities and also suppress the invasive potential of human MDA-MB-231 breast cancer cells in vitro. The inhibitory effects observed in the current study may contribute to the suppression of carcinogenesis by diets high in cruciferous vegetables
Luo, Jianming; Wei, Zheng; Zhang, Shengyu; Peng, Xichun; Huang, Yu; Zhang, Yali; Lu, Jiang
2017-05-01
Tons of grape pomace which still contained a rich amount of plant polyphenols, is discarded after winemaking. Plant polyphenols have multi-functional activities for human body. In this study, polyphenols of pomaces from Muscadinia rotundifolia "Noble" and Vitis vinifera "Cabernet Sauvignon" were extracted and fractionated, and then they were analyzed with LC-MS and the inhibitory effects on breast cancer cells were compared. The inhibition on MDA-MB-231 cells of fractions from "Noble" was further evaluated. The results showed that polyphenols from 2 grape pomaces could be separated into 3 fractions, and ellagic acid and/or ellagitannins were only detected in fractions from "Noble" pomace. All 3 fractions from "Noble" pomace inhibited MDA-MB-231 better than MCF-7. But fraction 2 from "Cabernet Sauvignon" inhibited MCF-7 better while fraction 1 and fraction 3 inhibited both 2 cells similarly. Moreover, the fractions from "Noble" pomace rather than "Cabernet Sauvignon" can inhibit MDA-MB-231 better. Finally, fractions from "Noble" pomace can induce S-phase arrest and apoptosis on MDA-MB-231. These findings suggested the extracts from grape pomace especially those from "Noble," are potential to be utilized as health beneficial products or even anti-breast cancer agents. © 2017 Institute of Food Technologists®.
Hooshmand, Somayeh; Ghaderi, Abbas; Yusoff, Khatijah; Thilakavathy, Karuppiah; Rosli, Rozita; Mojtahedi, Zahra
2014-01-01
The consequence of Rho GDP dissociation inhibitor alpha (RhoGDIα) activity on migration and invasion of estrogen receptor positive (ER+) and negative (ER-) breast cancer cells has not been studied using the proteomic approach. Changes in expression of RhoGDIα and other proteins interacting directly or indirectly with RhoGDIα in MCF7 and MDA-MB-231, with different metastatic potentials is of particular interest. ER+ MCF7 and ER- MDA-MB-231 cell lines were subjected to two-dimensional electrophoresis (2-DE) and spots of interest were identified by matrix-assisted laser desorption/ionization time of- flight/time- of-flight (MALDI-TOF/TOF) mass spectrometry (MS) analysis after downregulation of RhoGDIα using short interfering RNA (siRNA) and upregulated using GFP-tagged ORF clone of RhoGDIα. The results showed a total of 35 proteins that were either up- or down-regulated in these cells. Here we identifed 9 and 15 proteins differentially expressed with silencing of RhoGDIα in MCF-7 and the MDA-MB-231 cells, respectively. In addition, 10 proteins were differentially expressed in the upregulation of RhoGDIα in MCF7, while only one protein was identified in the upregulation of RhoGDIα in MDA-MB-231. Based on the biological functions of these proteins, the results revealed that proteins involved in cell migration are more strongly altered with RhoGDI-α activity. Although several of these proteins have been previously indicated in tumorigenesis and invasiveness of breast cancer cells, some ohave not been previously reported to be involved in breast cancer migration. Hence, these proteins may serve as useful candidate biomarkers for tumorigenesis and invasiveness of breast cancer cells. Future studies are needed to determine the mechanisms by which these proteins regulate cell migration. The combination of RhoGDIα with other potential biomarkers may be a more promising approach in the inhibition of breast cancer cell migration.
International Nuclear Information System (INIS)
Corbett, J.O.
1981-04-01
Recently published calculations have suggested that a hypothetical individual may receive an effective radiation dose equivalent of 23 mrem/y from coal-fired power station emissions through the ingestion of lead-210, polonium-210 and protactinium-231. It is shown that the model used in those calculations is over-pessimistic by one or two orders of magnitude when applied to the deposition of Pb-210 and Po-210 derived from the decay of radon naturally present in the atmosphere. A more recent assessment of metabolic data for Pa-231 suggests that estimated doses from this nuclide also can be reduced by about a factor of twenty. It is concluded that the maximum effective dose equivalent from power station emissions probably does not exceed 1-2 mrem/y. (author)
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Box and other house cars without roof hatches or... SAFETY APPLIANCE STANDARDS § 231.27 Box and other house cars without roof hatches or placed in service...) Number. (i) Each box or other house car without roof hatches shall be equipped with an efficient vertical...
Uranium age determination - Separation and analysis of 230Th and 231Pa
International Nuclear Information System (INIS)
Morgenstern, A.; Apostolidis, C.; Mayer, K.; Wallenius, M.
2002-01-01
Full text: In recent years several incidents involving illicit trafficking and smuggling of nuclear material, radioactive sources and radioactively contaminated materials have raised growing public concern about criminal acts involving nuclear materials. Consequently, research efforts in nuclear forensic science have been intensified in order to develop and improve methods for the identification of the nature and origin of seized materials. Information obtained from the analysis of unknown nuclear materials is of key importance in order to aide authorities that are in charge of developing fast and appropriate response action. For the identification of nuclear materials various sample characteristics are of relevance, including isotopic composition, the content of chemical impurities, material properties and the date of production. Information on the production date, respectively the 'age' of nuclear materials, will also be of key importance in other fields of nuclear science, i.e. for the verification of a Fissile Materials Cut-Off Treaty (FMCT) in order to distinguish freshly produced materials from 'old' excess weapons materials. The age of nuclear materials may also be of relevance under a strengthened safeguards regime to reveal clandestine production of weapons usable materials, i.e. the separation of plutonium or production of highly enriched uranium (HEU). The age dating of plutonium samples has been described in detail for bulk samples as well as for particles. In this work we focused on the age determination of uranium materials of different uranium enrichment. The radioactive decay of the uranium isotopes provides a chronometer that is inherent to the material, in particular the mother/daughter pairs 234 U/ 230 Th and 235 U/ 231 Pa can be advantageously used. Due to the relatively long half-lives of 234 U (2.46·10 5 years) and 235 U (7.04·10 8 years) only minute amounts of daughter nuclides are growing in, therefore both separation of Th and Pa from
International Nuclear Information System (INIS)
Kotthaus, Tanja
2010-01-01
In this thesis five heavy deformed isotopes from the mass region A≥230, namely 234 U, 233 U, 231 Th, 230 Pa and 232 Pa, were investigated by means of deuteron-induced neutron transfer reactions. The even-even isotope 234 U has been studied with the 4π-γ-spectrometer MINIBALL at the Cologne Tandem accelerator. Excited nuclei in the isotope 234 U were produced using the reaction 235 U(d,t) at a beam energy of 11 MeV. The target thickness was 3.5 mg/cm 2 . The analysis of the γγ-coincidence data yielded a reinterpretation of the level scheme in 12 cases. Considering its decay characteristics, the 4 + state at an excitation energy of 1886.7 keV is a potential candidate for a two-phonon vibrational state. The isotopes 233 U, 231 Th, 230 Pa and 232 Pa were investigated at the Munich Q3D spectrometer. For each isotope an angular distribution with angles between 5 and 45 were measured. In all four cases the energy of the polarized deuteron beam (vector polarization of 80%) was 22 MeV. As targets 234 U (160 μg/cm 2 ), 230 Th (140 μg/cm 2 ) and 231 Pa (140 μg/cm 2 ) were used. The experimental angular distributions were compared to results of DWBA calculations. For the odd isotope 233 U spin and parity for 33 states are assigned and in the other odd isotope 231 Th 22 assignments are made. The excitation spectra of the two odd-odd isotopes 230 Pa and 232 Pa were investigated for the first time. For the isotope 230 Pa 63 states below an excitation energy of 1.5 MeV are identified. Based on the new experimental data the Nilsson configuration of the ground state is either 1/2[530] p -5/2[633] n or 1/2[530] p +3/2[631] n . In addition 12 rotational bands are proposed and from this six values for the GM splitting energy are deduced as well as two new values for the Newby shift. In the other odd-odd isotope 232 Pa 40 states below an excitation energy of 850 keV are observed and suggestions for the groundstate band and its GM partner are made. From this one GM splitting
Directory of Open Access Journals (Sweden)
Gökhan Okan
2015-01-01
Full Text Available Background: The etiopathogenesis of psoriasis has not been clearly elucidated although the role of chronic inflammation, imbalance between pro- and anti-inflammatory cytokines, and many immunological events have been established. Endothelin 1 (EDN1 and endothelin receptor type-A (EDNRA are implicated in the inflammatory process. The relationships between EDN1 and EDNRA polymorphisms with several diseases have been found. Aims and Objectives: This study examined the possible association of EDN1 (G5665T and T-1370G and EDNRA (G-231A and G + 70C single nucleotide polymorphisms (SNPs with the occurence of psoriasis, and evaluated the relationship between genotypes and clinical/laboratory manifestation of psoriasis. Materials and Methods: We analyzed genotype and allele distributions of the above-mentioned polymorphisms in 151 patients with psoriasis and 152 healthy controls by real-time PCR combined with melting curve analysis. Results: We did not find significant differences in the genotype and allele distributions of EDN1 T-1370G, EDNRA G-231A, and EDNRA G+70C polymorphisms between patients with psoriasis and healthy controls. Psoriasis area and severity index (PASI score of EDNRA -231 polymorphic A allele carrying subjects (AA and AA + AG was higher than that of wild homozygotes (P = 0.044 and P = 0.027, respectively. In addition, EDN1 levels in EDNRA+70 polymorphic C allele carriers (CC + CG were elevated when compared with GG genotype; however, the difference was at borderline significance (P = 0.05. Conclusion: Although there were no associations between studied polymorphisms and psoriasis susceptibility, the PASI score and EDN1 levels seem to be affected by EDNRA G-231A and G + 70C polymorphisms.
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
Energy Technology Data Exchange (ETDEWEB)
Pham, Anh; Bortolazzo, Anthony [Department of Biological Sciences, San Jose State University, San Jose, CA 95192-0100 (United States); White, J. Brandon, E-mail: Brandon.White@sjsu.edu [Department of Biological Sciences, San Jose State University, San Jose, CA 95192-0100 (United States)
2012-10-19
Highlights: Black-Right-Pointing-Pointer Quercetin cannot be detected intracellularly despite killing MDA-MB-231 cells. Black-Right-Pointing-Pointer Quercetin forms a heterodimer through oxidation in media with serum. Black-Right-Pointing-Pointer The quercetin heterodimer does not kill MDA-MB-231 cells. Black-Right-Pointing-Pointer Ascorbic acid stabilizes quercetin increasing cell death in quercetin treated cells. Black-Right-Pointing-Pointer Quercetin, and not a modified form, is responsible for apoptosis and cell death. -- Abstract: Quercetin is a member of the flavonoid family and has been previously shown to have a variety of anti-cancer activities. We and others have reported anti-proliferation, cell cycle arrest, and induction of apoptosis of cancer cells after treatment with quercetin. Quercetin has also been shown to undergo oxidation. However, it is unclear if quercetin or one of its oxidized forms is responsible for cell death. Here we report that quercetin rapidly oxidized in cell culture media to form a dimer. The quercetin dimer is identical to a dimer that is naturally produced by onions. The quercetin dimer and quercetin-3-O-glucopyranoside are unable to cross the cell membrane and do not kill MDA-MB-231 cells. Finally, supplementing the media with ascorbic acid increases quercetin's ability to induce cell death probably by reduction oxidative dimerization. Our results suggest that an unmodified quercetin is the compound that elicits cell death.
International Nuclear Information System (INIS)
Pham, Anh; Bortolazzo, Anthony; White, J. Brandon
2012-01-01
Highlights: ► Quercetin cannot be detected intracellularly despite killing MDA-MB-231 cells. ► Quercetin forms a heterodimer through oxidation in media with serum. ► The quercetin heterodimer does not kill MDA-MB-231 cells. ► Ascorbic acid stabilizes quercetin increasing cell death in quercetin treated cells. ► Quercetin, and not a modified form, is responsible for apoptosis and cell death. -- Abstract: Quercetin is a member of the flavonoid family and has been previously shown to have a variety of anti-cancer activities. We and others have reported anti-proliferation, cell cycle arrest, and induction of apoptosis of cancer cells after treatment with quercetin. Quercetin has also been shown to undergo oxidation. However, it is unclear if quercetin or one of its oxidized forms is responsible for cell death. Here we report that quercetin rapidly oxidized in cell culture media to form a dimer. The quercetin dimer is identical to a dimer that is naturally produced by onions. The quercetin dimer and quercetin-3-O-glucopyranoside are unable to cross the cell membrane and do not kill MDA-MB-231 cells. Finally, supplementing the media with ascorbic acid increases quercetin’s ability to induce cell death probably by reduction oxidative dimerization. Our results suggest that an unmodified quercetin is the compound that elicits cell death.
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Taherian, Aliakbar; Mazoochi, Tahereh
2012-01-01
Curative treatment of breast cancer patients using chemotherapy often fails as a result of intrinsic or acquired resistance of the tumor to the drug. ERK is one of the main components of the Ras/Raf/MEK/ERK cascade, which mediates signal from cell surface receptors to transcription factors to regulate different gene expression. In this study, cytotoxicity and the expression of Erk1/2 and phospho-ERK was compared in MDA-MB-231 (ER-) and MCF-7 (ER+) cell lines after treatment with doxorubicin (DOX) or docetaxel (DOCT). Cell cytotoxicity of DOX or DOCT was calculated using MTT assay. Immonofluorescent technique was used to show MDR-1 protein in MDA-MB-231 and MCF-7 cells after treatment with DOX or DOCT. The expression of ERK1/2 and phpspho-ERK was assayed with immunoblotting. Comparing IC50 values showed that MDA-MB-231 cells are more sensitive than MCF-7 cells to DOX or DOCT. Immonofluorescent results confirmed the expression of MDR-1 in these two cell lines after DOX or DOCT treatment. In MDA-MB-231 cells the expression of ERK1/2 and phospho-ERK was decreased after DOX treatment in a dose-dependent manner. In contrast in MCF-7 cells the expression of ERK1/2 and phospho-ERK was increased after DOX treatment. DOCT treatment demonstrated the same result with less significant differences than DOX. The heterogeneity seen in cell lines actually reflects the heterogeneity of breast cancers. That is why, patients categorized in one group respond differently to a single treatment. These results emphasize the importance of a more accurate classification and a more specific treatment of breast cancer subtypes.
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Box and other house cars with roof hatches built... RAILROAD SAFETY APPLIANCE STANDARDS § 231.28 Box and other house cars with roof hatches built or placed in... other house cars with roof hatches. Box and other house cars with roof hatches built on or before April...
Energy Technology Data Exchange (ETDEWEB)
Gkretsi, Vasiliki; Stylianou, Andreas; Stylianopoulos, Triantafyllos, E-mail: tstylian@ucy.ac.cy
2017-03-15
A hallmark of cancer cells is their ability to invade surrounding tissues and form metastases. Cell-extracellular matrix (ECM)-adhesion proteins are crucial in metastasis, connecting tumor ECM with actin cytoskeleton thus enabling cells to respond to mechanical cues. Vasodilator-stimulated phosphoprotein (VASP) is an actin-polymerization regulator which interacts with cell-ECM adhesion protein Migfilin, and regulates cell migration. We compared VASP expression in MCF-7 and MDA-MB-231 breast cancer (BC) cells and found that more invasive MDA-MB-231 cells overexpress VASP. We then utilized a 3-dimensional (3D) approach to study metastasis in MDA-MB-231 cells using a system that considers mechanical forces exerted by the ECM. We prepared 3D collagen I gels of increasing concentration, imaged them by atomic force microscopy, and used them to either embed cells or tumor spheroids, in the presence or absence of VASP. We show, for the first time, that VASP silencing downregulated Migfilin, β-catenin and urokinase plasminogen activator both in 2D and 3D, suggesting a matrix-independent mechanism. Tumor spheroids lacking VASP demonstrated impaired invasion, indicating VASP’s involvement in metastasis, which was corroborated by Kaplan-Meier plotter showing high VASP expression to be associated with poor remission-free survival in lymph node-positive BC patients. Hence, VASP may be a novel BC metastasis biomarker. - Highlights: • More invasive MDA-MB-231 overexpress VASP compared to MCF-7 breast cancer cells. • We prepared 3D collagen I gels of increasing concentration and characterized them. • VASP silencing downregulated Migfilin, β-catenin and uPA both in 2D and 3D culture. • Tumor spheroids lacking VASP demonstrated impaired invasion. • Kaplan-Meier plotter shows association of high VASP expression with poor survival.
Lenci, Elena; Innocenti, Riccardo; Biagioni, Alessio; Menchi, Gloria; Bianchini, Francesca; Trabocchi, Andrea
2016-10-20
The application of a cell-based growth inhibition on a library of skeletally different glycomimetics allowed for the selection of a hexahydro-2 H -furo[3,2- b ][1,4]oxazine compound as candidate inhibitors of MDA-MB-231 cell growth. Subsequent synthesis of analogue compounds and preliminary biological studies validated the selection of a valuable hit compound with a novel polyhydroxylated structure for the modulation of the breast carcinoma cell cycle mechanism.
Czech Academy of Sciences Publication Activity Database
Morgenstern, A.; Lebeda, Ondřej; Štursa, Jan; Capote, R.; Sin, M.; Bruchertseifer, F.; Zielinska, B.; Apostolidis, C.
2009-01-01
Roč. 80, č. 5 (2009), 054612/1-054612/6 ISSN 0556-2813 Institutional research plan: CEZ:AV0Z10480505 Keywords : Pa-231 * U-230 * Th-226 * reaction cross section * targeted alpha therapy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.477, year: 2009
49 CFR 231.24 - Box and other house cars with roofs, 16 feet 10 inches or more above top of rail. 1
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Box and other house cars with roofs, 16 feet 10... APPLIANCE STANDARDS § 231.24 Box and other house cars with roofs, 16 feet 10 inches or more above top of.... Same as specified for “Box and Other House Cars.” (2) Dimensions. Same as specified for “Box and Other...
40 CFR 264.231 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.
2010-07-01
... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Surface Impoundments § 264.231 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22... surface impoundments managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order to reduce...
Lou, Chenghua; Zhu, Zhihui; Zhao, Yaping; Zhu, Rui; Zhao, Huajun
2017-01-01
Arctigenin is a bioactive lignan isolated from the seeds of Arctium lappa L. which has been widely used as a diuretic and a diaphoretic in Traditional Chinese Medicine. In the present study, the authors investigated the effects of arctigenin on tumor migration and invasion in aggressive human breast cancer cells. The MTT assay results showed that arctigenin did not show a significant cytotoxic effect on the cell viability of MDA-MB-231 cells. However, wound healing migration and Boyden chamber invasion assays demonstrated that arctigenin significantly inhibited in vitro migration and invasion of the MDA-MB-231 cells. Furthermore, gelatin zymography results showed that arctigenin reduced the activity of MMP-2 and MMP-9. Western blot analysis results demonstrated that the expression of MMP-2, MMP-9 and heparanase proteins was significantly downregulated following the treatment of arctigenin. Finally, the antiangiogenic activity of arctigenin was also examined by the chick embryo chorioallantoic membrane (CAM) assay. Arctigenin treatment significantly inhibited angiogenesis in the CAM. In conclusion, the results revealed that arctigenin significantly inhibited the migration and invasion of MDA-MB-231 cells by downregulating MMP-2, MMP-9 and heparanase expression. However, further studies are still necessary to investigate the exact mechanisms involved and to explore signal transduction pathways to better understand the biological mechanisms.
High resolution measurement of the 231Pa(n,f) cross section from 0.4 eV to 12 MeV
International Nuclear Information System (INIS)
Plattard, S.; Auchampaugh, G.F.; de Saussure, G.
1980-01-01
The 231 Pa(n,f) reaction was studied to shed light on the existence of a shallow third minimum in the 232 Pa fission barrier. Results are plotted along with data points derived from ENDF/B-V. The occurrence of a pure vibrational state at E/sub n/ = 156.7 keV (3 + ) together with a nearby state of opposite parity favors the evidence for a third asymmetrically deformed minimum in the 232 Pa fission barrier. 2 figures
Directory of Open Access Journals (Sweden)
Elena Lenci
2016-10-01
Full Text Available The application of a cell-based growth inhibition on a library of skeletally different glycomimetics allowed for the selection of a hexahydro-2H-furo[3,2-b][1,4]oxazine compound as candidate inhibitors of MDA-MB-231 cell growth. Subsequent synthesis of analogue compounds and preliminary biological studies validated the selection of a valuable hit compound with a novel polyhydroxylated structure for the modulation of the breast carcinoma cell cycle mechanism.
International Nuclear Information System (INIS)
Uma Suganya, K.S.; Govindaraju, K.; Ganesh Kumar, V.; Prabhu, D.; Arulvasu, C.; Stalin Dhas, T.; Karthick, V.; Changmai, Niranjan
2016-01-01
Highlights: • Biosynthesis of stable and well dispersed predominantly spherical gold nanoparticles of size around ∼12.5 nm. • Anticancer assessment of gold nanoparticles on MDA-MB-231 and MCF-7 cell lines. • AuNPs were found non toxic to normal HMEC cells. • Flow cytometry results revealed significant arrest in cell proliferation in early G0/G1 to S phase. - Abstract: Breast cancer is a major complication in women and numerous approaches are being developed to overcome this problem. In conventional treatments such as chemotherapy and radiotherapy the post side effects cause an unsuitable effect in treatment of cancer. Hence, it is essential to develop a novel strategy for the treatment of this disease. In the present investigation, a possible route for green synthesis of gold nanoparticles (AuNPs) using leaf extract of Mimosa pudica and its anticancer efficacy in the treatment of breast cancer cell lines is studied. The synthesized nanoparticles were found to be effective in killing cancer cells (MDA-MB-231 & MCF-7) which were studied using various anticancer assays (MTT assay, cell morphology determination, cell cycle analysis, comet assay, Annexin V-FITC/PI staining and DAPI staining). Cell morphological analysis showed the changes occurred in cancer cells during the treatment with AuNPs. Cell cycle analysis revealed apoptosis in G_0/G_1 to S phase. Similarly in Comet assay, there was an increase in tail length in treated cells in comparison with the control. Annexin V-FITC/PI staining assay showed prompt fluorescence in treated cells indicating the translocation of phosphatidylserine from the inner membrane. PI and DAPI staining showed the DNA damage in treated cells.
Energy Technology Data Exchange (ETDEWEB)
Uma Suganya, K.S. [Centre for Ocean Research, Sathyabama University, Chennai 600119 (India); Govindaraju, K., E-mail: govindtu@gmail.com [Centre for Ocean Research, Sathyabama University, Chennai 600119 (India); Ganesh Kumar, V. [Centre for Ocean Research, Sathyabama University, Chennai 600119 (India); Prabhu, D.; Arulvasu, C. [Department of Zoology, University of Madras, Guindy campus, Chennai 600 025 (India); Stalin Dhas, T.; Karthick, V.; Changmai, Niranjan [Centre for Ocean Research, Sathyabama University, Chennai 600119 (India)
2016-05-15
Highlights: • Biosynthesis of stable and well dispersed predominantly spherical gold nanoparticles of size around ∼12.5 nm. • Anticancer assessment of gold nanoparticles on MDA-MB-231 and MCF-7 cell lines. • AuNPs were found non toxic to normal HMEC cells. • Flow cytometry results revealed significant arrest in cell proliferation in early G0/G1 to S phase. - Abstract: Breast cancer is a major complication in women and numerous approaches are being developed to overcome this problem. In conventional treatments such as chemotherapy and radiotherapy the post side effects cause an unsuitable effect in treatment of cancer. Hence, it is essential to develop a novel strategy for the treatment of this disease. In the present investigation, a possible route for green synthesis of gold nanoparticles (AuNPs) using leaf extract of Mimosa pudica and its anticancer efficacy in the treatment of breast cancer cell lines is studied. The synthesized nanoparticles were found to be effective in killing cancer cells (MDA-MB-231 & MCF-7) which were studied using various anticancer assays (MTT assay, cell morphology determination, cell cycle analysis, comet assay, Annexin V-FITC/PI staining and DAPI staining). Cell morphological analysis showed the changes occurred in cancer cells during the treatment with AuNPs. Cell cycle analysis revealed apoptosis in G{sub 0}/G{sub 1} to S phase. Similarly in Comet assay, there was an increase in tail length in treated cells in comparison with the control. Annexin V-FITC/PI staining assay showed prompt fluorescence in treated cells indicating the translocation of phosphatidylserine from the inner membrane. PI and DAPI staining showed the DNA damage in treated cells.
Tank 241-TX-104, cores 230 and 231 analytical results for the final report
International Nuclear Information System (INIS)
Diaz, L.A.
1998-01-01
This document is the analytical laboratory report for tank 241-TX-104 push mode core segments collected between February 18, 1998 and February 23, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-104 Push Mode Core Sampling and Analysis Plan (TSAP) (McCain, 1997), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995) and the Safety Screening Data Quality Objective (DQO) (Dukelow, et.al., 1995). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report. Appearance and Sample Handling Attachment 1 is a cross reference to relate the tank farm identification numbers to the 222-S Laboratory LabCore/LIMS sample numbers. The subsamples generated in the laboratory for analyses are identified in these diagrams with their sources shown. Core 230: Three push mode core segments were removed from tank 241-TX-104 riser 9A on February 18, 1998. Segments were received by the 222-S Laboratory on February 19, 1998. Two segments were expected for this core. However, due to poor sample recovery, an additional segment was taken and identified as 2A. Core 231: Four push mode core segments were removed from tank 241-TX-104 riser 13A between February 19, 1998 and February 23, 1998. Segments were received by the 222-S Laboratory on February 24, 1998. Two segments were expected for this core. However, due to poor sample recovery, additional segments were taken and identified as 2A and 2B. The TSAP states the core samples should be transported to the laboratory within three
Lee, Ming-Fen; Pan, Min-Hsiung; Chiou, Yi-Siou; Cheng, An-Chin; Huang, Han
2011-11-09
Resveratrol and pterostilbene exhibit diverse biological activities. MED28, a subunit of the mammalian Mediator complex for transcription, was also identified as magicin, an actin cytoskeleton Grb2-associated protein, and as endothelial-derived gene (EG-1). Several tumors exhibit aberrant MED28 expression, whereas the underlying mechanism is unclear. Triple-negative breast cancers, often expressing epidermal growth factor (EGF) receptor (EGFR), are associated with metastasis and poor survival. The objective of this study is to compare the effect of resveratrol and pterostilbene and to investigate the role of MED28 in EGFR-overexpressing MDA-MB-231 breast cancer cells. Pretreatment of resveratrol, but not pterostlbene, suppressed EGF-mediated migration and expression of MED28 and matrix metalloproteinase (MMP)-9 in MDA-MB-231 cells. Moreover, overexpression of MED28 increased migration, and the addition of EGF further enhanced migration. Our data indicate that resveratrol modulates the effect of MED28 on cellular migration, presumably through the EGFR/phosphatidylinositol 3-kinase (PI3K) signaling pathway, in breast cancer cells.
DEFF Research Database (Denmark)
Hjortoe, Gertrud M; Petersen, Lars C; Albrektsen, Tatjana
2004-01-01
Tissue factor (TF), the cellular receptor for factor VIIa (FVIIa), besides initiating blood coagulation, is believed to play an important role in tissue repair, inflammation, angiogenesis, and tumor metastasis. Like TF, the chemokine interleukin-8 (IL-8) is shown to play a critical role...... in these processes. To elucidate the potential mechanisms by which TF contributes to tumor invasion and metastasis, we investigated the effect of FVIIa on IL-8 expression and cell migration in a breast carcinoma cell line, MDA-MB-231, a cell line that constitutively expresses abundant TF. Expression of IL-8 m......RNA in MDA-MB-231 cells was markedly up-regulated by plasma concentrations of FVII or an equivalent concentration of FVIIa (10 nM). Neither thrombin nor other proteases involved in hemostasis were effective in stimulating IL-8 in these cells. Increased transcriptional activation of the IL-8 gene...
Ghafari, Fereshteh; Rajabi, Mohammad Reza; Mazoochi, Tahereh; Taghizadeh, Mohsen; Nikzad, Hossein; Atlasi, Mohammad Ali; Taherian, Aliakbar
2017-01-01
Objective: Breast cancer is a heterogeneous disease and very common malignancy in women worldwide. The efficacy of chemotherapy as an important part of breast cancer treatment is limited due to its side effects. While pharmaceutical companies are looking for better chemicals, research on traditional medicines that generally have fewer side effects is quite interesting. In this study, apoptosis and necrosis effect of Arctium lappa and doxorubicin was compared in MCF7, and MDA-MB-231 cell lines...
International Nuclear Information System (INIS)
Siegrist, R.L.; Slack, W.W.; Houk, T.C.
1998-03-01
The overall goal of the program of activities is to demonstrate robust and cost-effective technologies for in situ remediation of DNAPL compounds in low permeability media (LPM), including adaptations and enhancements of conventional technologies to achieve improved performance for DNAPLs in LPM. The technologies sought should be potential for application at simple, small sites (e.g., gasoline underground storage tanks) as well as at complex, larger sites (e.g., DOE land treatment units). The technologies involved in the X-231A demonstration at Portsmouth Gaseous Diffusion Plant (PORTS) utilized subsurface manipulation of the LPM through soil fracturing with thermally enhanced mass recovery or horizontal barrier in place destruction. To enable field evaluation of these approaches, a set of four test cells was established at the X-231A land treatment unit at the DOE PORTS plant in August 1996 and a series of demonstration field activities occurred through December 1997. The principal objectives of the PORTS X-231A demonstration were to: determine and compare the operational features of hydraulic fractures as an enabling technology for steam and hot air enhanced soil vapor extraction and mass recovery, in situ interception and reductive destruction by zero valent iron, and in situ interception and oxidative destruction by potassium permanganate; determine the interaction of the delivered agents with the LPM matrix adjacent to the fracture and within the fractured zone and assess the beneficial modifications to the transport and/or reaction properties of the LPM deposit; and determine the remediation efficiency achieved by each of the technology strategies
Czech Academy of Sciences Publication Activity Database
Flodrová, Dana; Toporová, L.; Laštovičková, Markéta; Macejová, D.; Hunaková, L.; Brtko, J.; Bobálová, Janette
2017-01-01
Roč. 281, NOV (2017), s. 26-34 ISSN 0378-4274 R&D Projects: GA ČR(CZ) GA15-15479S Grant - others:AV ČR(CZ) SAV-15-01 Program:Bilaterální spolupráce Institutional support: RVO:68081715 Keywords : breast cancer * MDA-MB-231 * biomarker * retinoids Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.858, year: 2016
Optimized Method for Untargeted Metabolomics Analysis of MDA-MB-231 Breast Cancer Cells
Directory of Open Access Journals (Sweden)
Amanda L. Peterson
2016-09-01
Full Text Available Cancer cells often have dysregulated metabolism, which is largely characterized by the Warburg effect—an increase in glycolytic activity at the expense of oxidative phosphorylation—and increased glutamine utilization. Modern metabolomics tools offer an efficient means to investigate metabolism in cancer cells. Currently, a number of protocols have been described for harvesting adherent cells for metabolomics analysis, but the techniques vary greatly and they lack specificity to particular cancer cell lines with diverse metabolic and structural features. Here we present an optimized method for untargeted metabolomics characterization of MDA-MB-231 triple negative breast cancer cells, which are commonly used to study metastatic breast cancer. We found that an approach that extracted all metabolites in a single step within the culture dish optimally detected both polar and non-polar metabolite classes with higher relative abundance than methods that involved removal of cells from the dish. We show that this method is highly suited to diverse applications, including the characterization of central metabolic flux by stable isotope labelling and differential analysis of cells subjected to specific pharmacological interventions.
Takeda, Shuso; Matsuo, Kazumasa; Yaji, Kentaro; Okajima-Miyazaki, Shunsuke; Harada, Mari; Miyoshi, Hiroko; Okamoto, Yoshiko; Amamoto, Toshiaki; Shindo, Mitsuru; Omiecinski, Curtis J.; Aramaki, Hironori
2014-01-01
exo-Methylene lactone group-containing compounds, such as (−)-xanthatin, are present in a large variety of biologically active natural products, including extracts of Xanthium strumarium (Cocklebur). These substances are reported to possess diverse functional activities, exhibiting anti-inflammatory, antimalarial, and anticancer potential. In this study, we synthesized six structurally related xanthanolides containing exo-methylene lactone moieties, including (−)-xanthatin and (+)-8-epi-xanthatin, and examined the effects of these chemically defined substances on the highly aggressive and farnesyltransferase inhibitor (FTI)-resistant MDA-MB-231 cancer cell line. The results obtained demonstrate that (−)-xanthatin was a highly effective inhibitor of MDA-MB-231 cell growth, inducing caspase-independent cell death, and that these effects were independent of FTase inhibition. Further, our results show that among the GADD45 isoforms, GADD45γ was selectively induced by (−)-xanthatin and that GADD45γ-primed JNK and p38 signaling pathways are, at least in part, involved in mediating the growth inhibition and potential anticancer activities of this agent. Given that GADD45γ is becoming increasingly recognized for its tumor suppressor function, the results presented here suggest the novel possibility that (−)-xanthatin may have therapeutic value as a selective inducer of GADD45γ in human cancer cells, in particular in FTI-resistant aggressive breast cancers. PMID:21568272
Non-Muscle Myosin II Isoforms Have Different Functions in Matrix Rearrangement by MDA-MB-231 Cells.
Directory of Open Access Journals (Sweden)
Bridget Hindman
Full Text Available The role of a stiffening extra-cellular matrix (ECM in cancer progression is documented but poorly understood. Here we use a conditioning protocol to test the role of nonmuscle myosin II isoforms in cell mediated ECM arrangement using collagen constructs seeded with breast cancer cells expressing shRNA targeted to either the IIA or IIB heavy chain isoform. While there are several methods available to measure changes in the biophysical characteristics of the ECM, we wanted to use a method which allows for the measurement of global stiffness changes as well as a dynamic response from the sample over time. The conditioning protocol used allows the direct measurement of ECM stiffness. Using various treatments, it is possible to determine the contribution of various construct and cellular components to the overall construct stiffness. Using this assay, we show that both the IIA and IIB isoforms are necessary for efficient matrix remodeling by MDA-MB-231 breast cancer cells, as loss of either isoform changes the stiffness of the collagen constructs as measured using our conditioning protocol. Constructs containing only collagen had an elastic modulus of 0.40 Pascals (Pa, parental MDA-MB-231 constructs had an elastic modulus of 9.22 Pa, while IIA and IIB KD constructs had moduli of 3.42 and 7.20 Pa, respectively. We also calculated the cell and matrix contributions to the overall sample elastic modulus. Loss of either myosin isoform resulted in decreased cell stiffness, as well as a decrease in the stiffness of the cell-altered collagen matrices. While the total construct modulus for the IIB KD cells was lower than that of the parental cells, the IIB KD cell-altered matrices actually had a higher elastic modulus than the parental cell-altered matrices (4.73 versus 4.38 Pa. These results indicate that the IIA and IIB heavy chains play distinct and non-redundant roles in matrix remodeling.
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Bergasa-Caceres, Fernando; Rabitz, Herschel A.
2013-06-01
A model of protein folding kinetics is applied to study the effects of macromolecular crowding on protein folding rate and stability. Macromolecular crowding is found to promote a decrease of the entropic cost of folding of proteins that produces an increase of both the stability and the folding rate. The acceleration of the folding rate due to macromolecular crowding is shown to be a topology-dependent effect. The model is applied to the folding dynamics of the murine prion protein (121-231). The differential effect of macromolecular crowding as a function of protein topology suffices to make non-native configurations relatively more accessible.
International Nuclear Information System (INIS)
Gates, D.D.; Siegrist, R.L.
1993-09-01
Treatability studies were conducted as part of a comprehensive research project initiated to demonstrate as well as evaluate in situ treatment technologies for volatile organic compounds (VOCs) and radioactive substances in wet, slowly permeable soils. The site of interest for this project was the X-231B Oil Biodegradation unit at the Portsmouth Gaseous Diffusion Plant, a US Department of Energy (DOE) facility in southern Ohio. This report describes the treatability studies that investigated the feasibility of the application of low-strength hydrogen peroxide (H 2 O 2 ) solutions to treat trichloroethylene (TCE)-contaminated soil
Baptista, Rodrigo P; Reis-Cunha, Joao Luis; DeBarry, Jeremy D; Chiari, Egler; Kissinger, Jessica C; Bartholomeu, Daniella C; Macedo, Andrea M
2018-02-14
Next-generation sequencing (NGS) methods are low-cost high-throughput technologies that produce thousands to millions of sequence reads. Despite the high number of raw sequence reads, their short length, relative to Sanger, PacBio or Nanopore reads, complicates the assembly of genomic repeats. Many genome tools are available, but the assembly of highly repetitive genome sequences using only NGS short reads remains challenging. Genome assembly of organisms responsible for important neglected diseases such as Trypanosoma cruzi, the aetiological agent of Chagas disease, is known to be challenging because of their repetitive nature. Only three of six recognized discrete typing units (DTUs) of the parasite have their draft genomes published and therefore genome evolution analyses in the taxon are limited. In this study, we developed a computational workflow to assemble highly repetitive genomes via a combination of de novo and reference-based assembly strategies to better overcome the intrinsic limitations of each, based on Illumina reads. The highly repetitive genome of the human-infecting parasite T. cruzi 231 strain was used as a test subject. The combined-assembly approach shown in this study benefits from the reference-based assembly ability to resolve highly repetitive sequences and from the de novo capacity to assemble genome-specific regions, improving the quality of the assembly. The acceptable confidence obtained by analyzing our results showed that our combined approach is an attractive option to assemble highly repetitive genomes with NGS short reads. Phylogenomic analysis including the 231 strain, the first representative of DTU III whose genome was sequenced, was also performed and provides new insights into T. cruzi genome evolution.
International Nuclear Information System (INIS)
Takeda, Shuso; Ikeda, Eriko; Su, Shengzhong; Harada, Mari; Okazaki, Hiroyuki; Yoshioka, Yasushi; Nishimura, Hajime; Ishii, Hiroyuki; Kakizoe, Kazuhiro; Taniguchi, Aya; Tokuyasu, Miki; Himeno, Taichi; Watanabe, Kazuhito; Omiecinski, Curtis J.; Aramaki, Hironori
2014-01-01
We recently reported that Δ 9 -tetrahydrocannabinol (Δ 9 -THC), a major cannabinoid component in Cannabis Sativa (marijuana), significantly stimulated the expression of fatty acid 2-hydroxylase (FA2H) in human breast cancer MDA-MB-231 cells. Peroxisome proliferator-activated receptor α (PPARα) was previously implicated in this induction. However, the mechanisms mediating this induction have not been elucidated in detail. We performed a DNA microarray analysis of Δ 9 -THC-treated samples and showed the selective up-regulation of the PPARα isoform coupled with the induction of FA2H over the other isoforms (β and γ). Δ 9 -THC itself had no binding/activation potential to/on PPARα, and palmitic acid (PA), a PPARα ligand, exhibited no stimulatory effects on FA2H in MDA-MB-231 cells; thus, we hypothesized that the levels of PPARα induced were involved in the Δ 9 -THC-mediated increase in FA2H. In support of this hypothesis, we herein demonstrated that; (i) Δ 9 -THC activated the basal transcriptional activity of PPARα in a concentration-dependent manner, (ii) the concomitant up-regulation of PPARα/FA2H was caused by Δ 9 -THC, (iii) PA could activate PPARα after the PPARα expression plasmid was introduced, and (iv) the Δ 9 -THC-induced up-regulation of FA2H was further stimulated by the co-treatment with L-663,536 (a known PPARα inducer). Taken together, these results support the concept that the induced levels of PPARα may be involved in the Δ 9 -THC up-regulation of FA2H in MDA-MB-231 cells
Takeda, Shuso; Ikeda, Eriko; Su, Shengzhong; Harada, Mari; Okazaki, Hiroyuki; Yoshioka, Yasushi; Nishimura, Hajime; Ishii, Hiroyuki; Kakizoe, Kazuhiro; Taniguchi, Aya; Tokuyasu, Miki; Himeno, Taichi; Watanabe, Kazuhito; Omiecinski, Curtis J; Aramaki, Hironori
2014-12-04
We recently reported that Δ(9)-tetrahydrocannabinol (Δ(9)-THC), a major cannabinoid component in Cannabis Sativa (marijuana), significantly stimulated the expression of fatty acid 2-hydroxylase (FA2H) in human breast cancer MDA-MB-231 cells. Peroxisome proliferator-activated receptor α (PPARα) was previously implicated in this induction. However, the mechanisms mediating this induction have not been elucidated in detail. We performed a DNA microarray analysis of Δ(9)-THC-treated samples and showed the selective up-regulation of the PPARα isoform coupled with the induction of FA2H over the other isoforms (β and γ). Δ(9)-THC itself had no binding/activation potential to/on PPARα, and palmitic acid (PA), a PPARα ligand, exhibited no stimulatory effects on FA2H in MDA-MB-231 cells; thus, we hypothesized that the levels of PPARα induced were involved in the Δ(9)-THC-mediated increase in FA2H. In support of this hypothesis, we herein demonstrated that; (i) Δ(9)-THC activated the basal transcriptional activity of PPARα in a concentration-dependent manner, (ii) the concomitant up-regulation of PPARα/FA2H was caused by Δ(9)-THC, (iii) PA could activate PPARα after the PPARα expression plasmid was introduced, and (iv) the Δ(9)-THC-induced up-regulation of FA2H was further stimulated by the co-treatment with L-663,536 (a known PPARα inducer). Taken together, these results support the concept that the induced levels of PPARα may be involved in the Δ(9)-THC up-regulation of FA2H in MDA-MB-231 cells. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Robert Czajkowski
Full Text Available Pectinolytic Pectobacterium spp. and Dickeya spp. are necrotrophic bacterial pathogens of many important crops, including potato, worldwide. This study reports on the isolation and characterization of broad host lytic bacteriophages able to infect the dominant Pectobacterium spp. and Dickeya spp. affecting potato in Europe viz. Pectobacterium carotovorum subsp. carotovorum (Pcc, P. wasabiae (Pwa and Dickeya solani (Dso with the objective to assess their potential as biological disease control agents. Two lytic bacteriophages infecting stains of Pcc, Pwa and Dso were isolated from potato samples collected from two potato fields in central Poland. The ΦPD10.3 and ΦPD23.1 phages have morphology similar to other members of the Myoviridae family and the Caudovirales order, with a head diameter of 85 and 86 nm and length of tails of 117 and 121 nm, respectively. They were characterized for optimal multiplicity of infection, the rate of adsorption to the Pcc, Pwa and Dso cells, the latent period and the burst size. The phages were genotypically characterized with RAPD-PCR and RFLP techniques. The structural proteomes of both phages were obtained by fractionation of phage proteins by SDS-PAGE. Phage protein identification was performed by liquid chromatography-mass spectrometry (LC-MS analysis. Pulsed-field gel electrophoresis (PFGE, genome sequencing and comparative genome analysis were used to gain knowledge of the length, organization and function of the ΦPD10.3 and ΦPD23.1 genomes. The potential use of ΦPD10.3 and ΦPD23.1 phages for the biocontrol of Pectobacterium spp. and Dickeya spp. infections in potato is discussed.
Directory of Open Access Journals (Sweden)
Anna Wawruszak
Full Text Available Histone deacetylase inhibitors (HDIs are promising anticancer drugs, which inhibit proliferation of a wide variety of cancer cells including breast carcinoma cells. In the present study, we investigated the influence of valproic acid (VPA and suberoylanilide hydroxamic acid (SAHA, vorinostat, alone or in combination with cisplatin (CDDP on proliferation, induction of apoptosis and cell cycle progression in MCF7, T47D and MDA-MB-231 human breast carcinoma cell lines. The type of interaction between HDIs and CDDP was determined by an isobolographic analysis. The isobolographic analysis is a very precise and rigorous pharmacodynamic method, to determine the presence of synergism, addition or antagonism between different drugs with using variety of fixed dose ratios. Our experiments show that the combinations of CDDP with SAHA or VPA at a fixed-ratio of 1:1 exerted additive interaction in the viability of MCF7 cells, while in T47D cells there was a tendency to synergy. In contrast, sub-additive (antagonistic interaction was observed for the combination of CDDP with VPA in MDA-MB-231 "triple-negative" (i.e. estrogen receptor negative, progesterone receptor negative, and HER-2 negative human breast cancer cells, whereas combination of CDDP with SAHA in the same MDA-MB-231 cell line yielded additive interaction. Additionally, combined HDIs/CDDP treatment resulted in increase in apoptosis and cell cycle arrest in all tested breast cancer cell lines in comparison with a single therapy. In conclusion, the additive interaction of CDDP with SAHA or VPA suggests that HDIs could be combined with CDDP in order to optimize treatment regimen in some human breast cancers.
Directory of Open Access Journals (Sweden)
Marianne Sandin
2015-09-01
Full Text Available Protein translocation between organelles in the cell is an important process that regulates many cellular functions. However, organelles can rarely be isolated to purity so several methods have been developed to analyse the fractions obtained by density gradient centrifugation. We present an analysis of the distribution of proteins amongst organelles in the human breast cell line, MDA-MB-231 using two approaches: an isotopic labelling and a label-free approach.
Directory of Open Access Journals (Sweden)
Lily Boo
2017-07-01
Full Text Available Breast cancer spheroids have been widely used as in vitro models of cancer stem cells (CSCs, yet little is known about their phenotypic characteristics and microRNAs (miRNAs expression profiles. The objectives of this research were to evaluate the phenotypic characteristics of MDA-MB-231 spheroid-enriched cells for their CSCs properties and also to determine their miRNAs expression profile. Similar to our previously published MCF-7 spheroid, MDA-MB-231 spheroid also showed typical CSCs characteristics namely self-renewability, expression of putative CSCs-related surface markers and enhancement of drug resistance. From the miRNA profile, miR-15b, miR-34a, miR-148a, miR-628 and miR-196b were shown to be involved in CSCs-associated signalling pathways in both models of spheroids, which highlights the involvement of these miRNAs in maintaining the CSCs features. In addition, unique clusters of miRNAs namely miR-205, miR-181a and miR-204 were found in basal-like spheroid whereas miR-125, miR-760, miR-30c and miR-136 were identified in luminal-like spheroid. Our results highlight the roles of miRNAs as well as novel perspectives of the relevant pathways underlying spheroid-enriched CSCs in breast cancer.
Energy Technology Data Exchange (ETDEWEB)
Takeda, Shuso [Department of Molecular Biology, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan); Laboratory of Xenobiotic Metabolism and Environmental Toxicology, Faculty of Pharmaceutical Sciences, Hiroshima International University (HIU), 5-1-1 Hiro-koshingai, Kure, Hiroshima 737-0112 (Japan); Ikeda, Eriko [Department of Molecular Biology, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan); Su, Shengzhong [Center for Molecular Toxicology and Carcinogenesis, 101 Life Sciences Building, Pennsylvania State University, University Park, PA 16802 (United States); Harada, Mari [Department of Molecular Biology, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan); Okazaki, Hiroyuki [Drug Innovation Research Center, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan); Yoshioka, Yasushi; Nishimura, Hajime; Ishii, Hiroyuki; Kakizoe, Kazuhiro; Taniguchi, Aya; Tokuyasu, Miki; Himeno, Taichi [Department of Molecular Biology, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan); Watanabe, Kazuhito [Department of Hygienic Chemistry, Faculty of Pharmaceutical Sciences, Hokuriku University, Ho-3 Kanagawa-machi, Kanazawa 920-1181 (Japan); Omiecinski, Curtis J. [Center for Molecular Toxicology and Carcinogenesis, 101 Life Sciences Building, Pennsylvania State University, University Park, PA 16802 (United States); Aramaki, Hironori [Department of Molecular Biology, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan); Drug Innovation Research Center, Daiichi University of Pharmacy, 22-1 Tamagawa-cho, Minami-ku, Fukuoka 815-8511 (Japan)
2014-12-04
We recently reported that Δ{sup 9}-tetrahydrocannabinol (Δ{sup 9}-THC), a major cannabinoid component in Cannabis Sativa (marijuana), significantly stimulated the expression of fatty acid 2-hydroxylase (FA2H) in human breast cancer MDA-MB-231 cells. Peroxisome proliferator-activated receptor α (PPARα) was previously implicated in this induction. However, the mechanisms mediating this induction have not been elucidated in detail. We performed a DNA microarray analysis of Δ{sup 9}-THC-treated samples and showed the selective up-regulation of the PPARα isoform coupled with the induction of FA2H over the other isoforms (β and γ). Δ{sup 9}-THC itself had no binding/activation potential to/on PPARα, and palmitic acid (PA), a PPARα ligand, exhibited no stimulatory effects on FA2H in MDA-MB-231 cells; thus, we hypothesized that the levels of PPARα induced were involved in the Δ{sup 9}-THC-mediated increase in FA2H. In support of this hypothesis, we herein demonstrated that; (i) Δ{sup 9}-THC activated the basal transcriptional activity of PPARα in a concentration-dependent manner, (ii) the concomitant up-regulation of PPARα/FA2H was caused by Δ{sup 9}-THC, (iii) PA could activate PPARα after the PPARα expression plasmid was introduced, and (iv) the Δ{sup 9}-THC-induced up-regulation of FA2H was further stimulated by the co-treatment with L-663,536 (a known PPARα inducer). Taken together, these results support the concept that the induced levels of PPARα may be involved in the Δ{sup 9}-THC up-regulation of FA2H in MDA-MB-231 cells.
Directory of Open Access Journals (Sweden)
Mennerich Detlev
2007-01-01
Full Text Available Abstract Background Stromelysin-3 (ST-3 is over-expressed in the majority of human carcinomas including breast carcinoma. Due to its known effect in promoting tumour formation, but its impeding effect on metastasis, a dual role of ST-3 in tumour progression, depending on the cellular grade of dedifferentiation, was hypothesized. Methods The present study was designed to investigate the influence of ST-3 in vivo and in vitro on the oestrogen-dependent, non-invasive MCF-7 breast carcinoma cell line as well as on the oestrogen-independent, invasive MDA-MB-231 breast carcinoma cell line. Therefore an orthotopic human xenograft tumour model in nude mice, as well as a 3D matrigel cell culture system, were employed. Results Using both in vitro and in vivo techniques, we have demonstrated that over-expression of ST-3 in MCF-7 and MDA-MB-231 cells leads to both increased cell numbers and tumour volumes. This observation was dependent upon the presence of growth factors. In particular, the enhanced proliferative capacity was in MCF-7/ST-3 completely and in MDA-MB-231/ST-3 cells partially dependent on the IGF-1 signalling pathway. Microarray analysis of ST-3 over-expressing cells revealed that in addition to cell proliferation, further biological processes seemed to be affected, such as cell motility and stress response. The MAPK-pathway as well as the Wnt and PI3-kinase pathways, appear to also play a potential role. Furthermore, we have demonstrated that breast cancer cell lines of different differentiation status, as well as the non-tumourigenic cell line MCF-10A, have a comparable capability to induce endogenous ST-3 expression in fibroblasts. Conclusion These data reveal that ST-3 is capable of enhancing tumourigenesis in highly differentiated "early stage" breast cancer cell lines as well as in further progressed breast cancer cell lines that have already undergone epithelial-mesenchymal transition. We propose that ST-3 induction in tumour
International Nuclear Information System (INIS)
Kasper, Grit; Lehmann, Kerstin E; Reule, Matthias; Tschirschmann, Miriam; Dankert, Niels; Stout-Weider, Karen; Lauster, Roland; Schrock, Evelin; Mennerich, Detlev; Duda, Georg N
2007-01-01
Stromelysin-3 (ST-3) is over-expressed in the majority of human carcinomas including breast carcinoma. Due to its known effect in promoting tumour formation, but its impeding effect on metastasis, a dual role of ST-3 in tumour progression, depending on the cellular grade of dedifferentiation, was hypothesized. The present study was designed to investigate the influence of ST-3 in vivo and in vitro on the oestrogen-dependent, non-invasive MCF-7 breast carcinoma cell line as well as on the oestrogen-independent, invasive MDA-MB-231 breast carcinoma cell line. Therefore an orthotopic human xenograft tumour model in nude mice, as well as a 3D matrigel cell culture system, were employed. Using both in vitro and in vivo techniques, we have demonstrated that over-expression of ST-3 in MCF-7 and MDA-MB-231 cells leads to both increased cell numbers and tumour volumes. This observation was dependent upon the presence of growth factors. In particular, the enhanced proliferative capacity was in MCF-7/ST-3 completely and in MDA-MB-231/ST-3 cells partially dependent on the IGF-1 signalling pathway. Microarray analysis of ST-3 over-expressing cells revealed that in addition to cell proliferation, further biological processes seemed to be affected, such as cell motility and stress response. The MAPK-pathway as well as the Wnt and PI3-kinase pathways, appear to also play a potential role. Furthermore, we have demonstrated that breast cancer cell lines of different differentiation status, as well as the non-tumourigenic cell line MCF-10A, have a comparable capability to induce endogenous ST-3 expression in fibroblasts. These data reveal that ST-3 is capable of enhancing tumourigenesis in highly differentiated 'early stage' breast cancer cell lines as well as in further progressed breast cancer cell lines that have already undergone epithelial-mesenchymal transition. We propose that ST-3 induction in tumour fibroblasts leads to the stimulation of the IGF-1R pathway in
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
Reithmeier, Anja; Panizza, Elena; Krumpel, Michael; Orre, Lukas M; Branca, Rui M M; Lehtiö, Janne; Ek-Rylander, Barbro; Andersson, Göran
2017-09-15
Tartrate-resistant acid phosphatase (TRAP/ACP5), a metalloenzyme that is characteristic for its expression in activated osteoclasts and in macrophages, has recently gained considerable focus as a driver of metastasis and was associated with clinically relevant parameters of cancer progression and cancer aggressiveness. MDA-MB-231 breast cancer cells with different TRAP expression levels (overexpression and knockdown) were generated and characterized for protein expression and activity levels. Functional cell experiments, such as proliferation, migration and invasion assays were performed as well as global phosphoproteomic and proteomic analysis was conducted to connect molecular perturbations to the phenotypic changes. We identified an association between metastasis-related properties of TRAP-overexpressing MDA-MB-231 breast cancer cells and a TRAP-dependent regulation of Transforming growth factor (TGFβ) pathway proteins and Cluster of differentiation 44 (CD44). Overexpression of TRAP increased anchorage-independent and anchorage-dependent cell growth and proliferation, induced a more elongated cellular morphology and promoted cell migration and invasion. Migration was increased in the presence of the extracellular matrix (ECM) proteins osteopontin and fibronectin and the basement membrane proteins collagen IV and laminin I. TRAP-induced properties were reverted upon shRNA-mediated knockdown of TRAP or treatment with the small molecule TRAP inhibitor 5-PNA. Global phosphoproteomics and proteomics analyses identified possible substrates of TRAP phosphatase activity or signaling intermediates and outlined a TRAP-dependent regulation of proteins involved in cell adhesion and ECM organization. Upregulation of TGFβ isoform 2 (TGFβ2), TGFβ receptor type 1 (TβR1) and Mothers against decapentaplegic homolog 2 (SMAD2), as well as increased intracellular phosphorylation of CD44 were identified upon TRAP perturbation. Functional antibody-mediated blocking and chemical
Aleksiūnienė, Beata; Preiksaitiene, Egle; Morkūnienė, Aušra; Ambrozaitytė, Laima; Utkus, Algirdas
2018-01-01
Many studies have shown that molecular karyotyping is an effective diagnostic tool in individuals with developmental delay/intellectual disability. We report on a de novo interstitial 1q22q23.1 microdeletion, 1.6 Mb in size, detected in a patient with short stature, microcephaly, hypoplastic corpus callosum, cleft palate, minor facial anomalies, congenital heart defect, camptodactyly of the 4-5th fingers, and intellectual disability. Chromosomal microarray analysis revealed a 1.6-Mb deletion in the 1q22q23.1 region, arr[GRCh37] 1q22q23.1(155630752_157193893)×1. Real-time PCR analysis confirmed its de novo origin. The deleted region encompasses 50 protein-coding genes, including the morbid genes APOA1BP, ARHGEF2, LAMTOR2, LMNA, NTRK1, PRCC, RIT1, SEMA4A, and YY1AP1. Although the unique phenotype observed in our patient can arise from the haploinsufficiency of the dosage-sensitive LMNA gene, the dosage imbalance of other genes implicated in the rearrangement could also contribute to the phenotype. Further studies are required for the delineation of the phenotype associated with this rare chromosomal alteration and elucidation of the critical genes for manifestation of the specific clinical features. © 2018 S. Karger AG, Basel.
International Nuclear Information System (INIS)
Hertz, M.R.; Figgins, P.E.; Deal, W.R.
1983-01-01
The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 100 0 C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables
Another piece of the puzzle: The fast H I outflow in Mrk 231
Morganti, Raffaella; Veilleux, Sylvain; Oosterloo, Tom; Teng, Stacy H.; Rupke, David
2016-09-01
We present the detection, performed with the Westerbork Synthesis Radio Telescope (WSRT) and the Karl Jansky Very Large Array (VLA), of a fast H I 21 cm outflow in the ultra-luminous infrared galaxy Mrk 231. The outflow is observed as shallow H I absorption blueshifted ~1300 km s-1 with respect to the systemic velocity and located against the inner kpc of the radio source. The outflowing gas has an estimated column density between 5 and 15 × 1018Tspin cm-2. We derive the Tspin to lie in the range 400-2000 K and the corresponding H I densities are nHI ~ 10-100 cm-3. Our results complement previous findings and confirm the multiphase nature of the outflow in Mrk 231. Although effects of the interaction between the radio plasma and the surrounding medium cannot be ruled out, the energetics and the lack of a clear kpc-scale jet suggest that the most likely origin of the H I outflow is a wide-angle nuclear wind, as earlier proposed to explain the neutral outflow traced by Na I and molecular gas in this source. Our results suggest that an H I component is present in fast outflows regardless of the acceleration mechanism (wind vs. jet driven) and that it must be connected with common properties of the pre-interaction gas involved. Considering the observed similarity of their column densities, the H I outflow likely represents the inner part of the broad wind identified on larger scales in atomic Na I. The mass outflow rate of the H I outflow (between 8 and 18 M⊙ yr-1) does not appear to be as large as that observed in molecular gas, partly owing to the smaller sizes of the outflowing region sampled by the H I absorption. These characteristics are commonly seen in other cases of outflows driven by the active galactic nucleus (AGN) suggesting that the H I may represent a short intermediate phase in the rapid cooling of the gas. The results further confirm H I as a good tracer for AGN-driven outflows not only in powerful radio sources. We also obtained deeper continuum
Midro, Alina T; Zollino, Marcella; Wiland, Ewa; Panasiuk, Barbara; Iwanowski, Piotr S; Murdolo, Marina; Śmigiel, Robert; Sąsiadek, Maria; Pilch, Jacek; Kurpisz, Maciej
2016-02-01
The purpose of this study was to compare meiotic segregation in sperm cells from two carriers with t(4;8)(p16;p23.1) reciprocal chromosome translocations (RCTs), differing in localization of the breakpoint positions at the 4p subband-namely, 4p16.3 (carrier 1) and 4p16.1 (carrier 2)-and to compare data of the pedigree analyses performed by direct method. Three-color fluorescent in situ hybridization (FISH) on sperm cells and FISH mapping for the evaluation of the breakpoint positions, data from pedigrees, and direct segregation analysis of the pedigrees were performed. Similar proportions of normal/balanced and unbalanced sperm cells were found in both carriers. The most common was an alternate type of segregation (about 52 % and about 48 %, respectively). Unbalanced adjacent I and adjacent II karyotypes were found in similar proportions about 15 %. The direct segregation analysis (following Stengel-Rutkowski) of the pedigree of carriers of t(4;8)(p16.1;p23.1) was performed and results were compared with the data of the pedigree segregation analysis obtained earlier through the indirect method. The probability of live-born progeny with unbalanced karyotype for carriers of t(4;8)(p16.1;p23.1) was moderately high at 18.8 %-comparable to the value obtained using the indirect method for the same carriership, which was 12 %. This was, however, markedly lower than the value of 41.2 % obtained through the pedigree segregation indirect analysis estimated for carriers of t(4;8)(p16.3;p23.1), perhaps due to the unique composition of genes present within the 4p16.1-4p 16.3 region. Revealed differences in pedigree segregation analysis did not correspond to the very similar profile of meiotic segregation patterns presented by carrier 1 and carrier 2. Most probably, such discordances may be due to differences in embryo survival rates arising from different genetic backgrounds.
Lee, Da Young; Lee, Da Hyun; Jung, Jung You; Koh, Dongsoo; Kim, Geum-Soog; Ahn, Young-Sup; Lee, Young Han; Lim, Yoongho; Shin, Soon Young
2016-01-01
2-Hydroxy-3',5,5'-trimenthoxyochalcone (DK-139) is a synthetic chalcone-derived compound. This study evaluated the biological activity of DK-139 on the inhibition of tumor metastasis. Growth-regulated oncogene-alpha (GROα) plays an important role in the progression of tumor development by stimulating angiogenesis and metastasis. In this study, DK-139 inhibited tumor necrosis factor alpha (TNFα)-induced GROα gene promoter activity by inhibiting of IκB kinase (IKK) in MDA-MB231 cells. In addition, DK-139 prevented the TNFα-induced cell migration, F-actin formation, and invasive capability of MDA-MB-231 cells. These findings suggest that DK-139 is a potential drug candidate for the inhibition of tumor cell locomotion and invasion via the suppression of NF-κB-mediated GROα expression. Copyright © 2015 Elsevier Ltd. All rights reserved.
Hillaire-Marcel, C.; Ghaleb, B.; de Vernal, A.; Maccali, J.; Cuny, K.; Jacobel, A.; Le Duc, C.; McManus, J.
2017-12-01
Merging the late Quaternary Arctic paleoceanography into the Earth's global climate history remains challenging due to the lack of robust marine chronostratigraphies. Over ridges notably, low and variable sedimentation rates, scarce biogenic remains ensuing from low productivity and/or poor preservation, and oxygen isotope and paleomagnetic records differing from global stacks represent major impediments. However, as illustrate here based on consistent records from Mendeleev-Alpha and Lomonosov Ridges, disequilibria between U-series isotopes can provide benchmark ages. In such settings, fluxes of the particle-reactive U-daughter isotopes 230Th and 231Pa from the water column, are not unequivocally linked to sedimentation rates, but rather to sea-ice rafting and brine production histories, thus to the development of sea-ice factories over shelves during intervals of high relative sea level. The excesses in 230Th and 231Pa over fractions supported by their parent U-isotopes, collapse down sedimentary sequences, due to radioactive decay, and provide radiometric benchmark ages of approximately 300 and 140 ka, respectively. These "extinction ages" point to mean sedimentation rates of ˜4.3 and ˜1.7 mm/ka, respectively, over the Lomonosov and Mendeleev Ridges, which are significantly lower than assumed in most recent studies, thus highlighting the need for revisiting current interpretations of Arctic lithostratigraphies in relation to the global-scale late Quaternary climatostratigraphy.
Directory of Open Access Journals (Sweden)
Prakash P Mansara
Full Text Available Omega 3 (n3 and Omega 6 (n6 polyunsaturated fatty acids (PUFAs have been reported to exhibit opposing roles in cancer progression. Our objective was to determine whether different ratios of n6/n3 (AA/EPA+DHA FAs could modulate the cell viability, lipid peroxidation, total cellular fatty acid composition and expression of tumor regulatory Matrix Attachment Region binding proteins (MARBPs in breast cancer cell lines and in non-cancerous, MCF10A cells. Low ratios of n6/n3 (1:2.5, 1:4, 1:5, 1:10 FA decreased the viability and growth of MDA-MB-231 and MCF7 significantly compared to the non-cancerous cells (MCF10A. Contrarily, higher n6/n3 FA (2.5:1, 4:1, 5:1, 10:1 decreased the survival of both the cancerous and non-cancerous cell types. Lower ratios of n6/n3 selectively induced LPO in the breast cancer cells whereas the higher ratios induced in both cancerous and non-cancerous cell types. Interestingly, compared to higher n6/n3 FA ratios, lower ratios increased the expression of tumor suppressor MARBP, SMAR1 and decreased the expression of tumor activator Cux/CDP in both breast cancer and non-cancerous, MCF10A cells. Low n6/n3 FAs significantly increased SMAR1 expression which resulted into activation of p21WAF1/CIP1 in MDA-MB-231 and MCF7, the increase being ratio dependent in MDA-MB-231. These results suggest that increased intake of n3 fatty acids in our diet could help both in the prevention as well as management of breast cancer.
Feruglio, C.; Fiore, F.; Carniani, S.; Piconcelli, E.; Zappacosta, L.; Bongiorno, A.; Cicone, C.; Maiolino, R.; Marconi, A.; Menci, N.; Puccetti, S.; Veilleux, S.
2015-11-01
Mrk 231 is a nearby ultra-luminous IR galaxy exhibiting a kpc-scale, multi-phase AGN-driven outflow. This galaxy represents the best target to investigate in detail the morphology and energetics of powerful outflows, as well as their still poorly-understood expansion mechanism and impact on the host galaxy. In this work, we present the best sensitivity and angular resolution maps of the molecular disk and outflow of Mrk 231, as traced by CO(2-1) and (3-2) observations obtained with the IRAM/PdBI. In addition, we analyze archival deep Chandra and NuSTAR X-ray observations. We use this unprecedented combination of multi-wavelength data sets to constrain the physical properties of both the molecular disk and outflow, the presence of a highly-ionized ultra-fast nuclear wind, and their connection. The molecular CO(2-1) outflow has a size of 1 kpc, and extends in all directions around the nucleus, being more prominent along the south-west to north-east direction, suggesting a wide-angle biconical geometry. The maximum projected velocity of the outflow is nearly constant out to 1 kpc, thus implying that the density of the outflowing material must decrease from the nucleus outwards as r-2. This suggests that either a large part of the gas leaves the flow during its expansion or that the bulk of the outflow has not yet reached out to 1 kpc, thus implying a limit on its age of 1 Myr. Mapping the mass and energy rates of the molecular outflow yields dot {M} OF = [500-1000] M⊙ yr-1 and Ėkin,OF = [7-10] × 1043 erg s-1. The total kinetic energy of the outflow is Ekin,OF is of the same order of the total energy of the molecular disk, Edisk. Remarkably, our analysis of the X-ray data reveals a nuclear ultra-fast outflow (UFO) with velocity -20 000 km s-1, dot {M}UFO = [0.3-2.1] M⊙ yr-1, and momentum load dot {P}UFO/ dot {P}rad = [0.2-1.6]. We find Ėkin,UFO Ėkin,OF as predicted for outflows undergoing an energy conserving expansion. This suggests that most of the UFO
Zhang, Yemin; Zhou, Yu; Li, Mingxin; Wang, Changhua
2016-01-01
Previous studies have evidenced that the anticancer potential of curcumin (diferuloylmethane), a main yellow bioactive compound from plant turmeric was mediated by interfering with PI3K/Akt signaling. However, the underlying molecular mechanism is still poorly understood. This study experimentally revealed that curcumin treatment reduced Akt protein expression in a dose- and time-dependent manner in MDA-MB-231 breast cancer cells, along with an activation of autophagy and suppression of ubiquitin-proteasome system (UPS) function. The curcumin-reduced Akt expression, cell proliferation, and migration were prevented by genetic and pharmacological inhibition of autophagy but not by UPS inhibition. Additionally, inactivation of AMPK by its specific inhibitor compound C or by target shRNA-mediated silencing attenuated curcumin-activated autophagy. Thus, these results indicate that curcumin-stimulated AMPK activity induces activation of the autophagy-lysosomal protein degradation pathway leading to Akt degradation and the subsequent suppression of proliferation and migration in breast cancer cell. PMID:26752181
Th{sup 232} (n,2n) Th{sup 231} cross section from threshold to 20.4 Mev
Energy Technology Data Exchange (ETDEWEB)
Butler, J P; Santry, D C
1961-07-01
The excitation curve for the reaction Th{sup 232} (n,2n) Th{sup 231} has been measured by the activation method from the threshold energy, 6.34 Mev, to 20.4 Mev, relative to the known cross section for the S{sup 32} (n, p) P{sup 32} reaction. Monoenergetic neutrons were obtained from the D (d,n) He{sup 3} and T (d,n) He{sup 4} reactions employing a Tandem Van de Graaff accelerator. From threshold to 9.0 Mev, the (n,2n) cross section rises rapidly, reaching its maximum value of 1.88 {+-} 0.09 barns in the region of 9.5 to 11.0 Mev. Above 11.5 Mev the (n,2n) cross section decreases due to competition of the (n,3n) and (n,2nf) reactions and at 20.4 Mev it has a value of 0.22{sub 5} {+-} 0.01{sub 5} barns. (author)
Directory of Open Access Journals (Sweden)
Wang Ling
2013-02-01
Full Text Available Abstract Background Celecoxib is a selective cyclooxygenase (COX-2 inhibitor that has been reported to reduce the risk of breast cancer. In our previous study, celecoxib induced apoptosis and caused cell cycle arrest at the G0/G1 phase in the breast cancer cell line MDA-MB-231, and its effects were mediated by downregulation of NF-κB signaling. The NF-κB p65/RelA subunit may play a role in cell death through the activation of anti-apoptotic target genes including the inhibitor of apoptosis (IAP and Bcl-2 families, and inhibition of protein kinase B/Akt. The aim of the present study was to investigate p65 as the potential target of celecoxib treatment and determine whether p65 overexpression can override the inhibitory effect of celecoxib on NF-κB activity and affect cell survival. Methods The effects of p65 overexpression on celecoxib-inhibited NF-κB transcriptional activity were examined by western blotting, electrophoretic mobility shift assay (EMSA and luciferase reporter gene assay. Cell viability and cell death were evaluated by the 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazoliumbromide (MTT assay, and the levels of cleaved poly(ADP-ribose polymerase (PARP and caspase. Anti-apoptotic NF-κB target genes and cell cycle regulators were examined by western blotting to screen for the expression of target genes under direct regulation by p65. Results Overexpression of p65 increased NF-κB transcriptional activity and interfered with celecoxib-mediated apoptosis as assessed by MTT assay and caspase-3, caspase-9, and PARP expressions. Exogenously overexpressed p65 upregulated NF-κB-responsive genes, including anti-apoptotic genes such as survivin and XIAP, and the cell cycle regulatory gene cyclin D1. However, p65 overexpression did not affect celecoxib-induced p-Akt inactivation, suggesting that celecoxib might have separate molecular mechanisms for regulating Akt signaling independently of its inhibition of NF-κB transcriptional
International Nuclear Information System (INIS)
Lee, W.-J.; Chen, W.-K.; Wang, C.-J.; Lin, W.-L.; Tseng, T.-H.
2008-01-01
Hepatocyte growth factor (HGF) and its receptor, Met, known to control invasive growth program have recently been shown to play crucial roles in the survival of breast cancer patients. The diet-derived flavonoids have been reported to possess anti-invasion properties; however, knowledge on the pharmacological and molecular mechanisms in suppressing HGF/Met-mediated tumor invasion and metastasis is poorly understood. In our preliminary study, we use HGF as an invasive inducer to investigate the effect of flavonoids including apigenin, naringenin, genistein and kaempferol on HGF-dependent invasive growth of MDA-MB-231 human breast cancer cells. Results show that apigenin presents the most potent anti-migration and anti-invasion properties by Boyden chamber assay. Furthermore, apigenin represses the HGF-induced cell motility and scattering and inhibits the HGF-promoted cell migration and invasion in a dose-dependent manner. The effect of apigenin on HGF-induced signaling activation involving invasive growth was evaluated by immunoblotting analysis, it shows that apigenin blocks the HGF-induced Akt phosphorylation but not Met, ERK, and JNK phosphorylation. In addition to MDA-MB-231 cells, apigenin exhibits inhibitory effect on HGF-induced Akt phosphorylation in hepatoma SK-Hep1 cells and lung carcinoma A549 cells. By indirect immunofluorescence microscopy assay, apigenin inhibits the HGF-induced clustering of β4 integrin at actin-rich adhesive site and lamellipodia through PI3K-dependent manner. Treatment of apigenin inhibited HGF-stimulated integrin β4 function including cell-matrix adhesion and cell-endothelial cells adhesion in MDA-MB-231 cells. By Akt-siRNA transfection analysis, it confirmed that apigenin inhibited HGF-promoted invasive growth involving blocking PI3K/Akt pathway. Finally, we evaluated the effect of apigenin on HGF-promoted metastasis by lung colonization of tumor cells in nude mice and organ metastasis of tumor cells in chick embryo. By
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
International Nuclear Information System (INIS)
Harrison, Susan MW; Knifley, Teresa; Chen, Min; O’Connor, Kathleen L
2013-01-01
Various pathways impinge on the actin-myosin pathway to facilitate cell migration and invasion including members of the Rho family of small GTPases and MAPK. However, the signaling components that are considered important for these processes vary substantially within the literature with certain pathways being favored. These distinctions in signaling pathways utilized are often attributed to differences in cell type or physiological conditions; however, these attributes have not been systematically assessed. To address this question, we analyzed the migration and invasion of MDA-MB-231 breast carcinoma cell line in response to various stimuli including lysophosphatidic acid (LPA), hepatocyte growth factor (HGF) and epidermal growth factor (EGF) and determined the involvement of select signaling pathways that impact myosin light chain phosphorylation. LPA, a potent stimulator of the Rho-ROCK pathway, surprisingly did not require the Rho-ROCK pathway to stimulate migration but instead utilized Rac and MAPK. In contrast, LPA-stimulated invasion required Rho, Rac, and MAPK. Of these three major pathways, EGF-stimulated MDA-MB-231 migration and invasion required Rho; however, Rac was essential only for invasion and MAPK was dispensable for migration. HGF signaling, interestingly, utilized the same pathways for migration and invasion, requiring Rho but not Rac signaling. Notably, the dependency of HGF-stimulated migration and invasion as well as EGF-stimulated invasion on MAPK was subject to the inhibitors used. As expected, myosin light chain kinase (MLCK), a convergence point for MAPK and Rho family GTPase signaling, was required for all six conditions. These observations suggest that, while multiple signaling pathways contribute to cancer cell motility, not all pathways operate under all conditions. Thus, our study highlights the plasticity of cancer cells to adapt to multiple migratory cues
Mileo, Anna Maria; Di Venere, Donato; Abbruzzese, Claudia; Miccadei, Stefania
2015-01-01
Polyphenolic extracts from the edible part of artichoke (Cynara scolymus L.) have been shown to be potential chemopreventive and anticancer dietary compounds. High doses of polyphenolic extracts (AEs) induce apoptosis and decrease the invasive potential of the human breast cancer cell line, MDA-MB231. However, the molecular mechanism underlying AEs antiproliferative effects is not completely understood. We demonstrate that chronic and low doses of AEs treatment at sublethal concentrations suppress human breast cancer cell growth via a caspases-independent mechanism. Furthermore, AEs exposure induces a significant increase of senescence-associated β-galactosidase (SA-β-gal) staining and upregulation of tumour suppressor genes, p16(INK4a) and p21(Cip1/Waf1) in MDA-MB231 cells. AEs treatment leads to epigenetic alterations in cancer cells, modulating DNA hypomethylation and lysine acetylation levels in total proteins. Cell growth arrest correlates with increased reactive oxygen species (ROS) production in AEs treated breast cancer cells. Inhibition of ROS generation by N-acetylcysteine (NAC) attenuates the antiproliferative effect. These findings demonstrate that chronic AEs treatment inhibits breast cancer cell growth via the induction of premature senescence through epigenetic and ROS-mediated mechanisms. Our results suggest that artichoke polyphenols could be a promising dietary tool either in cancer chemoprevention or/and in cancer treatment as a nonconventional, adjuvant therapy.
International Nuclear Information System (INIS)
Morini, Monica; Astigiano, Simonetta; Gitton, Yorick; Emionite, Laura; Mirisola, Valentina; Levi, Giovanni; Barbieri, Ottavia
2010-01-01
The DLX gene family encodes for homeobox transcription factors involved in the control of morphogenesis and tissue homeostasis. Their expression can be regulated by Endothelin1 (ET1), a peptide associated with breast cancer invasive phenotype. Deregulation of DLX gene expression was found in human solid tumors and hematologic malignancies. In particular, DLX4 overexpression represents a possible prognostic marker in ovarian cancer. We have investigated the role of DLX genes in human breast cancer progression. MDA-MB-231 human breast carcinoma cells were grown in vitro or injected in nude mice, either subcutaneously, to mimic primary tumor growth, or intravenously, to mimic metastatic spreading. Expression of DLX2, DLX5 and DLX6 was assessed in cultured cells, either treated or not with ET1, tumors and metastases by RT-PCR. In situ hybridization was used to confirm DLX gene expression in primary tumors and in lung and bone metastases. The expression of DLX2 and DLX5 was evaluated in 408 primary human breast cancers examining the GSE1456 and GSE3494 microarray datasets. Kaplan-Meier estimates for disease-free survival were calculated for the patients grouped on the basis of DLX2/DLX5 expression. Before injection, or after subcutaneous growth, MDA-MB-231 cells expressed DLX2 but neither DLX5 nor DLX6. Instead, in bone and lung metastases resulting from intravenous injection we detected expression of DLX5/6 but not of DLX2, suggesting that DLX5/6 are activated during metastasis formation, and that their expression is alternative to that of DLX2. The in vitro treatment of MDA-MB-231 cells with ET1, resulted in switch from DLX2 to DLX5 expression. By data mining in microarray datasets we found that expression of DLX2 occurred in 21.6% of patients, and was significantly correlated with prolonged disease-free survival and reduced incidence of relapse. Instead, DLX5 was expressed in a small subset of cases, 2.2% of total, displaying reduced disease-free survival and high
Energy Technology Data Exchange (ETDEWEB)
Shevtsov, M. B.; Streeter, S. D.; Thresh, S.-J.; Swiderska, A.; McGeehan, J. E.; Kneale, G. G., E-mail: geoff.kneale@port.ac.uk [University of Portsmouth, Portsmouth PO1 2DY (United Kingdom)
2015-02-01
The structure of the new class of controller proteins (exemplified by C.Csp231I) in complex with its 21 bp DNA-recognition sequence is presented, and the molecular basis of sequence recognition in this class of proteins is discussed. An unusual extended spacer between the dimer binding sites suggests a novel interaction between the two C-protein dimers. In a wide variety of bacterial restriction–modification systems, a regulatory ‘controller’ protein (or C-protein) is required for effective transcription of its own gene and for transcription of the endonuclease gene found on the same operon. We have recently turned our attention to a new class of controller proteins (exemplified by C.Csp231I) that have quite novel features, including a much larger DNA-binding site with an 18 bp (∼60 Å) spacer between the two palindromic DNA-binding sequences and a very different recognition sequence from the canonical GACT/AGTC. Using X-ray crystallography, the structure of the protein in complex with its 21 bp DNA-recognition sequence was solved to 1.8 Å resolution, and the molecular basis of sequence recognition in this class of proteins was elucidated. An unusual aspect of the promoter sequence is the extended spacer between the dimer binding sites, suggesting a novel interaction between the two C-protein dimers when bound to both recognition sites correctly spaced on the DNA. A U-bend model is proposed for this tetrameric complex, based on the results of gel-mobility assays, hydrodynamic analysis and the observation of key contacts at the interface between dimers in the crystal.
International Nuclear Information System (INIS)
Shevtsov, M. B.; Streeter, S. D.; Thresh, S.-J.; Swiderska, A.; McGeehan, J. E.; Kneale, G. G.
2015-01-01
The structure of the new class of controller proteins (exemplified by C.Csp231I) in complex with its 21 bp DNA-recognition sequence is presented, and the molecular basis of sequence recognition in this class of proteins is discussed. An unusual extended spacer between the dimer binding sites suggests a novel interaction between the two C-protein dimers. In a wide variety of bacterial restriction–modification systems, a regulatory ‘controller’ protein (or C-protein) is required for effective transcription of its own gene and for transcription of the endonuclease gene found on the same operon. We have recently turned our attention to a new class of controller proteins (exemplified by C.Csp231I) that have quite novel features, including a much larger DNA-binding site with an 18 bp (∼60 Å) spacer between the two palindromic DNA-binding sequences and a very different recognition sequence from the canonical GACT/AGTC. Using X-ray crystallography, the structure of the protein in complex with its 21 bp DNA-recognition sequence was solved to 1.8 Å resolution, and the molecular basis of sequence recognition in this class of proteins was elucidated. An unusual aspect of the promoter sequence is the extended spacer between the dimer binding sites, suggesting a novel interaction between the two C-protein dimers when bound to both recognition sites correctly spaced on the DNA. A U-bend model is proposed for this tetrameric complex, based on the results of gel-mobility assays, hydrodynamic analysis and the observation of key contacts at the interface between dimers in the crystal
International Nuclear Information System (INIS)
Rolison, J.M.; Treinen, K.C.; McHugh, K.C.; Gaffney, A.M.; Williams, R.W.
2017-01-01
Uranium certified reference materials (CRM) issued by New Brunswick Laboratory were subjected to dating using four independent uranium-series radiochronometers. In all cases, there was acceptable agreement between the model ages calculated using the 231 Pa- 235 U, 230 Th- 234 U, 227 Ac- 235 U or 226 Ra- 234 U radiochronometers and either the certified 230 Th- 234 U model date (CRM 125-A and CRM U630), or the known purification date (CRM U050 and CRM U100). The agreement between the four independent radiochronometers establishes these uranium certified reference materials as ideal informal standards for validating dating techniques utilized in nuclear forensic investigations in the absence of standards with certified model ages for multiple radiochronometers. (author)
Energy Technology Data Exchange (ETDEWEB)
Schlomberg, K.; Eickhoff, J.; Beatty, B.; Braus, G.; Durbin, L.; Fiehweg, R.; Ray, M.; Ryon, T.; Schmitz, E.
2014-08-01
The National Renewable Energy Laboratory's (NREL's) Environmental Performance Report provides a description of the laboratory's environmental management activities for 2013, including information on environmental and sustainability performance, environmental compliance activities and status, and environmental protection programs, highlights, and successes. The purpose of this report is to ensure that U.S. Department of Energy (DOE) and the public receive timely, accurate information about events that have affected or could adversely affect the health, safety, and security of the public or workers; the environment; or the operations of DOE facilities. This report meets the requirements of the Annual Site Environmental Report and is prepared in accordance with the DOE Order 231.1B, Environment, Safety and Health Reporting.
Abdullah, Al-Shwyeh Hussah; Mohammed, Abdulkarim Sabo; Abdullah, Rasedee; Mirghani, Mohamed Elwathig Saeed; Al-Qubaisi, Mothanna
2014-06-25
Waterlily Mango (Mangifera indica L.) is thought to be antioxidant-rich, conferred by its functional phytochemicals. The potential anticancer effects of the ethanolic kernel extract on breast cancer cells (MDA-MB-231 and MCF-7) using MTT, anti-proliferation, neutral red (NR) uptake and lactate dehydrogenase (LDH) release assays were evaluated. Cytological studies on the breast cancer cells were also conducted, and phytochemical analyses of the extract were carried out to determine the likely bioactive compounds responsible for such effects. Results showed the extract induced cytotoxicity in MDA-MB-231 cells and MCF-7 cells with IC50 values of 30 and 15 μg/mL, respectively. The extract showed significant toxicity towards both cell lines, with low toxicity to normal breast cells (MCF-10A). The cytotoxic effects on the cells were further confirmed by the NR uptake, antiproliferative and LDH release assays. Bioactive analyses revealed that many bioactives were present in the extract although butylated hydroxytoluene, a potent antioxidant, was the most abundant with 44.65%. M. indica extract appears to be more cytoxic to both estrogen positive and negative breast cancer cell lines than to normal breast cells. Synergistic effects of its antioxidant bioactives could have contributed to the cytotoxic effects of the extract. The extract of M. indica, therefore, has potential anticancer activity against breast cancer cells. This potential is worth studying further, and could have implications on future studies and eventually management of human breast cancers.
García-Rivera, Dagmar; Delgado, René; Bougarne, Nadia; Haegeman, Guy; Berghe, Wim Vanden
2011-06-01
Vimang is a standardized extract derived from Mango bark (Mangifera Indica L.), commonly used as anti-inflammatory phytomedicine, which has recently been used to complement cancer therapies in cancer patients. We have further investigated potential anti-tumour effects of glucosylxanthone mangiferin and indanone gallic acid, which are both present in Vimang extract. We observed significant anti-tumour effects of both Vimang constituents in the highly aggressive and metastatic breast cancer cell type MDA-MB231. At the molecular level, mangiferin and gallic acid both inhibit classical NFκB activation by IKKα/β kinases, which results in impaired IκB degradation, NFκB translocation and NFκB/DNA binding. In contrast to the xanthone mangiferin, gallic acid further inhibits additional NFκB pathways involved in cancer cell survival and therapy resistance, such as MEK1, JNK1/2, MSK1, and p90RSK. This results in combinatorial inhibition of NFκB activity by gallic acid, which results in potent inhibition of NFκB target genes involved in inflammation, metastasis, anti-apoptosis and angiogenesis, such as IL-6, IL-8, COX2, CXCR4, XIAP, bcl2, VEGF. The cumulative NFκB inhibition by gallic acid, but not mangiferin, is also reflected at the level of cell survival, which reveals significant tumour cytotoxic effects in MDA-MB231 cells. Altogether, we identify gallic acid, besides mangiferin, as an essential anti-cancer component in Vimang extract, which demonstrates multifocal inhibition of NFκB activity in the cancer-inflammation network. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
DEFF Research Database (Denmark)
Giha, Hayder A; Nasr, Amre; Iriemenam, Nnaemeka C
2010-01-01
The certainty of the protective role of acquired immunity in malaria is the major drive for malaria vaccine development. In this study, we measured the levels of total IgG and IgG subclasses to four candidate malaria vaccine antigens; MSP2-3D7, MSP2-FC27, AMA-1 and Pf332-C231, in plasma obtained ...
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
Roberti, Giovanni; Fiore, Rosalia; Franco, Claudia; Pimpinella, Giovanni; Piscioneri, Patrizia
2010-01-01
Healthcare organizations must implement organizational and management models of regulation and control systems for effectively preventing possible administrative torts by personnel. We define an organizational management and control model for healthcare organizations, based on the legal dispositions of Decree n.231/2001. The model identifies critical points in the administrative and healthcare services delivery processes that are at high-risk of violations to the code. Its primary aim is to prevent torts by the personnel and safeguard the organization at the same time.
International Nuclear Information System (INIS)
HAMMERS, J.S.
1999-01-01
The purpose of the test was to verify that the AN Tank Farm B Pit Leak Detector components are functionally integrated and operate in accordance with engineering design specifications. The Acceptance Test Procedure HNF-4646,241-AN-B-Pit Leak Detection ANB-WT-LDSTA-231 was conducted between 26 June and 02 July 1999 at the 200E AN Tank Farm. The test has been completed with no open test exceptions. The test was conducted prior to final engineering ''as built'' activities being completed this had no impact on the procedure or test results. All components, identified in the procedure were found to be labeled and identified as written in the procedure
Directory of Open Access Journals (Sweden)
Franciara Maria de Oliveira
2006-05-01
Full Text Available Resumo
Um perfil das estratégias de Responsabilidade Social Corporativa adotadas por empresas no Brasil é o objetivo
principal deste trabalho. Utilizou-se como universo de estudo os 231 Casos Concretos preenchidos
espontaneamente pelas empresas filiadas na página web do Instituto Ethos de Empresa e Responsabilidade
Social (Instituto Ethos. Os casos foram analisados pelo software alemão de análise de dados qualitativos
denominado Atlas.ti 5.0, sob o enfoque metodológico das seis variáveis adotadas por Kotler e Lee (2005 em
Corporate Social Responsability: doing the most good for your company and your cause, como estratégias para
alcançar-se a Responsabilidade Social Corporativa. As estratégias analisadas são: Marketing Social
Corporativo, Marketing de Causa Social, Patrocínio, Filantropia Estratégica, Voluntariado Corporativo e Ação
Social Responsável. Percebe-se que a maioria das empresas que divulgaram suas estratégias de
Responsabilidade Social ainda não tem a percepção plena da utilização dessas estratégias, haja vista que a
grande maioria ainda está classificada com Ação Social Responsável, vindo em seguida o Marketing Social
Corporativo, Filantropia Estratégica, Voluntariado Corporativo, Patrocínio e Marketing de Causa Social
Palavras-chave: Estratégias. Marketing. Responsabilidade Social Corporativa.
Abstract
A profile of the strategies of Corporate Social Responsibility adopted by companies in Brazil is the main objective
of this work. It was used as study universe the 231 Concrete Cases filled of spontaneous form for the
companies registered in the web page of the Ethos Institute of Company and Social Responsibility (Ethos
Institute. The cases had been analyzed by the German software of analysis of qualitative data called Atlas.ti
5.0, under the
Directory of Open Access Journals (Sweden)
Addila Abu Bakar
2018-03-01
Full Text Available Flavokawain B (1 is a natural chalcone extracted from the roots of Piper methysticum, and has been proven to be a potential cytotoxic compound. Using the partial structure of flavokawain B (FKB, about 23 analogs have been synthesized. Among them, compounds 8, 13 and 23 were found in new FKB derivatives. All compounds were evaluated for their cytotoxic properties against two breast cancer cell lines, MCF-7 and MDA-MB-231, thus establishing the structure–activity relationship. The FKB derivatives 16 (IC50 = 6.50 ± 0.40 and 4.12 ± 0.20 μg/mL, 15 (IC50 = 5.50 ± 0.35 and 6.50 ± 1.40 μg/mL and 13 (IC50 = 7.12 ± 0.80 and 4.04 ± 0.30 μg/mL exhibited potential cytotoxic effects on the MCF-7 and MDA-MB-231 cell lines. However, the methoxy group substituted in position three and four in compound 2 (IC50 = 8.90 ± 0.60 and 6.80 ± 0.35 μg/mL and 22 (IC50 = 8.80 ± 0.35 and 14.16 ± 1.10 μg/mL exhibited good cytotoxicity. The lead compound FKB (1 showed potential cytotoxicity (IC50 = 7.70 ± 0.30 and 5.90 ± 0.30 μg/mL against two proposed breast cancer cell lines. It is evident that the FKB skeleton is unique for anticancer agents, additionally, the presence of halogens (Cl and F in position 2 and 3 also improved the cytotoxicity in FKB series. These findings could help to improve the future drug discovery process to treat breast cancer. A molecular dynamics study of active compounds revealed stable interactions within the active site of Janus kinase. The structures of all compounds were determined by 1H-NMR, EI-MS, IR and UV and X-ray crystallographic spectroscopy techniques.
Directory of Open Access Journals (Sweden)
Rachit JAIN
2011-07-01
Full Text Available A Mobile Ad hoc NETwork is a kind of wireless ad-hoc network, and is a self configuring network of mobile routers connected by wireless links. Mobile Ad-Hoc Network (MANET is a wireless network without infrastructure. Self configurability and easy deployment feature of the MANET resulted in numerous applications in this modern era. Efficient routing protocols will make MANETs reliable. Various research communities are working in field of MANET and trying to adopt the protocols and technology in other applications as well. In this work, we present investigations on the behavior of various routing protocol of MANET with a Cost 231 Walfisch-Ikegami Propagation Model. We evaluate the performance of four different ad-hoc routing protocols on four performance metrics such as Average Jitter, Average End-to-End Delay, Throughput, and Packet Delivery Fraction with varying Pause Time. From the simulation results it is concluded that DSR is better in transmission of packets per unit time and maximum number of packets reached their destination successfully with some delays, i.e. PDF & Throughput is more and Average jitter & end-to-end delay is less. Whereas AODV & ZRP having almost same values in all of the performance metrics, they transmit packets with very less delay but transmits less packets to their destination as compare to DSR
Geophysical well logging operations and log analysis in Geothermal Well Desert Peak No. B-23-1
Energy Technology Data Exchange (ETDEWEB)
Sethi, D.K.; Fertl, W.H.
1980-03-01
Geothermal Well Desert Peak No. B-23-1 was logged by Dresser Atlas during April/May 1979 to a total depth of 2939 m (9642 ft). A temperature of 209/sup 0/C (408/sup 0/F) was observed on the maximum thermometer run with one of the logging tools. Borehole tools rated to a maximum temperature of 204.4/sup 0/C (400/sup 0/F) were utilized for logging except for the Densilog tool, which was from the other set of borehole instruments, rated to a still higher temperature, i.e., 260/sup 0/C (500/sup 0/F). The quality of the logs recorded and the environmental effects on the log response have been considered. The log response in the unusual lithologies of igneous and metamorphic formations encountered in this well could be correlated with the drill cutting data. An empirical, statistical log interpretation approach has made it possible to obtain meaningful information on the rocks penetrated. Various crossplots/histograms of the corrected log data have been generated on the computer. These are found to provide good resolution between the lithological units in the rock sequence. The crossplotting techniques and the statistical approach were combined with the drill cutting descriptions in order to arrive at the lithological characteristics. The results of log analysis and recommendations for logging of future wells have been included.
K. S., Uma Suganya; Govindaraju, K.; Ganesh Kumar, V.; Prabhu, D.; Arulvasu, C.; Stalin Dhas, T.; Karthick, V.; Changmai, Niranjan
2016-05-01
Breast cancer is a major complication in women and numerous approaches are being developed to overcome this problem. In conventional treatments such as chemotherapy and radiotherapy the post side effects cause an unsuitable effect in treatment of cancer. Hence, it is essential to develop a novel strategy for the treatment of this disease. In the present investigation, a possible route for green synthesis of gold nanoparticles (AuNPs) using leaf extract of Mimosa pudica and its anticancer efficacy in the treatment of breast cancer cell lines is studied. The synthesized nanoparticles were found to be effective in killing cancer cells (MDA-MB-231 & MCF-7) which were studied using various anticancer assays (MTT assay, cell morphology determination, cell cycle analysis, comet assay, Annexin V-FITC/PI staining and DAPI staining). Cell morphological analysis showed the changes occurred in cancer cells during the treatment with AuNPs. Cell cycle analysis revealed apoptosis in G0/G1 to S phase. Similarly in Comet assay, there was an increase in tail length in treated cells in comparison with the control. Annexin V-FITC/PI staining assay showed prompt fluorescence in treated cells indicating the translocation of phosphatidylserine from the inner membrane. PI and DAPI staining showed the DNA damage in treated cells.
Directory of Open Access Journals (Sweden)
Garraffo H Martin
2007-09-01
Full Text Available Abstract Background The 5,8-disubstituted indolizidines constitute the largest class of poison-frog alkaloids. Some alkaloids have been shown to act as noncompetitive blockers at nicotinic acetylcholine receptors but the proposed structures and the biological activities of most of the 5,8-disubstituted indolizidines have not been determined because of limited supplies of the natural products. We have therefore conducted experiments to confirm proposed structures and determine biological activities using synthetic compounds. Recently, we reported that one of this class of alkaloids, (--235B', acts as a noncompetitive antagonist for α4β2 nicotinic receptors, and its sensitivity is comparable to that of the classical competitive antagonist for this receptor, dihydro-β-erythroidine. Results The enantioselective syntheses of (--209B, (--231C, (--233D, (--235B", (--221I, and what proved to be an epimer of natural 193E, starting from common chiral lactams have been achieved. When we performed electrophysiological recordings to examine the effects of the synthetic alkaloids on two major subtypes of nicotinic receptors (α4β2 and α7 expressed in Xenopus laevis oocytes, (--231C effectively blocked α4β2 receptor responses (IC50 value, 1.5 μM with a 7.0-fold higher potency than for blockade of α7 receptor responses. In contrast, synthetic (--221I and (--epi-193E were more potent in blocking α7 receptor responses (IC50 value, 4.4 μM and 9.1 μM, respectively than α4β2 receptor responses (5.3-fold and 2.0-fold, respectively. Conclusion We achieved the total synthesis of (--209B, (--231C, (--233D, (--235B", (--221I, and an epimer of 193E starting from common chiral lactams, and the absolute stereochemistry of natural (--233D was determined. Furthermore, the relative stereochemistry of (--231C and (--221I was also determined. The present asymmetric synthesis of the proposed structure for 193E revealed that the C-8 configuration of natural 193E
Grover, Sandeep; Fishman, Gerald A; Stone, Edwin M
2004-10-01
To define ophthalmic findings in a family with autosomal dominant retinitis pigmentosa and a novel IMPDH1 gene mutation. Genetic and observational family study. Sixteen affected members of a family with autosomal dominant retinitis pigmentosa. Ophthalmic examination, including best-corrected visual acuity (VA), slit-lamp biomicroscopy, direct and indirect ophthalmoscopy, Goldmann kinetic perimetry, and electroretinography were performed. Deoxyribonucleic acid single-strand conformation polymorphism (SSCP) analysis was done. Abnormal polymerase chain reaction products identified by SSCP analysis were sequenced bidirectionally. All affected patients had the onset of night blindness within the first decade of life. Ocular findings were characterized by diffuse retinal pigmentary degenerative changes, marked restriction of peripheral visual fields, severe loss of VA, nondetectable electroretinography amplitudes, and a high frequency of posterior subcapsular lens opacities. Affected members were observed to harbor a novel IMPDH1 gene mutation. A novel IMPDH1 gene mutation (Arg231Pro) was associated with a severe form of autosomal dominant retinitis pigmentosa. Families affected with a severe form of this genetic subtype should be investigated for a mutation in the IMPDH1 gene.
Banerjee, Malabika; Chattopadhyay, Subrata; Choudhuri, Tathagata; Bera, Rammohan; Kumar, Sanjay; Chakraborty, Biswajit; Mukherjee, Samir Kumar
2016-04-16
Breast cancer is considered as an increasing major life-threatening concern among the malignancies encountered globally in females. Traditional therapy is far from satisfactory due to drug resistance and various side effects, thus a search for complementary/alternative medicines from natural sources with lesser side effects is being emphasized. Andrographis paniculata, an oriental, traditional medicinal herb commonly available in Asian countries, has a long history of treating a variety of diseases, such as respiratory infection, fever, bacterial dysentery, diarrhea, inflammation etc. Extracts of this plant showed a wide spectrum of therapeutic effects, such as anti-bacterial, anti-malarial, anti-viral and anti-carcinogenic properties. Andrographolide, a diterpenoid lactone, is the major active component of this plant. This study reports on andrographolide induced apoptosis and its possible mechanism in highly proliferative, invasive breast cancer cells, MDA-MB-231 lacking a functional p53 and estrogen receptor (ER). Furthermore, the pharmacokinetic properties of andrographolide have also been studied in mice following intravenous and oral administration. Andrographolide showed a time- and concentration- dependent inhibitory effect on MDA-MB-231 breast cancer cell proliferation, but the treatment did not affect normal breast epithelial cells, MCF-10A (>80 %). The number of cells in S as well as G2/M phase was increased after 36 h of treatment. Elevated reactive oxygen species (ROS) production with concomitant decrease in Mitochondrial Membrane Potential (MMP) and externalization of phosphatidyl serine were observed. Flow cytometry with Annexin V revealed that the population of apoptotic cells increased with prolonged exposure to andrographolide. Activation of caspase-3 and caspase-9 were also noted. Bax and Apaf-1 expression were notably increased with decreased Bcl-2 and Bcl-xL expression in andrographolide-treated cells. Pharmacokinetic study with andrographolide
Directory of Open Access Journals (Sweden)
Albert P Chen
Full Text Available Following radiation therapy (RT, tumor morphology may remain unchanged for days and sometimes weeks, rendering anatomical imaging methods inadequate for early detection of therapeutic response. Changes in the hyperpolarized [1-¹³C]lactate signals observed in vivo following injection of pre-polarized [1-¹³C]pyruvate has recently been shown to be a marker for tumor progression or early treatment response. In this study, the feasibility of using ¹³C metabolic imaging with [1-¹³C]pyruvate to detect early radiation treatment response in a breast cancer xenograft model was demonstrated in vivo and in vitro. Significant decreases in hyperpolarized [1-¹³C]lactate relative to [1-¹³C]pyruvate were observed in MDA-MB-231 tumors 96 hrs following a single dose of ionizing radiation. Histopathologic data from the treated tumors showed higher cellular apoptosis and senescence; and changes in the expression of membrane monocarboxylate transporters and lactate dehydrogenase B were also observed. Hyperpolarized ¹³C metabolic imaging may be a promising new tool to develop novel and adaptive therapeutic regimens for patients undergoing RT.
K2-231 b: A Sub-Neptune Exoplanet Transiting a Solar Twin in Ruprecht 147
Curtis, Jason Lee; Vanderburg, Andrew; Torres, Guillermo; Kraus, Adam L.; Huber, Daniel; Mann, Andrew W.; Rizzuto, Aaron C.; Isaacson, Howard; Howard, Andrew W.; Henze, Christopher E.; Fulton, Benjamin J.; Wright, Jason T.
2018-04-01
We identify a sub-Neptune exoplanet (R p = 2.5 ± 0.2 {R}\\oplus ) transiting a solar twin in the Ruprecht 147 star cluster (3 Gyr, 300 pc, [Fe/H] = +0.1 dex). The ∼81 day light curve for EPIC 219800881 (V = 12.71) from K2 Campaign 7 shows six transits with a period of 13.84 days, a depth of ∼0.06%, and a duration of ∼4 hr. Based on our analysis of high-resolution MIKE spectra, broadband optical and NIR photometry, the cluster parallax and interstellar reddening, and isochrone models from PARSEC, Dartmouth, and MIST, we estimate the following properties for the host star: M ⋆ = 1.01 ± 0.03 {M}ȯ , R ⋆ = 0.95 ± 0.03 {R}ȯ , and {T}{{eff}} = 5695 ± 50 K. This star appears to be single based on our modeling of the photometry, the low radial velocity (RV) variability measured over nearly 10 yr, and Keck/NIRC2 adaptive optics imaging and aperture-masking interferometry. Applying a probabilistic mass–radius relation, we estimate that the mass of this planet is M p = 7 + 5 – 3 {M}\\oplus , which would cause an RV semi-amplitude of K = 2 ± 1 {\\text{m s}}-1 that may be measurable with existing precise RV facilities. After statistically validating this planet with BLENDER, we now designate it K2-231b, making it the second substellar object to be discovered in Ruprecht 147 and the first planet; it joins the small but growing ranks of 22 other planets and three candidates found in open clusters.
Gurunathan, Sangiliyandi; Han, Jaewoong; Park, Jung Hyun; Kim, Jin Hoi
2014-01-01
Recently, graphene and graphene-related materials have attracted much attention due their unique properties, such as their physical, chemical, and biocompatibility properties. This study aimed to determine the cytotoxic effects of graphene oxide (GO) that is reduced biologically using Ganoderma spp. mushroom extracts in MDA-MB-231 human breast cancer cells. Herein, we describe a facile and green method for the reduction of GO using extracts of Ganoderma spp. as a reducing agent. GO was reduced without any hazardous chemicals in an aqueous solution, and the reduced GO was characterized using a range of analytical procedures. The Ganoderma extract (GE)-reduced GO (GE-rGO) was characterized by ultraviolet-visible absorption spectroscopy, X-ray diffraction, Fourier-transform infrared spectroscopy, X-ray photoelectron spectroscopy, dynamic light scattering, scanning electron microscopy, Raman spectroscopy, and atomic force microscopy. Furthermore, the toxicity of GE-rGO was evaluated using a sequence of assays such as cell viability, lactate dehydrogenase leakage, and reactive oxygen species generation in human breast cancer cells (MDA-MB-231). The preliminary characterization of reduction of GO was confirmed by the red-shifting of the absorption peak for GE-rGO to 265 nm from 230 nm. The size of GO and GE-rGO was found to be 1,880 and 3,200 nm, respectively. X-ray diffraction results confirmed that reduction processes of GO and the processes of removing intercalated water molecules and the oxide groups. The surface functionalities and chemical natures of GO and GE-rGO were confirmed using Fourier-transform infrared spectroscopy and X-ray photoelectron spectroscopy. The surface morphologies of the synthesized graphene were analyzed using high-resolution scanning electron microscopy. Raman spectroscopy revealed single- and multilayer properties of GE-rGO. Atomic force microscopy images provided evidence for the formation of graphene. Furthermore, the effect of GO and GE
Gurunathan, Sangiliyandi; Han, JaeWoong; Park, Jung Hyun; Kim, Jin Hoi
2014-01-01
Background Recently, graphene and graphene-related materials have attracted much attention due their unique properties, such as their physical, chemical, and biocompatibility properties. This study aimed to determine the cytotoxic effects of graphene oxide (GO) that is reduced biologically using Ganoderma spp. mushroom extracts in MDA-MB-231 human breast cancer cells. Methods Herein, we describe a facile and green method for the reduction of GO using extracts of Ganoderma spp. as a reducing agent. GO was reduced without any hazardous chemicals in an aqueous solution, and the reduced GO was characterized using a range of analytical procedures. The Ganoderma extract (GE)-reduced GO (GE-rGO) was characterized by ultraviolet-visible absorption spectroscopy, X-ray diffraction, Fourier-transform infrared spectroscopy, X-ray photoelectron spectroscopy, dynamic light scattering, scanning electron microscopy, Raman spectroscopy, and atomic force microscopy. Furthermore, the toxicity of GE-rGO was evaluated using a sequence of assays such as cell viability, lactate dehydrogenase leakage, and reactive oxygen species generation in human breast cancer cells (MDA-MB-231). Results The preliminary characterization of reduction of GO was confirmed by the red-shifting of the absorption peak for GE-rGO to 265 nm from 230 nm. The size of GO and GE-rGO was found to be 1,880 and 3,200 nm, respectively. X-ray diffraction results confirmed that reduction processes of GO and the processes of removing intercalated water molecules and the oxide groups. The surface functionalities and chemical natures of GO and GE-rGO were confirmed using Fourier-transform infrared spectroscopy and X-ray photoelectron spectroscopy. The surface morphologies of the synthesized graphene were analyzed using high-resolution scanning electron microscopy. Raman spectroscopy revealed single- and multilayer properties of GE-rGO. Atomic force microscopy images provided evidence for the formation of graphene
Itoga, Toshiro; Nakashima, Hiroshi; Sanami, Toshiya; Namito, Yoshihito; Kirihara, Yoichi; Miyamoto, Shuji; Takemoto, Akinori; Yamaguchi, Masashi; Asano, Yoshihiro
2017-09-01
Photo-neutron energy spectra for Eg=23.1 and 26.6 MeV mono-energetic photons on natC were measured using laser Compton scattering facility at NewSUBARU BL01. The photon energy spectra were evaluated through measurements and simulations with collimator sizes and arrangements for the laser electron photon. The neutron energy spectra for the natC(g,xn) reaction were measured at 60 degrees in horizontal and 90 degrees in horizontal and vertical with respect to incident photon. The spectra show almost isotropic angular distribution and flat energy distribution from detection threshold to upper limit defined by reaction Q-value.
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
Marinello, Poliana Camila; da Silva, Thamara Nishida Xavier; Panis, Carolina; Neves, Amanda Fouto; Machado, Kaliana Larissa; Borges, Fernando Henrique; Guarnier, Flávia Alessandra; Bernardes, Sara Santos; de-Freitas-Junior, Júlio Cesar Madureira; Morgado-Díaz, José Andrés; Luiz, Rodrigo Cabral; Cecchini, Rubens; Cecchini, Alessandra Lourenço
2016-04-01
The participation of oxidative stress in the mechanism of metformin action in breast cancer remains unclear. We investigated the effects of clinical (6 and 30 μM) and experimental concentrations of metformin (1000 and 5000 μM) in MCF-7 and in MDA-MB-231 cells, verifying cytotoxicity, oxidative stress, DNA damage, and intracellular pathways related to cell growth and survival after 24 h of drug exposure. Clinical concentrations of metformin decreased metabolic activity of MCF-7 cells in the MTT assay, which showed increased oxidative stress and DNA damage, although cell death and impairment in the proliferative capacity were observed only at higher concentrations. The reduction in metabolic activity and proliferation in MDA-MB-231 cells was present only at experimental concentrations after 24 h of drug exposition. Oxidative stress and DNA damage were induced in this cell line at experimental concentrations. The drug decreased cytoplasmic extracellular signal-regulated kinases 1 and 2 (ERK1/2) and AKT and increased nuclear p53 and cytoplasmic transforming growth factor β1 (TGF-β1) in both cell lines. These findings suggest that metformin reduces cell survival by increasing reactive oxygen species, which induce DNA damage and apoptosis. A relationship between the increase in TGF-β1 and p53 levels and the decrease in ERK1/2 and AKT was also observed. These findings suggest the mechanism of action of metformin in both breast cancer cell lineages, whereas cell line specific undergoes redox changes in the cells in which proliferation and survival signaling are modified. Taken together, these results highlight the potential clinical utility of metformin as an adjuvant during the treatment of luminal and triple-negative breast cancer.
Onono, Fredrick; Subramanian, Thangaiah; Sunkara, Manjula; Subramanian, Karunai Leela; Spielmann, H. Peter; Morris, Andrew J.
2013-01-01
Mammalian cells can use exogenous isoprenols to generate isoprenoid diphosphate substrates for protein isoprenylation, but the mechanism, efficiency, and biological importance of this process are not known. We developed mass spectrometry-based methods using chemical probes and newly synthesized stable isotope-labeled tracers to quantitate incorporation of exogenously provided farnesol, geranylgeraniol, and unnatural analogs of these isoprenols containing an aniline group into isoprenoid diphosphates and protein isoprenylcysteines by cultured human cancer cell lines. We found that at exogenous isoprenol concentrations >10 μm, this process can generate as much as 50% of the cellular isoprenoid diphosphate pool used for protein isoprenylation. Mutational activation of p53 in MDA-MB-231 breast cancer cells up-regulates the mevalonate pathway to promote tumor invasiveness. p53 silencing or pharmacological inhibition of HMG-CoA reductase in these cells decreases protein isoprenylation from endogenously synthesized isoprenoids but enhances the use of exogenous isoprenols for this purpose, indicating that this latter process is regulated independently of the mevalonate pathway. Our observations suggest unique opportunities for design of cancer cell-directed therapies and may provide insights into mechanisms underlying pleiotropic therapeutic benefits and unwanted side effects of mevalonate pathway inhibition. PMID:23908355
Directory of Open Access Journals (Sweden)
Guo-Sheng Wu
Full Text Available Cell adhesion, migration and invasion are critical steps for carcinogenesis and cancer metastasis. Ganoderma lucidum, also called Lingzhi in China, is a traditional Chinese medicine, which exhibits anti-proliferation, anti-inflammation and anti-metastasis properties. Herein, GAEE, G. lucidum extract mainly contains ganoderiol A (GA, dihydrogenated GA and GA isomer, was shown to inhibit the abilities of adhesion and migration, while have a slight influence on that of invasion in highly metastatic breast cancer MDA-MB-231 cells at non-toxic doses. Further investigation revealed that GAEE decreased the active forms of focal adhesion kinase (FAK and disrupted the interaction between FAK and SRC, which lead to deactivating of paxillin. Moreover, GAEE treatment downregulated the expressions of RhoA, Rac1, and Cdc42, and decreased the interaction between neural Wiskott-Aldrich Syndrome protein (N-WASP and Cdc42, which impair cell migration and actin assembly. To our knowledge, this is the first report to show that G.lucidum triterpenoids could suppress cell migration and adhesion through FAK-SRC-paxillin signaling pathway. Our study also suggests that GAEE may be a potential agent for treatment of breast cancer.
International Nuclear Information System (INIS)
Arnesen, R.B.; Benzon, E. von; Adamsen, S.; Svendsen, L.B.; Raaschou, H.O.; Hart Hansen, O.
2007-01-01
Background: Detection of colorectal tumors with computed tomography colonography (CTC) is an alternative to conventional colonoscopy (CC), and clarification of the diagnostic performance is essential for cost-effective use of both technologies. Purpose: To evaluate the diagnostic performance of CTC compared with CC. Material and Methods: 231 consecutive CTCs were performed prior to same-day scheduled CC. The radiologist and endoscopists were blinded to each other's findings. Patients underwent a polyethylene glycol bowel preparation, and were scanned in prone and supine positions using a single-detector helical CT scanner and commercially available software for image analysis. Findings were validated (matched) in an unblinded comparison with video-recordings of the CCs and re-CCs in cases of doubt. Results: For patients with polyps 5 mm and 10 mm, the sensitivity was 69% (95% CI 58-80%) and 81% (68-94%), and the specificity was 91% (84-98%) and 98% (93-100%), respectively. For detection of polyps 5 mm and 10 mm, the sensitivity was 66% (57-75%) and 77% (65-89%). A flat, elevated low-grade carcinoma was missed by CTC. One cancer relapse was missed by CC, and a cecal cancer was missed by an incomplete CC and follow-up double-contrast barium enema. Conclusion: CC was superior to CTC and should remain first choice for the diagnosis of colorectal polyps. However, for diagnosis of lesions 10 mm, CTC and CC should be considered as complementary methods
International Nuclear Information System (INIS)
Bela Kanyar; Katalin Eged; Tunde Katona; Gerhard Proehl; Ulla Bergstroem; Bengt Hallberg; Shelly Mobbs; Geert Olyslaegers; Theo Zeevaert; Palome Pinedo; Inmaculade Simon
2004-01-01
Radioactive wastes may contain both parent and daughter radionuclides. In some cases the transfer parameters of the daughter radio-elements differ significantly from that of the parent ones and therefore the dose contributions in the different pathways might be important to assess separately. The present work has compared 5 different site specific models by a scenario, using contaminated water for drinking and irrigation. Altogether 5 radionuclides from the investigated 10 ones contained radioactive daughter elements. In general, for long term studies in biosphere the steady-state formulations of processes are adequate to assess the contamination, except the infiltration into the deeper soil and sediment layers. According to the results of the modelling and computer simulations, the following daughters are to be assessed separately from their parents with respect to the radiation impact: for parent 231 Pa the daughter 227 Ac, for parent 226 Ra the daughters 222 Rn, 210 Pb and 210 Po and for parent 237 Np the daughter 233 Pa. The dose contributions of the daughters from parents 238 U and 239 Pu are less significant during the considered 100-10000 years. In case of contamination of irrigation water with 1 Bq x m -3 of the parent radionuclide 231 Pa, more than 90% of the external dose from soil exposure comes from the daughter 227 Ac (annually 15 nSv). By a similar contamination with 226 Ra as a parent radionuclide, 60% of the ingestion dose is due to food contamination with the daughters 210 Pb and 210 Po (approximately 150 nSv x a -1 ). (author)
Energy Technology Data Exchange (ETDEWEB)
Tsai, I-Lin [Department of Pharmacy, National Taiwan University, No. 1, Jen-Ai Road, Section 1 Taipei 10051, Taiwan (China); The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Center for Genomic Medicine, National Taiwan University, Taipei 10051, Taiwan (China); Kuo, Tien-Chueh [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Graduate Institute of Biomedical Electronic and Bioinformatics, National Taiwan University, Room 410 BL Building, No. 1, Roosevelt Road, Sec. 4, Taipei 106, Taiwan (China); Ho, Tsung-Jung [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Department of Computer Science and Information Engineering, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China); Harn, Yeu-Chern [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Graduate Institute of Networking and Multimedia, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China); Wang, San-Yuan [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Department of Computer Science and Information Engineering, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China); Fu, Wen-Mei [Department of Pharmacology, National Taiwan University, 11 F No. 1 Sec. 1, Ren-ai Rd., Taipei 10051, Taiwan (China); Kuo, Ching-Hua, E-mail: kuoch@ntu.edu.tw [Department of Pharmacy, National Taiwan University, No. 1, Jen-Ai Road, Section 1 Taipei 10051, Taiwan (China); The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Center for Genomic Medicine, National Taiwan University, Taipei 10051, Taiwan (China); Tseng, Yufeng Jane, E-mail: kuoch@ntu.edu.tw [Department of Pharmacy, National Taiwan University, No. 1, Jen-Ai Road, Section 1 Taipei 10051, Taiwan (China); The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Center for Genomic Medicine, National Taiwan University, Taipei 10051, Taiwan (China); Graduate Institute of Biomedical Electronic and Bioinformatics, National Taiwan University, Room 410 BL Building, No. 1, Roosevelt Road, Sec. 4, Taipei 106, Taiwan (China); Department of Computer Science and Information Engineering, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China)
2013-05-03
Hypoxia affects the tumor microenvironment and is considered important to metastasis progression and therapy resistance. Thus far, the majority of global analyses of tumor hypoxia responses have been limited to just a single omics level. Combining multiple omics data can broaden our understanding of tumor hypoxia. Here, we investigate the temporal change of the metabolite composition with gene expression data from literature to provide a more comprehensive insight into the system level in response to hypoxia. Nuclear magnetic resonance spectroscopy was used to perform metabolomic profiling on the MDA-MB-231 breast cancer cell line under hypoxic conditions. Multivariate statistical analysis revealed that the metabolic difference between hypoxia and normoxia was similar over 24 h, but became distinct over 48 h. Time dependent microarray data from the same cell line in the literature displayed different gene expressions under hypoxic and normoxic conditions mostly at 12 h or earlier. The direct metabolomic profiles show a large overlap with theoretical metabolic profiles deduced from previous transcriptomic studies. Consistent pathways are glycolysis/gluconeogenesis, pyruvate, purine and arginine and proline metabolism. Ten metabolic pathways revealed by metabolomics were not covered by the downstream of the known transcriptomic profiles, suggesting new metabolic phenotypes. These results confirm previous transcriptomics understanding and expand the knowledge from existing models on correlation and co-regulation between transcriptomic and metabolomics profiles, which demonstrates the power of integrated omics analysis.
International Nuclear Information System (INIS)
Tsai, I-Lin; Kuo, Tien-Chueh; Ho, Tsung-Jung; Harn, Yeu-Chern; Wang, San-Yuan; Fu, Wen-Mei; Kuo, Ching-Hua; Tseng, Yufeng Jane
2013-01-01
Hypoxia affects the tumor microenvironment and is considered important to metastasis progression and therapy resistance. Thus far, the majority of global analyses of tumor hypoxia responses have been limited to just a single omics level. Combining multiple omics data can broaden our understanding of tumor hypoxia. Here, we investigate the temporal change of the metabolite composition with gene expression data from literature to provide a more comprehensive insight into the system level in response to hypoxia. Nuclear magnetic resonance spectroscopy was used to perform metabolomic profiling on the MDA-MB-231 breast cancer cell line under hypoxic conditions. Multivariate statistical analysis revealed that the metabolic difference between hypoxia and normoxia was similar over 24 h, but became distinct over 48 h. Time dependent microarray data from the same cell line in the literature displayed different gene expressions under hypoxic and normoxic conditions mostly at 12 h or earlier. The direct metabolomic profiles show a large overlap with theoretical metabolic profiles deduced from previous transcriptomic studies. Consistent pathways are glycolysis/gluconeogenesis, pyruvate, purine and arginine and proline metabolism. Ten metabolic pathways revealed by metabolomics were not covered by the downstream of the known transcriptomic profiles, suggesting new metabolic phenotypes. These results confirm previous transcriptomics understanding and expand the knowledge from existing models on correlation and co-regulation between transcriptomic and metabolomics profiles, which demonstrates the power of integrated omics analysis
Directory of Open Access Journals (Sweden)
Franciara Maria de Oliveira
2006-05-01
Full Text Available ResumoUm perfil das estratégias de Responsabilidade Social Corporativa adotadas por empresas no Brasil é o objetivoprincipal deste trabalho. Utilizou-se como universo de estudo os 231 Casos Concretos preenchidosespontaneamente pelas empresas filiadas na página web do Instituto Ethos de Empresa e ResponsabilidadeSocial (Instituto Ethos. Os casos foram analisados pelo software alemão de análise de dados qualitativosdenominado Atlas.ti 5.0, sob o enfoque metodológico das seis variáveis adotadas por Kotler e Lee (2005 emCorporate Social Responsability: doing the most good for your company and your cause, como estratégias paraalcançar-se a Responsabilidade Social Corporativa. As estratégias analisadas são: Marketing SocialCorporativo, Marketing de Causa Social, Patrocínio, Filantropia Estratégica, Voluntariado Corporativo e AçãoSocial Responsável. Percebe-se que a maioria das empresas que divulgaram suas estratégias deResponsabilidade Social ainda não tem a percepção plena da utilização dessas estratégias, haja vista que agrande maioria ainda está classificada com Ação Social Responsável, vindo em seguida o Marketing SocialCorporativo, Filantropia Estratégica, Voluntariado Corporativo, Patrocínio e Marketing de Causa SocialPalavras-chave: Estratégias. Marketing. Responsabilidade Social Corporativa.AbstractA profile of the strategies of Corporate Social Responsibility adopted by companies in Brazil is the main objectiveof this work. It was used as study universe the 231 Concrete Cases filled of spontaneous form for thecompanies registered in the web page of the Ethos Institute of Company and Social Responsibility (EthosInstitute. The cases had been analyzed by the German software of analysis of qualitative data called Atlas.ti5.0, under the methodical approach of the six variable adopted for Kotler and Lee (2005 in Corporate SocialResponsability: doing the most good for your company and your cause, as strategies to reach
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
Xia, Ling; Huang, Rong; Li, Yinta; Song, Shaoxian
2017-01-01
The effects of growth phase on the lipid content and surface properties of oleaginous microalgae Botryococcus sp. FACGB-762, Chlorella sp. XJ-445 and Desmodesmus bijugatus XJ-231 were investigated in this study. The results showed that throughout the growth phases, the lipid content of microalgae increased. The surface properties like particle size, the degree of hydrophobicity, and the total concentration of functional groups increased while net surface zeta potential decreased. The results suggested that the growth stage had significant influence not only on the lipid content but also on the surface characteristics. Moreover, the lipid content was significantly positively related to the concentration of hydroxyl functional groups in spite of algal strains or growth phases. These results provided a basis for further studies on the refinery process using oleaginous microalgae for biofuel production.
Half-megasecond Chandra spectral imaging of the hot circumgalactic nebula around quasar MRK 231
International Nuclear Information System (INIS)
Veilleux, S.; Teng, S. H.; Rupke, D. S. N.; Maiolino, R.; Sturm, E.
2014-01-01
A deep 400 ks ACIS-S observation of the nearest quasar known, Mrk 231, is combined with archival 120 ks data to carry out the first ever spatially resolved spectral analysis of a hot X-ray-emitting circumgalactic nebula around a quasar. The 65 × 50 kpc X-ray nebula shares no resemblance with the tidal debris seen at optical wavelengths. One notable exception is the small tidal arc ∼3.5 kpc south of the nucleus where excess soft X-ray continuum emission and Si XIII 1.8 keV line emission are detected, consistent with star formation and its associated alpha-element enhancement, respectively. An X-ray shadow is also detected at the location of the 15 kpc northern tidal tail. The hard X-ray continuum emission within ∼6 kpc of the center is consistent with being due entirely to the bright central active galactic nucleus. The soft X-ray spectrum of the outer (≳6 kpc) portion of the nebula is best described as the sum of two thermal components with temperatures ∼3 and ∼8 million K and spatially uniform super-solar alpha-element abundances, relative to iron. This result implies enhanced star formation activity over ∼10 8 yr, accompanied by redistribution of the metals on a large scale. The low-temperature thermal component is not present within ∼6 kpc of the nucleus, suggesting extra heating in this region from the circumnuclear starburst, the central quasar, or the optically identified ≳3 kpc quasar-driven outflow. The soft X-ray emission is weaker in the western quadrant, coincident with a deficit of Hα and some of the largest columns of neutral gas outflowing from the nucleus. Shocks may heat the gas to high temperatures at this location, consistent with the tentative ∼2σ detection of extended Fe XXV 6.7 keV line emission.
Directory of Open Access Journals (Sweden)
Itoga Toshiro
2017-01-01
Full Text Available Photo-neutron energy spectra for Eg=23.1 and 26.6 MeV mono-energetic photons on natC were measured using laser Compton scattering facility at NewSUBARU BL01. The photon energy spectra were evaluated through measurements and simulations with collimator sizes and arrangements for the laser electron photon. The neutron energy spectra for the natC(g,xn reaction were measured at 60 degrees in horizontal and 90 degrees in horizontal and vertical with respect to incident photon. The spectra show almost isotropic angular distribution and flat energy distribution from detection threshold to upper limit defined by reaction Q-value.
Directory of Open Access Journals (Sweden)
Yerly Vargas Casanova
2017-09-01
Full Text Available Linear, dimeric, tetrameric, and cyclic peptides derived from lactoferricin B, containing the RRWQWR motif, were designed, synthesized, purified, and characterized using RP-HPLC chromatography and MALDI-TOF mass spectrometry. The antibacterial activity of the designed peptides against E. coli (ATCC 11775 and 25922 and their cytotoxic effect against MDA-MB-468 and MDA-MB-231 breast cancer cell lines were evaluated. Dimeric and tetrameric peptides showed higher antibacterial activity in both bacteria strains than linear peptides. The dimeric peptide (RRWQWR2K-Ahx exhibited the highest antibacterial activity against the tested bacterial strains. Furthermore, the peptides with high antibacterial activity exhibited significant cytotoxic effect against the tested breast cancer cell lines. This cytotoxic effect was fast and dependent on the peptide concentration. The tetrameric molecule containing RRWQWR motif has an optimal cytotoxic effect at a concentration of 22 µM. The evaluated dimeric and tetrameric peptides could be considered as candidates for developing new therapeutic agents against breast cancer. Polyvalence of linear sequences could be considered as a novel and versatile strategy for obtaining molecules with high anticancer activity.
Vargas Casanova, Yerly; Rodríguez Guerra, Jorge Antonio; Umaña Pérez, Yadi Adriana; Leal Castro, Aura Lucía; Almanzar Reina, Giovanni; García Castañeda, Javier Eduardo; Rivera Monroy, Zuly Jenny
2017-09-29
Linear, dimeric, tetrameric, and cyclic peptides derived from lactoferricin B, containing the RRWQWR motif, were designed, synthesized, purified, and characterized using RP-HPLC chromatography and MALDI-TOF mass spectrometry. The antibacterial activity of the designed peptides against E. coli (ATCC 11775 and 25922) and their cytotoxic effect against MDA-MB-468 and MDA-MB-231 breast cancer cell lines were evaluated. Dimeric and tetrameric peptides showed higher antibacterial activity in both bacteria strains than linear peptides. The dimeric peptide (RRWQWR)₂K-Ahx exhibited the highest antibacterial activity against the tested bacterial strains. Furthermore, the peptides with high antibacterial activity exhibited significant cytotoxic effect against the tested breast cancer cell lines. This cytotoxic effect was fast and dependent on the peptide concentration. The tetrameric molecule containing RRWQWR motif has an optimal cytotoxic effect at a concentration of 22 µM. The evaluated dimeric and tetrameric peptides could be considered as candidates for developing new therapeutic agents against breast cancer. Polyvalence of linear sequences could be considered as a novel and versatile strategy for obtaining molecules with high anticancer activity.
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
Energy Technology Data Exchange (ETDEWEB)
Curry, Merril C.; Peters, Amelia A. [School of Pharmacy, The University of Queensland, Brisbane, Queensland 4072 (Australia); Kenny, Paraic A. [Department of Developmental and Molecular Biology, Albert Einstein College of Medicine, Bronx, New York 10461 (United States); Roberts-Thomson, Sarah J. [School of Pharmacy, The University of Queensland, Brisbane, Queensland 4072 (Australia); Monteith, Gregory R., E-mail: gregm@uq.edu.au [School of Pharmacy, The University of Queensland, Brisbane, Queensland 4072 (Australia)
2013-05-10
Highlights: •Some clinical breast cancers are associated with MCU overexpression. •MCU silencing did not alter cell death initiated with the Bcl-2 inhibitor ABT-263. •MCU silencing potentiated caspase-independent cell death initiated by ionomycin. •MCU silencing promoted ionomycin-mediated cell death without changes in bulk Ca{sup 2+}. -- Abstract: The mitochondrial calcium uniporter (MCU) transports free ionic Ca{sup 2+} into the mitochondrial matrix. We assessed MCU expression in clinical breast cancer samples using microarray analysis and the consequences of MCU silencing in a breast cancer cell line. Our results indicate that estrogen receptor negative and basal-like breast cancers are characterized by elevated levels of MCU. Silencing of MCU expression in the basal-like MDA-MB-231 breast cancer cell line produced no change in proliferation or cell viability. However, distinct consequences of MCU silencing were seen on cell death pathways. Caspase-dependent cell death initiated by the Bcl-2 inhibitor ABT-263 was not altered by MCU silencing; whereas caspase-independent cell death induced by the calcium ionophore ionomycin was potentiated by MCU silencing. Measurement of cytosolic Ca{sup 2+} levels showed that the promotion of ionomycin-induced cell death by MCU silencing occurs independently of changes in bulk cytosolic Ca{sup 2+} levels. This study demonstrates that MCU overexpression is a feature of some breast cancers and that MCU overexpression may offer a survival advantage against some cell death pathways. MCU inhibitors may be a strategy to increase the effectiveness of therapies that act through the induction of caspase-independent cell death pathways in estrogen receptor negative and basal-like breast cancers.
Aghaei, Mahmoud; Yazdiniapour, Zeinab; Ghanadian, Mustafa; Zolfaghari, Behzad; Lanzotti, Virginia; Mirsafaee, Vahid
2016-11-01
From the aerial parts of Euphorbia sogdiana Popov, obtusifoliol (1) and two related steroids (2-3) have been isolated and characterized along with a known cycloartane derivative (4). The chemical structure of the obtusifoliol-related compounds, obtained by 1D and 2D NMR, and MS measurements, have been determined as: 3β,7α-dihydroxy-4α,14α-dimethyl-5α-ergosta-8,24(28)-diene-11-one (2) and 3β-hydroxy-4α,14α-dimethyl-5α-ergosta-8,24(28)-diene-1-one (3). Compound 2 has been previously isolated from Euphorbia chamaesyce while compound 3 was never reported before. The isolated compounds 1-4 were subjected to cytotoxic tests on the breast cancer cells, MCF-7 and MDA-MB231. Further pharmacological tests on the more active compounds 2 and 3 indicated their action to be related to cell growth inhibitory activity and apoptotic effects on the tested cells. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Yufeng Jane Tseng
2013-05-01
Full Text Available Hypoxia affects the tumor microenvironment and is considered important to metastasis progression and therapy resistance. Thus far, the majority of global analyses of tumor hypoxia responses have been limited to just a single omics level. Combining multiple omics data can broaden our understanding of tumor hypoxia. Here, we investigate the temporal change of the metabolite composition with gene expression data from literature to provide a more comprehensive insight into the system level in response to hypoxia. Nuclear magnetic resonance spectroscopy was used to perform metabolomic profiling on the MDA-MB-231 breast cancer cell line under hypoxic conditions. Multivariate statistical analysis revealed that the metabolic difference between hypoxia and normoxia was similar over 24 h, but became distinct over 48 h. Time dependent microarray data from the same cell line in the literature displayed different gene expressions under hypoxic and normoxic conditions mostly at 12 h or earlier. The direct metabolomic profiles show a large overlap with theoretical metabolic profiles deduced from previous transcriptomic studies. Consistent pathways are glycolysis/gluconeogenesis, pyruvate, purine and arginine and proline metabolism. Ten metabolic pathways revealed by metabolomics were not covered by the downstream of the known transcriptomic profiles, suggesting new metabolic phenotypes. These results confirm previous transcriptomics understanding and expand the knowledge from existing models on correlation and co-regulation between transcriptomic and metabolomics profiles, which demonstrates the power of integrated omics analysis.
Energy Technology Data Exchange (ETDEWEB)
Nair, Madhumathy G.; Desai, Krisha; Prabhu, Jyothi S.; Hari, P.S.; Remacle, Jose; Sridhar, T.S., E-mail: tssridhar@sjri.res.in
2016-08-01
Resistance to anthracycline based chemotherapy is a major limitation in the treatment of breast cancer, particularly of the triple negative sub-type that lacks targeted therapies. Resistance that arises from tumor-stromal interaction facilitated by integrins provides the possibility of targeted disruption. In the present study, we demonstrate that integrin β3 signaling inhibits apoptosis induced by a DNA-damaging chemotherapeutic agent, epirubicin, in MDA-MB-231 breast cancer cells. Drug efflux based mechanisms do not contribute to this effect. We show that integrin β3 employs the PI3K-Akt and the MAPK pathway for enabling cell survival and proliferation. Further, our results indicate that integrin β3 helps inhibit epirubicin induced cytotoxicity by repression of the pro-apoptotic protein BAD, thus promoting an anti-apoptotic response. Myristoylated RGT peptide and a monoclonal antibody against integrin β3 brought about a reversal of this effect and chemosensitized the cells. These results identify β3 integrin signaling via repression of BAD as an important survival pathway used by breast cancer cells to evade chemotherapy induced stress. - Highlights: • Integrin β3 signaling promotes chemoresistance to epirubicin in breast cancer cells. • Integrin β3 promotes cell survival and proliferation in drug treated cells through the PI3K and MAPK pathways. • Integrin signaling helps evade drug induced cytotoxicity by repression of pro-apoptotic molecule; BAD.
Directory of Open Access Journals (Sweden)
Anantha Koteswararao Kanugula
Full Text Available Statins are increasingly being recognized as anti-cancer agents against various cancers including breast cancer. To understand the molecular pathways targeted by fluvastatin and its differential sensitivity against metastatic breast cancer cells, we analyzed protein alterations in MDA-MB-231 cells treated with fluvastatin using 2-DE in combination with LC-MS/MS. Results revealed dys-regulation of 39 protein spots corresponding to 35 different proteins. To determine the relevance of altered protein profiles with breast cancer cell death, we mapped these proteins to major pathways involved in the regulation of cell-to-cell signaling and interaction, cell cycle, Rho GDI and proteasomal pathways using IPA analysis. Highly interconnected sub networks showed that vimentin and ERK1/2 proteins play a central role in controlling the expression of altered proteins. Fluvastatin treatment caused proteolysis of vimentin, a marker of epithelial to mesenchymal transition. This effect of fluvastatin was reversed in the presence of mevalonate, a downstream product of HMG-CoA and caspase-3 inhibitor. Interestingly, fluvastatin neither caused an appreciable cell death nor did modulate vimentin expression in normal mammary epithelial cells. In conclusion, fluvastatin alters levels of cytoskeletal proteins, primarily targeting vimentin through increased caspase-3- mediated proteolysis, thereby suggesting a role for vimentin in statin-induced breast cancer cell death.
Directory of Open Access Journals (Sweden)
Gurunathan S
2014-04-01
Full Text Available Sangiliyandi Gurunathan,1,2 JaeWoong Han,1 Jung Hyun Park,1 Jin Hoi Kim1 1Department of Animal Biotechnology, Konkuk University, Seoul, South Korea; 2GS Institute of Bio and Nanotechnology, Coimbatore, Tamilnadu, India Background: Recently, graphene and graphene-related materials have attracted much attention due their unique properties, such as their physical, chemical, and biocompatibility properties. This study aimed to determine the cytotoxic effects of graphene oxide (GO that is reduced biologically using Ganoderma spp. mushroom extracts in MDA-MB-231 human breast cancer cells. Methods: Herein, we describe a facile and green method for the reduction of GO using extracts of Ganoderma spp. as a reducing agent. GO was reduced without any hazardous chemicals in an aqueous solution, and the reduced GO was characterized using a range of analytical procedures. The Ganoderma extract (GE-reduced GO (GE-rGO was characterized by ultraviolet-visible absorption spectroscopy, X-ray diffraction, Fourier-transform infrared spectroscopy, X-ray photoelectron spectroscopy, dynamic light scattering, scanning electron microscopy, Raman spectroscopy, and atomic force microscopy. Furthermore, the toxicity of GE-rGO was evaluated using a sequence of assays such as cell viability, lactate dehydrogenase leakage, and reactive oxygen species generation in human breast cancer cells (MDA-MB-231. Results: The preliminary characterization of reduction of GO was confirmed by the red-shifting of the absorption peak for GE-rGO to 265 nm from 230 nm. The size of GO and GE-rGO was found to be 1,880 and 3,200 nm, respectively. X-ray diffraction results confirmed that reduction processes of GO and the processes of removing intercalated water molecules and the oxide groups. The surface functionalities and chemical natures of GO and GE-rGO were confirmed using Fourier-transform infrared spectroscopy and X-ray photoelectron spectroscopy. The surface morphologies of the synthesized
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
Riemer, Friederike; Kuehner, Kirsten A; Ritz, Susanne; Sauter-Louis, Carola; Hartmann, Katrin
2016-04-01
The objectives of this study were to review signalment, clinical signs and laboratory features in a large number of naturally occurring cases of feline infectious peritonitis (FIP), and to evaluate potential changes in diagnostic criteria for FIP and compare findings in cats with and without effusion. The medical records of 231 cats with confirmed FIP that presented to the Clinic of Small Animal Medicine of the Ludwig-Maximilian University of Munich, Germany, were reviewed for signalment, history, and clinical and laboratory parameters. Age, sex and breed distribution of the cats were compared with the clinic population. Male sex and young age were significantly correlated with FIP. Neutering status was not associated with FIP. No breed predisposition was observed and the majority of cats presented were domestic shorthair and mixed breed. Microcytosis of peripheral erythrocytes was found in 35.1% of cats, of which 42.4% did not have concurrent anaemia. Band neutrophilia was documented in 44.3% (81/183), of which 35.8% did not have mature neutrophilia. Lymphopenia, observed significantly more often with effusion, was documented in only 26.8% of cats without effusion. Hyperbilirubinaemia also occurred significantly more often in cats with vs without effusion. While serum total protein was increased in only 17.5% of cats, hyperglobulinaemia was documented in 89.1%. Nearly 85.0% of cats had an albumin-to-globulin (A:G) ratio peritonitis. Globulins and A:G ratio were of higher diagnostic value than hyperproteinaemia. © ISFM and AAFP 2015.
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
Directory of Open Access Journals (Sweden)
Weihua Meng
2015-10-01
Full Text Available Neuropathic pain is defined as pain arising as a direct consequence of a lesion or a disease affecting the somatosensory system and it affects around 1 in 4 diabetic patients in the UK. The purpose of this genome-wide association study (GWAS was to identify genetic contributors to this disorder. Cases of neuropathic pain were defined as diabetic patients with a multiple prescription history of at least one of five drugs specifically indicated for the treatment of neuropathic pain. Controls were diabetic individuals who were not prescribed any of these drugs, nor amitriptyline, carbamazepine, or nortriptyline. Overall, 961 diabetic neuropathic pain cases and 3260 diabetic controls in the Genetics of Diabetes Audit and Research Tayside (GoDARTS cohort were identified. We found a cluster in the Chr1p35.1 (ZSCAN20-TLR12P with a lowest P value of 2.74 × 10−7 at rs71647933 in females and a cluster in the Chr8p23.1, next to HMGB1P46 with a lowest P value of 8.02 × 10−7 at rs6986153 in males. Sex-specific narrow sense heritability was higher in males (30.0% than in females (14.7%. This GWAS on diabetic neuropathic pain provides evidence for the sex-specific involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 with the disorder, indicating the need for further research.
Chen, Ying-Jung; Lee, Yuan-Chin; Huang, Chia-Hui; Chang, Long-Sen
2016-11-01
Triple-negative breast cancers (TNBCs) are highly invasive and have a higher rate of distant metastasis. Matrix metalloproteinase-9 (MMP-9) plays a crucial role in EGF/EGFR-mediated malignant progression and metastasis of TNBCs. Various studies have revealed that treatment with gallic acid down-regulates MMP-9 expression in cancer cells, and that conjugation of phytochemical compounds with gold nanoparticles (AuNPs) increases the anti-tumor activity of the phytochemical compounds. Thus, the effect of gallic acid-capped AuNPs (GA-AuNPs) on MMP-9 expression in EGF-treated TNBC MDA-MB-231 cells was analyzed in the present study. The so-called green synthesis of AuNPs by means of gallic acid was performed at pH10, and the resulting GA-AuNPs had spherical shape with an average diameter of approximately 50nm. GA-AuNPs notably suppressed migration and invasion of EGF-treated cells, and inhibited EGF-induced MMP-9 up-regulation. GA-AuNPs abrogated EGF-induced Akt/p65 and ERK/c-Jun phosphorylation, leading to down-regulation of MMP-9 mRNA and protein expression in EGF-treated cells. Meanwhile, EGF-induced p300 stabilization was found to be involved in MMP-9 expression, whereas GA-AuNPs inhibited the EGF-promoted stability of the p300 protein. Although GA-AuNPs and gallic acid suppressed EGF-induced MMP-9 up-regulation via the same signaling pathway, the effective concentration of gallic acid was approximately 100-fold higher than that of GA-AuNPs for inhibition of MMP-9 expression in EGF-treated cells to a similar extent. Collectively, our data indicate that, in comparison with gallic acid, GA-AuNPs have a superior ability to inhibit EGF/EGFR-mediated MMP-9 expression in TNBC MDA-MB-231 cells. Our findings also point to a way to improve the anti-tumor activity of gallic acid. Copyright © 2016 Elsevier Inc. All rights reserved.
Ivshina, Irina; Kostina, Ludmila; Krivoruchko, Anastasiya; Kuyukina, Maria; Peshkur, Tatyana; Anderson, Peter; Cunningham, Colin
2016-07-15
Removal of polycyclic aromatic hydrocarbons (PAHs) in soil using biosurfactants (BS) produced by Rhodococcus ruber IEGM 231 was studied in soil columns spiked with model mixtures of major petroleum constituents. A crystalline mixture of single PAHs (0.63g/kg), a crystalline mixture of PAHs (0.63g/kg) and polycyclic aromatic sulfur heterocycles (PASHs), and an artificially synthesized non-aqueous phase liquid (NAPL) containing PAHs (3.00g/kg) dissolved in alkanes C10-C19 were used for spiking. Percentage of PAH removal with BS varied from 16 to 69%. Washing activities of BS were 2.5 times greater than those of synthetic surfactant Tween 60 in NAPL-spiked soil and similar to Tween 60 in crystalline-spiked soil. At the same time, amounts of removed PAHs were equal and consisted of 0.3-0.5g/kg dry soil regardless the chemical pattern of a model mixture of petroleum hydrocarbons and heterocycles used for spiking. UV spectra for soil before and after BS treatment were obtained and their applicability for differentiated analysis of PAH and PASH concentration changes in remediated soil was shown. The ratios A254nm/A288nm revealed that BS increased biotreatability of PAH-contaminated soils. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Sacha Sorrentino
Full Text Available The pathological form of prion protein (PrP(Sc, as other amyloidogenic proteins, causes a marked increase of membrane permeability. PrP(Sc extracted from infected Syrian hamster brains induces a considerable change in membrane ionic conductance, although the contribution of this interaction to the molecular mechanism of neurodegeneration process is still controversial. We previously showed that the human PrP fragment 90-231 (hPrP₉₀₋₂₃₁ increases ionic conductance across artificial lipid bilayer, in a calcium-dependent manner, producing an alteration similar to that observed for PrP(Sc. In the present study we demonstrate that hPrP₉₀₋₂₃₁, pre-incubated with 10 mM Ca⁺⁺ and then re-suspended in physiological external solution increases not only membrane conductance but neurotoxicity as well. Furthermore we show the existence of a direct link between these two effects as demonstrated by a highly statistically significant correlation in several experimental conditions. A similar correlation between increased membrane conductance and cell degeneration has been observed assaying hPrP₉₀₋₂₃₁ bearing pathogenic mutations (D202N and E200K. We also report that Ca⁺⁺ binding to hPrP₉₀₋₂₃₁ induces a conformational change based on an alteration of secondary structure characterized by loss of alpha-helix content causing hydrophobic amino acid exposure and proteinase K resistance. These features, either acquired after controlled thermal denaturation or induced by D202N and E200K mutations were previously identified as responsible for hPrP₉₀₋₂₃₁ cytotoxicity. Finally, by in silico structural analysis, we propose that Ca⁺⁺ binding to hPrP₉₀₋₂₃₁ modifies amino acid orientation, in the same way induced by E200K mutation, thus suggesting a pathway for the structural alterations responsible of PrP neurotoxicity.
International Nuclear Information System (INIS)
Chen, Ying-Jung; Lee, Yuan-Chin; Huang, Chia-Hui; Chang, Long-Sen
2016-01-01
Triple-negative breast cancers (TNBCs) are highly invasive and have a higher rate of distant metastasis. Matrix metalloproteinase-9 (MMP-9) plays a crucial role in EGF/EGFR-mediated malignant progression and metastasis of TNBCs. Various studies have revealed that treatment with gallic acid down-regulates MMP-9 expression in cancer cells, and that conjugation of phytochemical compounds with gold nanoparticles (AuNPs) increases the anti-tumor activity of the phytochemical compounds. Thus, the effect of gallic acid-capped AuNPs (GA-AuNPs) on MMP-9 expression in EGF-treated TNBC MDA-MB-231 cells was analyzed in the present study. The so-called green synthesis of AuNPs by means of gallic acid was performed at pH 10, and the resulting GA-AuNPs had spherical shape with an average diameter of approximately 50 nm. GA-AuNPs notably suppressed migration and invasion of EGF-treated cells, and inhibited EGF-induced MMP-9 up-regulation. GA-AuNPs abrogated EGF-induced Akt/p65 and ERK/c-Jun phosphorylation, leading to down-regulation of MMP-9 mRNA and protein expression in EGF-treated cells. Meanwhile, EGF-induced p300 stabilization was found to be involved in MMP-9 expression, whereas GA-AuNPs inhibited the EGF-promoted stability of the p300 protein. Although GA-AuNPs and gallic acid suppressed EGF-induced MMP-9 up-regulation via the same signaling pathway, the effective concentration of gallic acid was approximately 100-fold higher than that of GA-AuNPs for inhibition of MMP-9 expression in EGF-treated cells to a similar extent. Collectively, our data indicate that, in comparison with gallic acid, GA-AuNPs have a superior ability to inhibit EGF/EGFR-mediated MMP-9 expression in TNBC MDA-MB-231 cells. Our findings also point to a way to improve the anti-tumor activity of gallic acid. - Highlights: • Gallic acid-capped gold nanoparticles inhibit EGF-induced MMP-9 expression. • EGF-induced MMP-9 expression via p300 stabilization and NFκB/c-Jun activation. • Gallic acid
Energy Technology Data Exchange (ETDEWEB)
Chen, Ying-Jung; Lee, Yuan-Chin; Huang, Chia-Hui [Institute of Biomedical Sciences, National Sun Yat-Sen University, Kaohsiung 804, Taiwan (China); Chang, Long-Sen, E-mail: lschang@mail.nsysu.edu.tw [Institute of Biomedical Sciences, National Sun Yat-Sen University, Kaohsiung 804, Taiwan (China); Department of Biotechnology, Kaohsiung Medical University, Kaohsiung 807, Taiwan (China)
2016-11-01
Triple-negative breast cancers (TNBCs) are highly invasive and have a higher rate of distant metastasis. Matrix metalloproteinase-9 (MMP-9) plays a crucial role in EGF/EGFR-mediated malignant progression and metastasis of TNBCs. Various studies have revealed that treatment with gallic acid down-regulates MMP-9 expression in cancer cells, and that conjugation of phytochemical compounds with gold nanoparticles (AuNPs) increases the anti-tumor activity of the phytochemical compounds. Thus, the effect of gallic acid-capped AuNPs (GA-AuNPs) on MMP-9 expression in EGF-treated TNBC MDA-MB-231 cells was analyzed in the present study. The so-called green synthesis of AuNPs by means of gallic acid was performed at pH 10, and the resulting GA-AuNPs had spherical shape with an average diameter of approximately 50 nm. GA-AuNPs notably suppressed migration and invasion of EGF-treated cells, and inhibited EGF-induced MMP-9 up-regulation. GA-AuNPs abrogated EGF-induced Akt/p65 and ERK/c-Jun phosphorylation, leading to down-regulation of MMP-9 mRNA and protein expression in EGF-treated cells. Meanwhile, EGF-induced p300 stabilization was found to be involved in MMP-9 expression, whereas GA-AuNPs inhibited the EGF-promoted stability of the p300 protein. Although GA-AuNPs and gallic acid suppressed EGF-induced MMP-9 up-regulation via the same signaling pathway, the effective concentration of gallic acid was approximately 100-fold higher than that of GA-AuNPs for inhibition of MMP-9 expression in EGF-treated cells to a similar extent. Collectively, our data indicate that, in comparison with gallic acid, GA-AuNPs have a superior ability to inhibit EGF/EGFR-mediated MMP-9 expression in TNBC MDA-MB-231 cells. Our findings also point to a way to improve the anti-tumor activity of gallic acid. - Highlights: • Gallic acid-capped gold nanoparticles inhibit EGF-induced MMP-9 expression. • EGF-induced MMP-9 expression via p300 stabilization and NFκB/c-Jun activation. • Gallic acid
Mack, Nzinga; Mazzio, Elizabeth A; Bauer, David; Flores-Rozas, Hernan; Soliman, Karam F A
2017-03-01
In the US, African Americans have a high death rate from triple-negative breast cancer (TNBC), characterized by lack of hormone receptors (ER, PR, HER2/ERRB2) which are otherwise valuable targets of chemotherapy. There is a need to identify novel targets that negatively impact TNBC tumorigenesis. TNBCs release an abundance of lactic acid, under normoxic, hypoxic and hyperoxic conditions; this referred to as the Warburg effect. Accumulated lactic acid sustains peri-cellular acidity which propels metastatic invasion and malignant aggressive transformation. The source of lactic acid is believed to be via conversion of pyruvate by lactate dehydrogenase (LDH) in the last step of glycolysis, with most studies focusing on the LDHA isoform. In this study, LDHA was silenced using long-term MISSION® shRNA lentivirus in human breast cancer MDA-MB-231 cells. Down-regulation of LDHA transcription and protein expression was confirmed by western blot, immunocytochemistry and qPCR. A number of parameters were measured in fully viable vector controls versus knock-down (KD) clones, including levels of lactic acid produced, glucose consumed, ATP and basic metabolic rates. The data show that lentivirus V-165 generated a knock-down clone most effective in reducing both gene and protein levels to less than 1% of vector controls. Stable KD showed absolutely no changes in cell viability, lactic acid production, ATP, glucose consumption or basic metabolic rate. Given the complete absence of impact on any observed parameter by LDH-A KD and this being somewhat contrary to findings in the literature, further analysis was required to determine why. Whole-transcriptome analytic profile on MDA-MB-231 for LDH subtypes using Agilent Human Genome 4×44k microarrays, where the data show the following component breakdown. Transcripts: 30.47 % LDHA, 69.36% LDHB, 0.12% LDHC and 0.05% LDHD. These findings underscore the importance of alternative isoforms of LDH in cancer cells to produce lactic acid
Energy Technology Data Exchange (ETDEWEB)
Levon, A.I. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); De Boer, J. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Graw, G. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Hertenberger, R. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Hofer, D. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Kvasil, J. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Loesch, A. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Mueller-Zanotti, E. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Wuerkner, M. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Baltzer, H. (Institut fuer Strahlen- und Kernphysik, University of Bonn, D-53115 Bonn (Germany)); Grafen, V. (Institut fuer Strahlen- und Kernphysik, University of Bonn, D-53115 Bonn (Germany)); Guenther, C. (Institut fuer Strahlen- und Kernphysik, University of
1994-08-29
The level structure of the [sup 229]Pa nucleus has been investigated by means of the [sup 231]Pa(p,t)[sup 229]Pa and [sup 230]Th(p,2n[gamma])[sup 229]Pa reactions. Triton angular-distribution measurements were subjected to a CCBA analysis and combined with the results of in-beam conversion electron and [gamma]-ray spectroscopy to establish a level scheme. Two low-lying bands of opposite parity were observed up to spins (23/2)[sup -] and (17/2)[sup +], respectively. Rotational bands built on some 0[sup +] excitations of the even-even core can be assigned. The lowest states of three further low-lying bands are observed. The level scheme is interpreted in terms of an octupole-deformed core with an unpaired proton. From the E1/E2 branching ratio the electric dipole moment can be deduced vertical stroke D[sub 0]vertical stroke =(0.09 [+-]0.04) e .fm. ((orig.))
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
F-Area Burning/Rubble Pits (231-F, 231-1F, and 231-2F) Corrective Measures Study/Feasibility Study
International Nuclear Information System (INIS)
Palmer, E.
1996-06-01
The purpose of this report is to evaluate various technologies that can be used to remediate the soil contamination attributed to the FBRP source unit.Section 1 of this report gives the background of this facility. Section 2 discusses the remedial action objectives and the general response actions for each medium of interest. The technology types and process options are identified and evaluated for each medium of interest. A selection and evaluation of representative technologies is included. Section 3 describes the rationale for combining technologies into alternatives. Section 4 gives a detailed analysis of each alternative as well as a comparative analysis of these alternatives
Energy Technology Data Exchange (ETDEWEB)
Palmer, E. [Westinghouse Savannah River Company, AIKEN, SC (United States)
1996-06-01
The purpose of this report is to evaluate various technologies that can be used to remediate the soil contamination attributed to the FBRP source unit.Section 1 of this report gives the background of this facility. Section 2 discusses the remedial action objectives and the general response actions for each medium of interest. The technology types and process options are identified and evaluated for each medium of interest. A selection and evaluation of representative technologies is included. Section 3 describes the rationale for combining technologies into alternatives. Section 4 gives a detailed analysis of each alternative as well as a comparative analysis of these alternatives.
Biological profile of 99mTc-HYNIC-βAla-NT(8-13) in MDAMB-231 breast cancer cell line
International Nuclear Information System (INIS)
Teodoro, Rodrigo; Faintuch, Bluma L.; Wiecek, Danielle P.; Silva, Natanael G.; Vallejo, Natalia M.
2009-01-01
Introduction: Neurotensin (NT) is a tridecapeptide involved in several growth-steps of human cancers. Recent studies postulated the role of NT and NT-receptor subtype 1 in breast cancer progression. However, the main drawback of natural NT is its rapid degradation in plasma. In an effort to develop a NT peptide-based radiopharmaceutical for the detection of breast cancer, the aim of this study was the radiolabeling of the double stabilized NT(8-13) peptide using HYNIC as chelating agent. Methods: Conjugated HYNIC-βAla-NT(8-13) was labeled with 99m Tc using tricine and EDDA as coligands. Radiochemical purity was checked by TLC and confirmed by RP-HPLC. 99m Tc-HYNIC-βAla-NT(8-13) (0.1 mL/74 MBq) was administered in Nude mice bearing MDA-MB-231 breast cancer cells and biodistribution studies were carried out at 30 and 90 min postinjection (pi). Blocking evaluation was also conducted by co-injection of 115 nmol of cold NT (8-13) analog. Planar gamma-camera imaging was acquired at the earlier time point studied. Results: Radiochemical purity of the radioconjugate was higher than 99%. Biodistribution studies revealed a very fast accumulation in tumor (1.97±0.18% ID/g, 30 min pi) with a sharply decrease at the later time point studied (0.44±0.02% ID/g). The specificity of the radioconjugate was evaluated with blockade studies. A reduction of 45.94%, 27.73% and 36.39% was found for tumor, large and small intestines, respectively, at 30 min pi. Otherwise, a less impressive blockade was observed for tumor and small intestine (28.68% and 24.90%, respectively) at the later time point studied. Conclusion: The results provide encouraging evidence in the development of radiolabeled NT(8-13) analogues for breast cancer diagnosis. (author)
Directory of Open Access Journals (Sweden)
Nicolas G. Azios
2005-02-01
Full Text Available Resveratrol, a grape polyphenol, is thought to be a cancer preventive, yet its effects on metastatic breast cancer are relatively unknown. Since cancer cell invasion is dependent on cell migration, the chemotactic response of MDA-MB-231 metastatic human breast cancer cells to resveratrol, estradiol (E2, or epidermal growth factor (EGF was investigated. Resveratrol decreased while E2 and EGF increased directed cell migration. Resveratrol may inhibit cell migration by altering the cytoskeleton. Resveratrol induced a rapid global array of filopodia and decreased focal adhesions and focal adhesion kinase (FAK activity. E2 or EGF treatment did not affect filopodia extension but increased lamellipodia and associated focal adhesions that are integral for cell migration. Combined resveratrol and E2 treatment resulted in a filopodia and focal adhesion response similar to resveratrol alone. Combined resveratrol and EGF resulted in a lamellipodia and focal adhesion response similar to EGF alone. E2 and to a lesser extent resveratrol increased EGFR activity. The cytoskeletal changes and EGFR activity in response to E2 were blocked by EGFR1 inhibitor indicating that E2 may increase cell migration via crosstalk with EGFR signaling. These data suggest a promotional role for E2 in breast cancer cell migration but an antiestrogenic, preventative role for resveratrol.
Directory of Open Access Journals (Sweden)
Jacob E. Koskimaki
2009-12-01
Full Text Available Angiogenesis or neovascularization, the process of new blood vessel formation from preexisting microvasculature, involves interactions among several cell types including parenchymal, endothelial cells, and immune cells. The formation of new vessels is tightly regulated by a balance between endogenous proangiogenic and antiangiogenic factors to maintain homeostasis in tissue; tumor progression and metastasis in breast cancer have been shown to be angiogenesis-dependent. We previously introduced a systematic methodology to identify putative endogenous antiangiogenic peptides and validated these predictions in vitro in human umbilical vein endothelial cell proliferation and migration assays. These peptides are derived from several protein families including type IV collagen, CXC chemokines, and thrombospondin-1 domain-containing proteins. On the basis of the results from the in vitro screening, we have evaluated the ability of one peptide selected from each family named pentastatin-1, chemokinostatin-1, and properdistatin, respectively, to suppress angiogenesis in an MDA-MB-231 human breast cancer orthotopic xenograft model in severe combined immunodeficient mice. Peptides were administered intraperitoneally once per day. We have demonstrated significant suppression of tumor growth in vivo and subsequent reductions in microvascular density, indicating the potential of these peptides as therapeutic agents for breast cancer.
Biological profile of {sup 99m}Tc-HYNIC-betaAla-NT(8-13) in MDAMB-231 breast cancer cell line
Energy Technology Data Exchange (ETDEWEB)
Teodoro, Rodrigo; Faintuch, Bluma L.; Wiecek, Danielle P.; Silva, Natanael G.; Vallejo, Natalia M., E-mail: teodoro_rodrigo@yahoo.com.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Diretoria de Radiofarmacia
2009-07-01
Introduction: Neurotensin (NT) is a tridecapeptide involved in several growth-steps of human cancers. Recent studies postulated the role of NT and NT-receptor subtype 1 in breast cancer progression. However, the main drawback of natural NT is its rapid degradation in plasma. In an effort to develop a NT peptide-based radiopharmaceutical for the detection of breast cancer, the aim of this study was the radiolabeling of the double stabilized NT(8-13) peptide using HYNIC as chelating agent. Methods: Conjugated HYNIC-betaAla-NT(8-13) was labeled with {sup 99m}Tc using tricine and EDDA as coligands. Radiochemical purity was checked by TLC and confirmed by RP-HPLC. {sup 99m}Tc-HYNIC-betaAla-NT(8-13) (0.1 mL/74 MBq) was administered in Nude mice bearing MDA-MB-231 breast cancer cells and biodistribution studies were carried out at 30 and 90 min postinjection (pi). Blocking evaluation was also conducted by co-injection of 115 nmol of cold NT (8-13) analog. Planar gamma-camera imaging was acquired at the earlier time point studied. Results: Radiochemical purity of the radioconjugate was higher than 99%. Biodistribution studies revealed a very fast accumulation in tumor (1.97+-0.18% ID/g, 30 min pi) with a sharply decrease at the later time point studied (0.44+-0.02% ID/g). The specificity of the radioconjugate was evaluated with blockade studies. A reduction of 45.94%, 27.73% and 36.39% was found for tumor, large and small intestines, respectively, at 30 min pi. Otherwise, a less impressive blockade was observed for tumor and small intestine (28.68% and 24.90%, respectively) at the later time point studied. Conclusion: The results provide encouraging evidence in the development of radiolabeled NT(8-13) analogues for breast cancer diagnosis. (author)
Directory of Open Access Journals (Sweden)
David Bauer
Full Text Available Mortality associated with breast cancer is attributable to aggressive metastasis, to which TNFα plays a central orchestrating role. TNFα acts on breast tumor TNF receptors evoking the release of chemotactic proteins (e.g. MCP-1/CCL2. These proteins direct inward infiltration/migration of tumor-associated macrophages (TAMs, tumor-associated neutrophils (TANs, myeloid-derived suppressor cells (MDSCs, T-regulatory cells (Tregs, T helper IL-17-producing cells (Th17s, metastasis-associated macrophages (MAMs and cancer-associated fibroblasts (CAFs. Tumor embedded infiltrates collectively enable immune evasion, tumor growth, angiogenesis, and metastasis. In the current study, we investigate the potential of apigenin, a known anti-inflammatory constituent of parsley, to downregulate TNFα mediated release of chemokines from human triple-negative cells (MDA-MB-231 cells. The results show that TNFα stimulation leads to large rise of CCL2, granulocyte macrophage colony-stimulating factor (GMCSF, IL-1α and IL-6, all suppressed by apigenin. While many aspects of the transcriptome for NFkB signaling were evaluated, the data show signaling patterns associated with CCL2 were blocked by apigenin and mediated through suppressed mRNA and protein synthesis of IKBKe. Moreover, the data show that the attenuation of CCL2 by apigenin in the presence TNFα paralleled the suppression of phosphorylated extracellular signal-regulated kinase 1 (ERK 1/ 2. In summary, the obtained findings suggest that there exists a TNFα evoked release of CCL2 and other LSP recruiting cytokines from human breast cancer cells, which can be attenuated by apigenin.
Jiao, Jing; Yang, Guotao; Cheng, Xuewu; Liu, Zhengkuan; Wang, Jihong; Yan, Zhenzhong; Wang, Chi; Batista, Paulo; Pimenta, Alexandre; Andrioli, Vânia; Denardini, C. M.
2018-04-01
We present the first simultaneous observation of mesopause sodium (Na) and potassium (K) layer by a lidar which has Na and K channel simultaneously at the South Hemisphere site, São José dos Campos (23.1°S, 45.9°W). Measurements reported here were conducted on two nights with 3.5 and 8 h of observations in November 2016. On 20 November 2016, sporadic layers in both Na and K layer occurred above 100 km, and the higher layers corresponded well with sporadic E (Es) layer. And the density of Na at 100-105 km is higher than that at main layer around 90 km, but K density around 100 km is at least 3 times smaller compared with the K density around 90 km for the similar period. On 21 November 2016, both sporadic layers occurred in main layer height with obvious descending variations with time, which seems like tidal induced. Notably, the peak K/Na ratio slowly increased with time. And Na layer and K layer showed different processes along with time with K density reaching its maximum 1 h later than that of Na. Correlations of Na/K density, Es, and winds were also discussed.
Ferreira, Adilson Kleber; de-Sá-Júnior, Paulo Luiz; Pasqualoto, Kerly Fernanda Mesquita; de Azevedo, Ricardo Alexandre; Câmara, Diana Aparecida Dias; Costa, André Santos; Figueiredo, Carlos Rogério; Matsuo, Alisson Leonardo; Massaoka, Mariana Hiromi; Auada, Aline Vivian Vatti; Lebrun, Ivo; Damião, Mariana Celestina Frojuello Costa Bernstorff; Tavares, Maurício Temotheo; Magri, Fátima Maria Motter; Kerkis, Irina; Parise Filho, Roberto
2014-04-01
Breast cancer is the world's leading cause of death among women. This situation imposes an urgent development of more selective and less toxic agents. The use of natural molecular fingerprints as sources for new bioactive chemical entities has proven to be a quite promising and efficient method. Here, we have demonstrated for the first time that dillapiole has broad cytotoxic effects against a variety tumor cells. For instance, we found that it can act as a pro-oxidant compound through the induction of reactive oxygen species (ROS) release in MDA-MB-231 cells. We also demonstrated that dillapiole exhibits anti-proliferative properties, arresting cells at the G0/G1 phase and its antimigration effects can be associated with the disruption of actin filaments, which in turn can prevent tumor cell proliferation. Molecular modeling studies corroborated the biological findings and suggested that dillapiole may present a good pharmacokinetic profile, mainly because its hydrophobic character, which can facilitate its diffusion through tumor cell membranes. All these findings support the fact that dillapiole is a promising anticancer agent. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC231 (Link to dictyBase) - - - Contig-U16593-1 VFC231P (Link... to Original site) VFC231F 428 VFC231Z 202 VFC231P 630 - - Show VFC231 Library VF (Link to library) Clone ID VFC231 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16593-1 Original site URL http://dict...amoeba histolytica genomic, DNA sequence. 48 0.13 1 AC116984 |AC116984.2 Dictyostelium discoideum chromosome...mbrane 4.0 %: vesicles of secretory system 4.0 %: extracellular, including cell wall >> predict
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
International Nuclear Information System (INIS)
Palmer, E.
1997-02-01
This decision document presents the selected remedial alternative for the FBRP located at the SRS in Aiken, South Carolina. The selected alternative was developed in accordance with CERCLA, as amended, and to the extent practicable, the National Oil and Hazardous Substances Pollution Contingency Plan. This decision is based on the Administrative Record File for this specific RCRA/CERCLA unit
Directory of Open Access Journals (Sweden)
Gurunathan S
2015-06-01
-MB-231 breast cancer cells. Western blot analyses revealed that AgNPs induce cellular apoptosis via activation of p53, p-Erk1/2, and caspase-3 signaling, and downregulation of Bcl-2. Cells pretreated with pifithrin-alpha were protected from p53-mediated AgNPs-induced toxicity.Conclusion: We have demonstrated a simple approach for the synthesis of AgNPs using the novel strains B. tequilensis and C. indica, as well as their mechanism of cell death in a p53-dependent manner in MDA-MB-231 human breast cancer cells. The present findings could provide insight for the future development of a suitable anticancer drug, which may lead to the development of novel nanotherapeutic molecules for the treatment of cancers.Keywords: apoptosis, UV-vis spectroscopy, X-ray diffraction, ROS generation
Razmi, Mahdieh; Rabbani-Chadegani, Azra; Hashemi-Niasari, Fatemeh; Ghadam, Parinaz
2018-07-01
The clinical use of potent anticancer drug mitomycin C (MMC) has limited due to side effects and resistance of cancer cells. The aim of this study was to investigate whether lithium chloride (LiCl), as a mood stabilizer, can affect the sensitivity of MDA-MB-231 breast cancer cells to mitomycin C. The cells were exposed to various concentrations of mitomycin C alone and combined with LiCl and the viability determined by trypan blue and MTT assays. Proteins were analyzed by western blot and mRNA expression of HMGB1 MMP9 and Bcl-2 were analyzed by RT-PCR. Flow cytometry was used to determine the cell cycle arrest and percent of apoptotic and necrotic cells. Concentration of Bax assessed by ELISA. Exposure of the cells to mitomycin C revealed IC 50 value of 20 μM, whereas pretreatment of the cells with LiCl induced synergistic cytotoxicity and IC 50 value declined to 5 μM. LiCl combined with mitomycin C significantly down-regulated HMGB1, MMP9 and Bcl-2 gene expression but significantly increased the level of Bax protein. In addition, the content of HMGB1 in the nuclei decreased and pretreatment with LiCl reduced the content of HMGB1 release induced by MMC. LiCl increased mitomycin C-induced cell shrinkage and PARP fragmentation suggesting induction of apoptosis in these cells. LiCl prevented mitomycin C-induced necrosis and changed the cell death arrest at G2/M-phase. Taking all together, it is suggested that LiCl efficiently enhances mitomycin C-induced apoptosis and HMGB1, Bax and Bcl-2 expression may play a major role in this process, the findings that provide a new therapeutic strategy for LiCl in combination with mitomycin C. Copyright © 2018 Elsevier GmbH. All rights reserved.
Ghorbanoghli, Z; Nieuwenhuis, M H; Houwing-Duistermaat, J J; Jagmohan-Changur, S; Hes, F J; Tops, C M; Wagner, A; Aalfs, C M; Verhoef, S; Gómez García, E B; Sijmons, R H; Menko, F H; Letteboer, T G; Hoogerbrugge, N; van Wezel, T; Vasen, H F A; Wijnen, J T
2016-10-01
Familial adenomatous polyposis (FAP) is a dominantly inherited syndrome caused by germline mutations in the APC gene and characterized by the development of multiple colorectal adenomas and a high risk of developing colorectal cancer (CRC). The severity of polyposis is correlated with the site of the APC mutation. However, there is also phenotypic variability within families with the same underlying APC mutation, suggesting that additional factors influence the severity of polyposis. Genome-wide association studies identified several single nucleotide polymorphisms (SNPs) that are associated with CRC. We assessed whether these SNPs are associated with polyp multiplicity in proven APC mutation carriers. Sixteen CRC-associated SNPs were analysed in a cohort of 419 APC germline mutation carriers from 182 families. Clinical data were retrieved from the Dutch Polyposis Registry. Allele frequencies of the SNPs were compared for patients with APC genotype as a covariate. We found a trend of association of two of the tested SNPs with the ≥100 adenoma phenotype: the C alleles of rs16892766 at 8q23.3 (OR 1.71, 95 % CI 1.05-2.76, p = 0.03, dominant model) and rs3802842 at 11q23.1 (OR 1.51, 95 % CI 1.03-2.22, p = 0.04, dominant model). We identified two risk variants that are associated with a more severe phenotype in APC mutation carriers. These risk variants may partly explain the phenotypic variability in families with the same APC gene defect. Further studies with a larger sample size are recommended to evaluate and confirm the phenotypic effect of these SNPs in FAP.
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
DEFF Research Database (Denmark)
Owens, T
1988-01-01
on resting B cells (even in the presence of intact F23.1 antibody), but could induce antibody secretion by anti-Ig-preactivated B cells. Both F23.1+ clones (E9.D4 and 4.35F2) and one F23.1- clone (D2.2) could synergize with supernatants from activated E9.D4 T cells to induce B cell activation. F(ab')2......Culture of small resting allogeneic B cells (of an irrelevant haplotype) with two clones of T helper (Th) cells that were activated by the F23.1 anti-T cell receptor antibody led to the activation of B cells to proliferate and to secrete antibody. Th cell supernatants by themselves had no effect...... fragments of F23.1 induced E9.D4 to activate B cells as efficiently as intact F23.1 and B cell populations that had been incubated with F23.1 were not activated when cultured with E9.D4, although T cells recognized cell-presented F23.1 and were weakly activated. Reduction of the density of F23.1 adsorbed...
1991-01-01
S-231-0040 Classic Wizard Tuner e. S-231-0001 Classic Wizard Collection System Operator f. S-231-0002 Classic Wizard Network System Operator g. S-231...aircraft. HKLM[ NERON 12 has its headquarters at NAS Norfolk. (1) Pilots and Aircrew Training: HEIMINERON TWELVE Training Officer Naval Air Station Norfolk
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
Mariotto, S; Ciampa, A R; de Prati, A Carcereri; Darra, E; Vincenzi, S; Sega, M; Cavalieri, E; Shoji, K; Suzuki, H
2008-05-01
Arbutus unedo L. has been for a long time employed in traditional and popular medicine as an astringent, diuretic, urinary anti-septic, and more recently, in the therapy of hypertension and diabetes. Signal transducer and activator of transcription 1 (STAT1) is a fascinating and complex protein with multiple yet contrasting transcriptional functions. Although activation of this nuclear factor is finely regulated in order to control the entire inflammatory process, its hyper-activation or time-spatially erroneous activation may lead to exacerbation of inflammation. The modulation of this nuclear factor, therefore, has recently been considered as a new strategy in the treatment of inflammatory diseases. In this study, we present data showing that the aqueous extract of Arbutus unedo's leaves exerts inhibitory action on interferon-gamma (IFN-gamma) elicited activation of STAT1, both in human breast cancer cell line MDA-MB-231 and in human fibroblasts. This down-regulation of STAT1 is shown to result from a reduced tyrosine phosphorylation of STAT1 protein. Evidence is also presented indicating that the inhibitory effect of this extract may be mediated through enhancement of tyrosine phosphorylation of SHP2 tyrosine phosphatase. The modulation of this nuclear factor turns out into the regulation of the expression of a number of genes involved in the inflammatory response such as inducible nitric oxide synthase (iNOS) and intercellular adhesion molecule-1 (ICAM-1). Taken together, our results suggest that the employment of the Arbutus unedo aqueous extract is promising, at least, as an auxiliary anti-inflammatory treatment of diseases in which STAT1 plays a critical role.
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
32 CFR 231.3 - Responsibilities.
2010-07-01
... franchises assigned to credit unions serving DoD overseas installations. (e) Secretaries of the Military... and credit unions to ensure that they fulfill the requirements upon which the establishment and... presently served. Such requests will include a statement that the requirement has been coordinated with the...
2010-10-01
... under its jurisdiction where mining is authorized. However, the public interest requires that, with respect to the exploration for, and the surface mining of, such minerals, adequate measures be taken to...: Interior Office of the Secretary of the Interior SURFACE EXPLORATION, MINING AND RECLAMATION OF LANDS § 23...
2010-07-01
... union facility. A facility employing a communications system with the parent credit union to conduct... requirements that cannot be resolved by the credit union or local command. (q) Geographic franchise... operations are thus differentiated from county-wide or state-wide branch systems consisting of a head office...
Northern Pintail Telemetry [ds231
California Natural Resource Agency — Using radio-telemetry, female northern pintail (Anas acuta) survival, distribution, and movements during late August-March in Central California were determined...
2010-07-01
... administer in the form of grants, contracts, loans, loan guarantees, property, cooperative agreements, direct appropriations, or other direct or indirect assistance, but does not include a tax credit, deduction or exemption... families of criminal offenders, and services related to intervention in, and prevention of domestic...
2010-07-01
... seeking to continue academic, career and technical, and independent living instruction at an institution... of the following activities: (i) Taking credit-bearing courses with students without disabilities... student does not receive regular academic credit. (iii) Taking non-credit-bearing, nondegree courses with...
Experiment list: SRX185912 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available MB-231 foxm1 Thiostrepton 1; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 breast adenocarcinoma cells, thio...strepton, FOXM1 ChIP || cell_line=MDA-MB-231 || cell_type=ER-negative breast adenocarcinoma
Experiment list: SRX185911 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available B-231 foxm1 DMSO 1; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 breast adenocarcinoma cells, control, FOXM...1 ChIP || cell_line=MDA-MB-231 || cell_type=ER-negative breast adenocarcinoma cel
Experiment list: SRX185914 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available B-231 foxm1 Thiostrepton 2; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 breast adenocarcinoma cells, thios...trepton, FOXM1 ChIP || cell_line=MDA-MB-231 || cell_type=ER-negative breast adenocarcinoma
Experiment list: SRX185913 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available MB-231 foxm1 DMSO 2; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 breast adenocarcinoma cells, control, FOX...M1 ChIP || cell_line=MDA-MB-231 || cell_type=ER-negative breast adenocarcinoma ce
International Nuclear Information System (INIS)
Venchiarutti, C.; Roy-Barman, M.; Freydier, R.; Van Beek, P.; Souhaut, M.; Jeandel, C.
2011-01-01
Dissolved and particulate excess 230 Th and 231 Pa concentrations (noted 230 Th xs and 231 Pa xs respectively) and 231 Pa xs / 230 Th xs activity ratios were investigated on and out of the Kerguelen plateau (Southern Ocean) in the framework of the Kerguelen Ocean and Plateau compared Study project in order to better understand the influence of particle flux and particle chemistry and advection on the scavenging of 231 Pa. In the wake of Kerguelen, particulate 231 Pa xs is relatively abundant compared to its content in the dissolved phase. This, together with the low fractionation observed between 230 Th and 231 Pa (F Th/Pa ranging from 0.06 ± 0.01 to 1.6 ± 0.2) reflects the domination of the biogenic silica in the particle pool. Along the eastern escarpment of the Kerguelen plateau, the strong 231 Pa xs horizontal gradient in the deep waters highlights the intense removal of 231 Pa at depth, as already observed for 230 Th xs . This local boundary scavenging was attributed to re-suspension of opal-rich particles by nepheloid layers, resulting in fractionation factors F Th/Pa ≤ 1 along the Kerguelen plateau slope. Therefore, both the composition (biogenic opal) and the flux (intense along the margin) of particles control the scavenging of the two radionuclides in the Kerguelen wake. The modelling of 231 Pa distribution with an advection-scavenging model demonstrates that lateral advection of open ocean water on the Kerguelen plateau could supply most of the 231 Pa, which is then efficiently scavenged on the highly productive plateau, as previously proposed for 230 Th xs . It stresses that lateral advection can play a significant role in the overall budget of particle reactive trace elements in a coastal-open ocean system. (authors)
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
Lifescience Database Archive (English)
Full Text Available 112712 Link to Original y[*] w[*]; P{GawB}NP1582 / TM6, P{UAS-lacZ.UW23-1}UW23-1 86...E17 Link to DGRC Genome Viewer: 112712 CG10535 CG17309 1582 3 NP line. Received from the National Institute ...oenocyte internal - - - - - - - Show 112712 DGRC Number 112712 Link to Original G...enotype y[*] w[*]; P{GawB}NP1582 / TM6, P{UAS-lacZ.UW23-1}UW23-1 Insertion Site 86E17 Map Viewer Link to DGRC Genome Viewer: 112712
Zhang, Xiaohui; Zhong, Shanliang; Xu, Yong; Yu, Dandan; Ma, Tengfei; Chen, Lin; Zhao, Yang; Chen, Xiu; Yang, Sujin; Wu, Yueqin; Tang, Jinhai; Zhao, Jianhua
2016-01-01
Acquisition of resistance to docetaxel (Doc) is one of the most important problems in treatment of breast cancer patients, but the underlying mechanisms are still not fully understood. In present study, Doc-resistant MDA-MB-231 and MCF-7 breast cancer cell lines (MDA-MB-231/Doc and MCF-7/Doc) were successfully established in vitro by gradually increasing Doc concentration on the basis of parental MDA-MB-231 and MCF-7 cell lines (MDA-MB-231/S and MCF-7/S). The potential miRNAs relevant to the ...
Serret, Julien; Bièche, Ivan; Brigitte, Madly; Caicedo, Andres; Sanchez, Elodie; Vacher, Sophie; Vignais, Marie-Luce; Bourin, Philippe; Geneviève, David; Molina, Franck; Jorgensen, Christian; Lazennec, Gwendal
2015-01-01
The aim of this work was to understand whether the nature of breast cancer cells could modify the nature of the dialog of mesenchymal stem cells (MSCs) with cancer cells. By treating MSCs with the conditioned medium of metastatic Estrogen-receptor (ER)-negative MDA-MB-231, or non-metastatic ER-positive MCF-7 breast cancer cells, we observed that a number of chemokines were produced at higher levels by MSCs treated with MDA-MB-231 conditioned medium (CM). MDA-MB-231 cells were able to induce NF-κB signaling in MSC cells. This was shown by the use of a NF-kB chemical inhibitor or an IκB dominant negative mutant, nuclear translocation of p65 and induction of NF-κB signature. Our results suggest that MDA-MB-231 cells exert their effects on MSCs through the secretion of IL-1β, that activates MSCs and induces the same chemokines as the MDA-MB-231CM. In addition, inhibition of IL-1β secretion in the MDA-MB-231 cells reduces the induced production of a panel of chemokines by MSCs, as well the motility of MDA-MB-231 cells. Our data suggest that aggressive breast cancer cells secrete IL-1β, which increases the production of chemokines by MSCs. PMID:26362269
Loss of myoferlin redirects breast cancer cell motility towards collective migration.
Directory of Open Access Journals (Sweden)
Leonithas I Volakis
Full Text Available Cell migration plays a central role in the invasion and metastasis of tumors. As cells leave the primary tumor, they undergo an epithelial to mesenchymal transition (EMT and migrate as single cells. Epithelial tumor cells may also migrate in a highly directional manner as a collective group in some settings. We previously discovered that myoferlin (MYOF is overexpressed in breast cancer cells and depletion of MYOF results in a mesenchymal to epithelial transition (MET and reduced invasion through extracellular matrix (ECM. However, the biomechanical mechanisms governing cell motility during MYOF depletion are poorly understood. We first demonstrated that lentivirus-driven shRNA-induced MYOF loss in MDA-MB-231 breast cancer cells (MDA-231(MYOF-KD leads to an epithelial morphology compared to the mesenchymal morphology observed in control (MDA-231(LTVC and wild-type cells. Knockdown of MYOF led to significant reductions in cell migration velocity and MDA-231(MYOF-KD cells migrated directionally and collectively, while MDA-231(LTVC cells exhibited single cell migration. Decreased migration velocity and collective migration were accompanied by significant changes in cell mechanics. MDA-231(MYOF-KD cells exhibited a 2-fold decrease in cell stiffness, a 2-fold increase in cell-substrate adhesion and a 1.5-fold decrease in traction force generation. In vivo studies demonstrated that when immunocompromised mice were implanted with MDA-231(MYOF-KD cells, tumors were smaller and demonstrated lower tumor burden. Moreover, MDA-231(MYOF-KD tumors were highly circularized and did not invade locally into the adventia in contrast to MDA-231(LTVC-injected animals. Thus MYOF loss is associated with a change in tumor formation in xenografts and leads to smaller, less invasive tumors. These data indicate that MYOF, a previously unrecognized protein in cancer, is involved in MDA-MB-231 cell migration and contributes to biomechanical alterations. Our results indicate
Mondal, Palash; Roy, Sanjay; Loganathan, Gayathri; Mandal, Bitapi; Dharumadurai, Dhanasekaran; Akbarsha, Mohammad A; Sengupta, Partha Sarathi; Chattopadhyay, Shouvik; Guin, Partha Sarathi
2015-12-01
The X-ray diffraction and spectroscopic properties of 1-amino-4-hydroxy-9,10-anthraquinone (1-AHAQ), a simple analogue of anthracycline chemotherapeutic drugs were studied by adopting experimental and computational methods. The optimized geometrical parameters obtained from computational methods were compared with the results of X-ray diffraction analysis and the two were found to be in reasonably good agreement. X-ray diffraction study, Density Functional Theory (DFT) and natural bond orbital (NBO) analysis indicated two types of hydrogen bonds in the molecule. The IR spectra of 1-AHAQ were studied by Vibrational Energy Distribution Analysis (VEDA) using potential energy distribution (PED) analysis. The electronic spectra were studied by TDDFT computation and compared with the experimental results. Experimental and theoretical results corroborated each other to a fair extent. To understand the biological efficacy of 1-AHAQ, it was allowed to interact with calf thymus DNA and human breast adino-carcinoma cell MDA-MB-231. It was found that the molecule induces apoptosis in this adinocarcinoma cell, with little, if any, cytotoxic effect in HBL-100 normal breast epithelial cell.
Viola, Manuela; Brüggemann, Kathrin; Karousou, Evgenia; Caon, Ilaria; Caravà, Elena; Vigetti, Davide; Greve, Burkhard; Stock, Christian; De Luca, Giancarlo; Passi, Alberto; Götte, Martin
2017-06-01
Proteoglycans and glycosaminoglycans modulate numerous cellular processes relevant to tumour progression, including cell proliferation, cell-matrix interactions, cell motility and invasive growth. Among the glycosaminoglycans with a well-documented role in tumour progression are heparan sulphate, chondroitin/dermatan sulphate and hyaluronic acid/hyaluronan. While the mode of biosynthesis differs for sulphated glycosaminoglycans, which are synthesised in the ER and Golgi compartments, and hyaluronan, which is synthesized at the plasma membrane, these polysaccharides partially compete for common substrates. In this study, we employed a siRNA knockdown approach for heparan sulphate (EXT1) and heparan/chondroitin/dermatan sulphate-biosynthetic enzymes (β4GalT7) in the aggressive human breast cancer cell line MDA-MB-231 to study the impact on cell behaviour and hyaluronan biosynthesis. Knockdown of β4GalT7 expression resulted in a decrease in cell viability, motility and adhesion to fibronectin, while these parameters were unchanged in EXT1-silenced cells. Importantly, these changes were associated with a decreased expression of syndecan-1, decreased signalling response to HGF and an increase in the synthesis of hyaluronan, due to an upregulation of the hyaluronan synthases HAS2 and HAS3. Interestingly, EXT1-depleted cells showed a downregulation of the UDP-sugar transporter SLC35D1, whereas SLC35D2 was downregulated in β4GalT7-depleted cells, indicating an intricate regulatory network that connects all glycosaminoglycans synthesis. The results of our in vitro study suggest that a modulation of breast cancer cell behaviour via interference with heparan sulphate biosynthesis may result in a compensatory upregulation of hyaluronan biosynthesis. These findings have important implications for the development of glycosaminoglycan-targeted therapeutic approaches for malignant diseases.
Lifescience Database Archive (English)
Full Text Available 114062 Link to Original w[*]; P{GawB}NP7066 / TM6, P{UAS-lacZ.UW23-1}UW23-1 99A1 Li...nk to DGRC Genome Viewer: 114062 CG14508 CG31044 7066 3 FlyBase Insertion: P{GawB}NP7066 NP line. Received f...ment2:99A5 - - - - Show 114062 DGRC Number 114062 Link to Original Genotype w[*]; P{GawB}NP7066 / TM6, P{UAS...-lacZ.UW23-1}UW23-1 Insertion Site 99A1 Map Viewer Link to DGRC Genome Viewer: 114062 Related Genes CG14508
Directory of Open Access Journals (Sweden)
C. Venchiarutti
2011-11-01
Full Text Available Dissolved and particulate excess 230Th and 231Pa concentrations (noted 230Thxs and 231Paxs respectively and 231Paxs/230Thxs activity ratios were investigated on and out of the Kerguelen plateau (Southern Ocean in the framework of the Kerguelen Ocean and Plateau compared Study project in order to better understand the influence of particle flux and particle chemistry and advection on the scavenging of 231Pa.
In the wake of Kerguelen, particulate 231Paxs is relatively abundant compared to its content in the dissolved phase. This, together with the low fractionation observed between 230Th and 231Pa (FTh/Pa ranging from 0.06 ± 0.01 to 1.6 ± 0.2 reflects the domination of the biogenic silica in the particle pool.
Along the eastern escarpment of the Kerguelen plateau, the strong 231Paxs horizontal gradient in the deep waters highlights the intense removal of 231Pa at depth, as already observed for 230Thxs. This local boundary scavenging was attributed to re-suspension of opal-rich particles by nepheloid layers, resulting in fractionation factors FTh/Pa ≤ 1 along the Kerguelen plateau slope. Therefore, both the composition (biogenic opal and the flux (intense along the margin of particles control the scavenging of the two radionuclides in the Kerguelen wake.
The modelling of 231Pa distribution with an advection-scavenging model demonstrates that lateral advection of open ocean water on the Kerguelen plateau could supply most of the 231Pa, which is then efficiently scavenged on the highly productive plateau, as previously proposed for 230Thxs. It stresses that lateral advection can play a significant role in the overall
Lifescience Database Archive (English)
Full Text Available 112612 Link to Original y[*] w[*]; P{GawB}NP1294 / TM6, P{UAS-lacZ.UW23-1}UW23-1 --...- Link to DGRC Genome Viewer: 112612 CG40182 CG40188 1294 3 NP line. Received from the National Institute of... sg, tr abdomen - - - - - - - Show 112612 DGRC Number 112612 Link to Original Gen...otype y[*] w[*]; P{GawB}NP1294 / TM6, P{UAS-lacZ.UW23-1}UW23-1 Insertion Site --- Map Viewer Link to DGRC Genome Viewer: 112612... Related Genes CG40182 CG40188 Original Number 1294 Chr. 3 Comments NP line. Received fro
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
Publications | Page 231 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Think Tanks: en Marcha – la Iniciativa Think Tank Informe Anual 2010-2011. En nuestro Informe Anual 2010-2011 reflexionamos sobre nuestro tercer año de programación y presentamos a las instituciones apoyadas por la Iniciativa. El informe destaca la labor que realizan y el contexto en el que operan.
32 CFR 231.4 - General provisions.
2010-07-01
... establish an ongoing relationship with installation security authorities on all matters of asset protection... advertising, mailings or telecommunications to reach their customers. (6) Advertising in government-funded... Account (ITGA) depository), the financial institution shall satisfy the risk management standard...
Publications | Page 231 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Although the policy interventions are well understood, the political economy of ... Latin American and Caribbean Environmental Economics Program : annual ... a case for barrier-free access to mobile phones as a basic right (open access) ... community institutions of citizens is crucial to democratize local governance.
African Journals Online (AJOL)
userpc
Hepatotoxicity from these drugs have been linked to in part, the alterations in ... these drugs even in concurrent use. This study was ... being a clinical situation in cancer and malaria .... Effect of Oral Administration of Ethanolic Leaf. Extract of ...
49 CFR 238.231 - Brake system.
2010-10-01
...) Equipped with brake indicators as defined in § 238.5, designed so that the pressure sensor is placed in a... alcohol or other chemicals into the air brake system of passenger equipment is prohibited. (f) The...
2010-01-01
... pursuant to the Federal Tort Claims Act, as amended (28 U.S.C. 2671-2680), and the regulations of the..., determine, compromise, and settle, pursuant to the Federal Tort Claims Act as amended (28 U.S.C. 2671-2680... allege the negligence or wrongful act of an employee of a USDA agency; and consider, ascertain, adjust...
Lifescience Database Archive (English)
Full Text Available 112122 Link to Original y[*] w[*]; P{GawB}NP0275 / TM6, P{UAS-lacZ.UW23-1}UW23-1 47A12... ; -; 47A13 Link to DGRC Genome Viewer: 112122 lola psq 275 3 FlyBase Insertion: P{GawB}NP0275 NP line. R... 662 1 Request - muscle ubiquitous sg - - - - - - - - Show 112122 DGRC Number 11212...2 Link to Original Genotype y[*] w[*]; P{GawB}NP0275 / TM6, P{UAS-lacZ.UW23-1}UW23-1 Insertion Site 47A12 ...; -; 47A13 Map Viewer Link to DGRC Genome Viewer: 112122 Related Genes lola psq Original Number 275 Chr. 3 C
The Role of MMP-1 in Breast Cancer Growth and Metastasis to the Brain in a Xenograft Model
2012-12-07
particles (with puromycin as selection marker) (Thermo Scientific Co) targeting the following sequences: sh1: GAGTACAACTTACATCGTG; sh2 ...data not shown). shRNA lentiviruses targeting sh1 and sh2 sequences were used to infected 231-BR and 231-BR3 cells. Two pools of selected 231-BR cells...lentiviruses targeting sh1 and sh2 sequences were named sh1 and sh2 respectively. RNA-isolation and real-time RT-PCR Total RNAs from different cell lines and
2012-05-01
metastatic process (Condeelis and Pollard 2006), we quantitated macrophage recruitment in the lungs of mice injected with 231-Empty or 231-GATA3 cells by...image quantitation of Ki-67 expression and H&E staining of metastatic lung lesions using Apirio Image Analysis software (Figure 9) which demonstrated...expression in MD A-MB-231 and in another triple negative breast cancer cell line, Hs578T Transient knock down of GATA3 in the lum inal GATA3 positiv
Coumans, Joëlle V F; Gau, David; Poljak, Anne; Wasinger, Valerie; Roy, Partha; Moens, Pierre D J
2014-12-01
Despite early screening programs and new therapeutic strategies, metastatic breast cancer is still the leading cause of cancer death in women in industrialized countries and regions. There is a need for novel biomarkers of susceptibility, progression, and therapeutic response. Global analyses or systems science approaches with omics technologies offer concrete ways forward in biomarker discovery for breast cancer. Previous studies have shown that expression of profilin-1 (PFN1), a ubiquitously expressed actin-binding protein, is downregulated in invasive and metastatic breast cancer. It has also been reported that PFN1 overexpression can suppress tumorigenic ability and motility/invasiveness of breast cancer cells. To obtain insights into the underlying molecular mechanisms of how elevating PFN1 level induces these phenotypic changes in breast cancer cells, we investigated the alteration in global protein expression profiles of breast cancer cells upon stable overexpression of PFN1 by a combination of three different proteome analysis methods (2-DE, iTRAQ, label-free). Using MDA-MB-231 as a model breast cancer cell line, we provide evidence that PFN1 overexpression is associated with alterations in the expression of proteins that have been functionally linked to cell proliferation (FKPB1A, HDGF, MIF, PRDX1, TXNRD1, LGALS1, STMN1, LASP1, S100A11, S100A6), survival (HSPE1, HSPB1, HSPD1, HSPA5 and PPIA, YWHAZ, CFL1, NME1) and motility (CFL1, CORO1B, PFN2, PLS3, FLNA, FLNB, NME2, ARHGDIB). In view of the pleotropic effects of PFN1 overexpression in breast cancer cells as suggested by these new findings, we propose that PFN1-induced phenotypic changes in cancer cells involve multiple mechanisms. Our data reported here might also offer innovative strategies for identification and validation of novel therapeutic targets and companion diagnostics for persons with, or susceptibility to, breast cancer.
[Impact of siRNA-mediated down-regulation of CD147 on human breast cancer cells].
Li, Zhenqian; Li, Daoming; Li, Jiangwei; Huang, Pei; Qin, Hui
2015-10-01
To investigate the influence of siRNA-mediated down-regulation of CD147 on growth, proliferation and movement of human breast cancer cell line MDA-MB-231. The protein expression of CD147, MMP-2 and TIMP-2 of the MDA-MB-231 cells were analyzed by ABC. Lentiviral expression vector of CD147 gene was constructed and transfected into MDA-MB-231 cells. RT-PCR and Western blot were used to detect the mRNA and protein level changes of CD147 genes to identify the optimal time point, followed by detection of changes of mRNA and protein expression of MMP-2 and TIMP-2 genes. CCK-8 reagent method and cell scratch test were used to detect the proliferation and migration change of MDA-MB-231 cells. The nude mouse model of breast cancer by hypodermic injection with MDA-MB-231 cells was established to document the effect of CD147 siRNA on the tumor transplants. After transfection of lentiviral expression vector of CD147 gene, protein of CD147, MMP-2 and TIMP-2 were weakly or negative expressed, significantly weaker than those of control group (P CD147 and MMP-2 were 96.03% ± 0.84% and 96.03% ± 0.84%, respectively. Both CD147 mRNA and MMP-2 mRNA expression were down-regulated (P 0.05). No less than 2 days after transfection, cell growth of MDA-MB-231 cell line was found significantly inhibited (P CD147 led to reduction of volume and mass of nude mouses. The growth of the carcinoma transplant was inhibited upon siRNA-mediated down-regulation of CD147 (P CD147 may alter the MMP-2/TIMP-2 balance in MDA-MB-231 cells. CD147 gene silencing inhibits the proliferation and migration of MDA-MB-231 cells and the growth of carcinoma transplants in nude mice.
Energy Technology Data Exchange (ETDEWEB)
Yun, Bo La; Cho, Nariya; Li, Mulun; Song, In Chan; Moon, Woo Kyung [Dept. of Radiology, Seoul National University Hospital, Seoul National University College of Medicine, Seoul (Korea, Republic of); Jang, Min Hye; Park, So Yeon; Kim, Bo Young [Seoul National University Bundang Hospital, Seongnam (Korea, Republic of); Kang, Ho Chul [Dept. of Computer Science and Engineering, Seoul National University, Seoul (Korea, Republic of)
2014-10-15
To investigate whether there is a relationship between texture analysis parameters of apparent diffusion coefficient (ADC) maps and histopathologic features of MCF-7 and MDA-MB-231 xenograft models. MCF-7 estradiol (+), MCF-7 estradiol (-), and MDA-MB-231 xenograft models were made with approval of the animal care committee. Twelve tumors of MCF-7 estradiol (+), 9 tumors of MCF-7 estradiol (-), and 6 tumors in MDA-MB-231 were included. Diffusion-weighted MR images were obtained on a 9.4-T system. An analysis of the first and second order texture analysis of ADC maps was performed. The texture analysis parameters and histopathologic features were compared among these groups by the analysis of variance test. Correlations between texture parameters and histopathologic features were analyzed. We also evaluated the intraobserver agreement in assessing the texture parameters. MCF-7 estradiol (+) showed a higher standard deviation, maximum, skewness, and kurtosis of ADC values than MCF-7 estradiol (-) and MDA-MB-231 (p < 0.01 for all). The contrast of the MCF-7 groups was higher than that of the MDA-MB-231 (p 0.004). The correlation (COR) of the texture analysis of MCF-7 groups was lower than that of MDA-MB-231 (p < 0.001). The histopathologic analysis showed that Ki-67mean and Ki-67diff of MCF-7 estradiol (+) were higher than that of MCF-7 estradiol (-) or MDA-MB-231 (p < 0.05). The microvessel density (MVD)mean and MVDdiff of MDA-MB-231 were higher than those of MCF-7 groups (p < 0.001). A diffuse-multifocal necrosis was more frequently found in MDA-MB-231 (p < 0.001). The proportion of necrosis moderately correlated with the contrast (r = -0.438, p = 0.022) and strongly with COR (r = 0.540, p 0.004). Standard deviation (r = 0.622, r = 0.437), skewness (r = 0.404, r 0.484), and kurtosis (r = 0.408, r = 0.452) correlated with Ki-67 mean and Ki-67diff (p < 0.05 for all). COR moderately correlated with Ki-67diff (r -0.388, p = 0.045). Skewness (r = -0.643, r = -0
Experiment list: SRX891837 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available denocarcinoma || chip antibody=none (input) http://dbarc...ut, treated, replicate 2; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 || cell line=MDA-MB-231 || cell type=triple negative breast a
Czech Academy of Sciences Publication Activity Database
Kúnin, Michael
-, č. 231 (2004), s. 1-16 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z7085904 Keywords : intellectual property rights * software * piracy Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp231.pdf
Action of hexachlorobenzene on tumor growth and metastasis in different experimental models
International Nuclear Information System (INIS)
Pontillo, Carolina Andrea; Rojas, Paola; Chiappini, Florencia; Sequeira, Gonzalo; Cocca, Claudia; Crocci, Máximo; Colombo, Lucas; Lanari, Claudia
2013-01-01
Hexachlorobenzene (HCB) is a widespread organochlorine pesticide, considered a possible human carcinogen. It is a dioxin-like compound and a weak ligand of the aryl hydrocarbon receptor (AhR). We have found that HCB activates c-Src/HER1/STAT5b and HER1/ERK1/2 signaling pathways and cell migration, in an AhR-dependent manner in MDA-MB-231 breast cancer cells. The aim of this study was to investigate in vitro the effect of HCB (0.005, 0.05, 0.5, 5 μM) on cell invasion and metalloproteases (MMPs) 2 and 9 activation in MDA-MB-231 cells. Furthermore, we examined in vivo the effect of HCB (0.3, 3, 30 mg/kg b.w.) on tumor growth, MMP2 and MMP9 expression, and metastasis using MDA-MB-231 xenografts and two syngeneic mouse breast cancer models (spontaneous metastasis using C4-HI and lung experimental metastasis using LM3). Our results show that HCB (5 μM) enhances MMP2 expression, as well as cell invasion, through AhR, c-Src/HER1 pathway and MMPs. Moreover, HCB increases MMP9 expression, secretion and activity through a HER1 and AhR-dependent mechanism, in MDA-MB-231 cells. HCB (0.3 and 3 mg/kg b.w.) enhances subcutaneous tumor growth in MDA-MB-231 and C4-HI in vivo models. In vivo, using MDA-MB-231 model, the pesticide (0.3, 3 and 30 mg/kg b.w.) activated c-Src, HER1, STAT5b, and ERK1/2 signaling pathways and increased MMP2 and MMP9 protein levels. Furthermore, we observed that HCB stimulated lung metastasis regardless the tumor hormone-receptor status. Our findings suggest that HCB may be a risk factor for human breast cancer progression. - Highlights: ► HCB enhances MMP2 and MMP9 expression and cell invasion in MDA-MB-231, in vitro. ► HCB-effects are mediated through AhR, HER1 and/or c-Src. ► HCB increases subcutaneous tumor growth in MDA-MB-231 and C4-HI in vivo models. ► HCB activates c-Src/HER1 pathway and increases MMPs levels in MDA-MB-231 tumors. ► HCB stimulates lung metastasis in C4-HI and LM3 in vivo models
Action of hexachlorobenzene on tumor growth and metastasis in different experimental models
Energy Technology Data Exchange (ETDEWEB)
Pontillo, Carolina Andrea, E-mail: caroponti@hotmail.com [Laboratorio de Efectos Biológicos de Contaminantes Ambientales, Departamento de Bioquímica Humana, Facultad de Medicina, Universidad de Buenos Aires, Buenos Aires (Argentina); Rojas, Paola, E-mail: parojas2010@gmail.com [Laboratorio de Carcinogénesis Hormonal, Instituto de Biología y Medicina Experimental (IBYME-CONICET), Buenos Aires (Argentina); Chiappini, Florencia, E-mail: florenciachiappini@hotmail.com [Laboratorio de Efectos Biológicos de Contaminantes Ambientales, Departamento de Bioquímica Humana, Facultad de Medicina, Universidad de Buenos Aires, Buenos Aires (Argentina); Sequeira, Gonzalo, E-mail: chicon27_7@hotmail.com [Laboratorio de Carcinogénesis Hormonal, Instituto de Biología y Medicina Experimental (IBYME-CONICET), Buenos Aires (Argentina); Cocca, Claudia, E-mail: cm_cocca@hotmail.com [Laboratorio de Radioisótopos, Facultad de Farmacia y Bioquímica, Universidad de Buenos Aires, Buenos Aires (Argentina); Crocci, Máximo, E-mail: info@crescenti.com.ar [Instituto de Inmunooncología Crescenti, Buenos Aires (Argentina); Colombo, Lucas, E-mail: lucascol2003@yahoo.com.ar [Instituto de Oncología Angel Roffo, Universidad de Buenos Aires, Buenos Aires,Argentina (Argentina); Lanari, Claudia, E-mail: lanari.claudia@gmail.com [Laboratorio de Carcinogénesis Hormonal, Instituto de Biología y Medicina Experimental (IBYME-CONICET), Buenos Aires (Argentina); and others
2013-05-01
Hexachlorobenzene (HCB) is a widespread organochlorine pesticide, considered a possible human carcinogen. It is a dioxin-like compound and a weak ligand of the aryl hydrocarbon receptor (AhR). We have found that HCB activates c-Src/HER1/STAT5b and HER1/ERK1/2 signaling pathways and cell migration, in an AhR-dependent manner in MDA-MB-231 breast cancer cells. The aim of this study was to investigate in vitro the effect of HCB (0.005, 0.05, 0.5, 5 μM) on cell invasion and metalloproteases (MMPs) 2 and 9 activation in MDA-MB-231 cells. Furthermore, we examined in vivo the effect of HCB (0.3, 3, 30 mg/kg b.w.) on tumor growth, MMP2 and MMP9 expression, and metastasis using MDA-MB-231 xenografts and two syngeneic mouse breast cancer models (spontaneous metastasis using C4-HI and lung experimental metastasis using LM3). Our results show that HCB (5 μM) enhances MMP2 expression, as well as cell invasion, through AhR, c-Src/HER1 pathway and MMPs. Moreover, HCB increases MMP9 expression, secretion and activity through a HER1 and AhR-dependent mechanism, in MDA-MB-231 cells. HCB (0.3 and 3 mg/kg b.w.) enhances subcutaneous tumor growth in MDA-MB-231 and C4-HI in vivo models. In vivo, using MDA-MB-231 model, the pesticide (0.3, 3 and 30 mg/kg b.w.) activated c-Src, HER1, STAT5b, and ERK1/2 signaling pathways and increased MMP2 and MMP9 protein levels. Furthermore, we observed that HCB stimulated lung metastasis regardless the tumor hormone-receptor status. Our findings suggest that HCB may be a risk factor for human breast cancer progression. - Highlights: ► HCB enhances MMP2 and MMP9 expression and cell invasion in MDA-MB-231, in vitro. ► HCB-effects are mediated through AhR, HER1 and/or c-Src. ► HCB increases subcutaneous tumor growth in MDA-MB-231 and C4-HI in vivo models. ► HCB activates c-Src/HER1 pathway and increases MMPs levels in MDA-MB-231 tumors. ► HCB stimulates lung metastasis in C4-HI and LM3 in vivo models.
The prospect of uranium nitride (UN) and mixed nitride fuel (UN-PuN) for pressurized water reactor
International Nuclear Information System (INIS)
Syarifah, Ratna Dewi; Suud, Zaki
2015-01-01
Design study of small Pressurized Water Reactors (PWRs) core loaded with uranium nitride fuel (UN) and mixed nitride fuel (UN-PuN), Pa-231 as burnable poison, and Americium has been performed. Pa-231 known as actinide material, have large capture cross section and can be converted into fissile material that can be utilized to reduce excess reactivity. Americium is one of minor actinides with long half life. The objective of adding americium is to decrease nuclear spent fuel in the world. The neutronic analysis results show that mixed nitride fuel have k-inf greater than uranium nitride fuel. It is caused by the addition of Pu-239 in mixed nitride fuel. In fuel fraction analysis, for uranium nitride fuel, the optimum volume fractions are 45% fuel fraction, 10% cladding and 45% moderator. In case of UN-PuN fuel, the optimum volume fractions are 30% fuel fraction, 10% cladding and 60% coolant/ moderator. The addition of Pa-231 as burnable poison for UN fuel, enrichment U-235 5%, with Pa-231 1.6% has k-inf more than one and excess reactivity of 14.45%. And for mixed nitride fuel, the lowest value of reactivity swing is when enrichment (U-235+Pu) 8% with Pa-231 0.4%, the excess reactivity value 13,76%. The fuel pin analyze for the addition of Americium, the excess reactivity value is lower than before, because Americium absorb the neutron. For UN fuel, enrichment U-235 8%, Pa-231 1.6% and Am 0.5%, the excess reactivity is 4.86%. And for mixed nitride fuel, when enrichment (U-235+Pu) 13%, Pa-231 0.4% and Am 0.1%, the excess reactivity is 11.94%. For core configuration, it is better to use heterogeneous than homogeneous core configuration, because the radial power distribution is better
The prospect of uranium nitride (UN) and mixed nitride fuel (UN-PuN) for pressurized water reactor
Syarifah, Ratna Dewi; Suud, Zaki
2015-09-01
Design study of small Pressurized Water Reactors (PWRs) core loaded with uranium nitride fuel (UN) and mixed nitride fuel (UN-PuN), Pa-231 as burnable poison, and Americium has been performed. Pa-231 known as actinide material, have large capture cross section and can be converted into fissile material that can be utilized to reduce excess reactivity. Americium is one of minor actinides with long half life. The objective of adding americium is to decrease nuclear spent fuel in the world. The neutronic analysis results show that mixed nitride fuel have k-inf greater than uranium nitride fuel. It is caused by the addition of Pu-239 in mixed nitride fuel. In fuel fraction analysis, for uranium nitride fuel, the optimum volume fractions are 45% fuel fraction, 10% cladding and 45% moderator. In case of UN-PuN fuel, the optimum volume fractions are 30% fuel fraction, 10% cladding and 60% coolant/ moderator. The addition of Pa-231 as burnable poison for UN fuel, enrichment U-235 5%, with Pa-231 1.6% has k-inf more than one and excess reactivity of 14.45%. And for mixed nitride fuel, the lowest value of reactivity swing is when enrichment (U-235+Pu) 8% with Pa-231 0.4%, the excess reactivity value 13,76%. The fuel pin analyze for the addition of Americium, the excess reactivity value is lower than before, because Americium absorb the neutron. For UN fuel, enrichment U-235 8%, Pa-231 1.6% and Am 0.5%, the excess reactivity is 4.86%. And for mixed nitride fuel, when enrichment (U-235+Pu) 13%, Pa-231 0.4% and Am 0.1%, the excess reactivity is 11.94%. For core configuration, it is better to use heterogeneous than homogeneous core configuration, because the radial power distribution is better.
Yano, Shuya; Takehara, Kiyoto; Tazawa, Hiroshi; Kishimoto, Hiroyuki; Kagawa, Shunsuke; Bouvet, Michael; Fujiwara, Toshiyoshi; Hoffman, Robert M
2017-03-01
We previously developed and characterized a highly invasive and metastatic triple-negative breast cancer (TNBC) variant by serial orthotopic implantation of MDA-MB-231 human breast cancer cells in nude mice. Eventually, a highly invasive and metastatic variant of human TNBC was isolated after lymph node metastases was harvested and orthotopically re-implanted into the mammary gland of nude mice for two cycles. The variant thereby isolated is highly invasive in the mammary gland and metastasized to lymph nodes in 10 of 12 mice compared to 2 of 12 of the parental cell line. In the present report, we observed that high-metastatic MDA-MB-231H-RFP cells produced significantly larger subcutaneous tumors compared with parental MDA-MB-231 cells in nude mice. Extensive lymphatic trafficking by high-metastatic MDA-MB-231 cells was also observed. High-metastatic MDA-MB-231 developed larger recurrent tumors 2 weeks after tumor resection compared with tumors that were not resected in orthotopic models. Surgical resection of the MDA-MB-231 high-metastatic variant primary tumor in orthotopic models also resulted in rapid and enhanced lymphatic trafficking of residual cancer cells and extensive lymph node and lung metastasis that did not occur in the non-surgical mice. These results suggest that surgical resection of high metastatic TNBC can greatly increase the malignancy of residual cancer. J. Cell. Biochem. 118: 559-569, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Growth rates of iron-manganese concretions in the Pacific and Indian oceans
International Nuclear Information System (INIS)
Kuznetsov, Yu.V.; Pospelov, Yu.N.
1978-01-01
Radiochemical analysis has been used for studying the distribution of 231 Pa, 230 Th, 232 Th, 226 Ra, 234 U, and 238 U isotopes in nineteen iron-manganese concretions. The study has shown a considerable violation of the equilibrium between uranium and daughter isotopes, viz, protactinium-231 and thorium-230. A sharp decrease of the ratios between the 231 Pain concretions made it possible to find the growth rates of 10 concretions from pelagic regions of the Pacific and Indian oceans. The obtained data deviate in narrow limits and amount to (3-6)mm/10 6 years when evaluation is made according to 230 Th decay and (4-7)mm/10 6 years when 231 Pa is used. The presence of Ra excess (as compared with mother isotopes 230 Th) in inner layers of the concretions points to the fact that the growth rates determined by the radium method are raised too high due to radium migration from the surface layers into the depth of the concretion. It is shown that accumulation of 231 Pa and 230 Th in concretions accounts for a small part (less than 25%) of their production from uranium dissolved in the sea water
Hematpoor, Arshia; Paydar, Mohammadjavad; Liew, Sook Yee; Sivasothy, Yasodha; Mohebali, Nooshin; Looi, Chung Yeng; Wong, Won Fen; Azirun, Mohd Sofian; Awang, Khalijah
2018-01-05
The aim of the present study is to isolate bioactive compounds from the roots of Piper sarmentosum and examine the mechanism of action using human breast cancer cell line (MDA-MB-231). Bioassay guided-fractionation of methanolic extract led to the isolation of asaricin (1) and isoasarone (2). Asaricin (1) and isoasarone (2) had significant cytotoxicity towards MDA-MB-231. MCF-10A (human normal breast epithelial cells) cells are less sensitive than MDA-MB-231, but they respond to the treatment with the same unit of measurement. Both compounds increase reactive oxygen species (ROS), decrease mitochondrial membrane potential (MMP) and enhance cytochrome c release in treated MDA-MB-231 cells. Isoasarone (2) markedly elevated caspase -8 and -3/7 activities and caused a decline in nuclear NF-κB translocation, suggesting extrinsic, death receptor-linked apoptosis pathway. Quantitative PCR results of MDA-MB-231 treated with asaricin (1) and isoasarone (2) showed altered expression of Bcl-2: Bax level. The inhibitory potency of these isolates may support the therapeutic uses of these compounds in breast cancer. Copyright © 2017 Elsevier B.V. All rights reserved.
Experiment list: SRX891827 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available d, replicate 2; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 || cell line=MDA-MB-231 || cell type=triple negative breast adenocarcin...oma || chip antibody=H3K9ac, Millipore #07-352, Lot 2388
Experiment list: SRX891826 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ed, replicate 1; Homo sapiens; ChIP-Seq source_name=MDA-MB-231 || cell line=MDA-MB-231 || cell type=triple negative breast adenocarci...noma || chip antibody=H3K9ac, Millipore #07-352, Lot 238
Střednědobá makroekonomická predikce: makroekonomické modely v analytickém systému ČNB
Czech Academy of Sciences Publication Activity Database
Beneš, J.; Vávra, David; Vlček, J.
2002-01-01
Roč. 52, č. 4 (2002), s. 197-231 ISSN 0015-1920 Keywords : monetary policy * central bank * medium-term macroeconomic modeling Subject RIV: AH - Economics Impact factor: 0.222, year: 2002 http://journal.fsv.cuni.cz/ storage /287_197_231.pdf
32 CFR 231.5 - Procedures-domestic banks.
2010-07-01
.... 2667. Periodic reappraisals shall be based upon the fair market rental value exclusive of the... understand the potential loss of the building in the event of installation closure or other delimiting... shall encourage their conversion to independent or branch banks. (ii) Proposals from the on-base banking...
Gender | Page 231 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Language English ... Managing Natural Resources for Sustainable Livelihoods analyses and extends this premise to show unequivocally that the process of ... Is Latin America moving toward a new generation of pro-poor land reforms?
32 CFR 231.6 - Procedures-overseas banks.
2010-07-01
... depository used to make official deposits for credit to the TGA. (E) A list of organizational and... underwrite such banking services. (D) Establishment of a U.S. dollar currency custody account to support... identified and either the banking and currency control laws of certain host countries do not permit MBFs to...
Gender | Page 231 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
“And I thought: I'm really not making the world a better place,” she says. ... and their full potential as citizens and equal partners in decision-making and development. ... Equity issues are again attracting attention from academics and policy ...
46 CFR 107.231 - Inspection for certification.
2010-10-01
... effectively carry out abandonment and fire fighting procedures. Fire Fighting Equipment (h) Each hand portable... accordance with § 107.235(a). (i) Each fixed fire-extinguishing system is inspected, and serviced if required, in accordance with § 107.235(b). (j) Each fire main system meets the testing requirements in § 107...
Directory of Open Access Journals (Sweden)
Marie Lue Antony
Full Text Available Benzyl isothiocyanate (BITC, a constituent of edible cruciferous vegetables, decreases viability of cancer cells by causing apoptosis but the mechanism of cell death is not fully understood. The present study was undertaken to determine the role of Bcl-2 family proteins in BITC-induced apoptosis using MDA-MB-231 (breast, MCF-7 (breast, and HCT-116 (colon human cancer cells. The B-cell lymphoma 2 interacting mediator of cell death (Bim protein was dispensable for proapoptotic response to BITC in MCF-7 and MDA-MB-231 cells as judged by RNA interference studies. Instead, the BITC-treated MCF-7 and MDA-MB-231 cells exhibited upregulation of p53 upregulated modulator of apoptosis (PUMA protein. The BITC-mediated induction of PUMA was relatively more pronounced in MCF-7 cells due to the presence of wild-type p53 compared with MDA-MB-231 with mutant p53. The BITC-induced apoptosis was partially but significantly attenuated by RNA interference of PUMA in MCF-7 cells. The PUMA knockout variant of HCT-116 cells exhibited significant resistance towards BITC-induced apoptosis compared with wild-type HCT-116 cells. Attenuation of BITC-induced apoptosis in PUMA knockout HCT-116 cells was accompanied by enhanced G2/M phase cell cycle arrest due to induction of p21 and down regulation of cyclin-dependent kinase 1 protein. The BITC treatment caused a decrease in protein levels of Bcl-xL (MCF-7 and MDA-MB-231 cells and Bcl-2 (MCF-7 cells. Ectopic expression of Bcl-xL in MCF-7 and MDA-MB-231 cells and that of Bcl-2 in MCF-7 cells conferred protection against proapoptotic response to BITC. Interestingly, the BITC-treated MDA-MB-231 cells exhibited induction of Bcl-2 protein expression, and RNA interference of Bcl-2 in this cell line resulted in augmentation of BITC-induced apoptosis. The BITC-mediated inhibition of MDA-MB-231 xenograft growth in vivo was associated with the induction of PUMA protein in the tumor. In conclusion, the results of the present study
Lifescience Database Archive (English)
Full Text Available 114063 Link to Original w[*]; P{GawB}NP7072 / TM6, P{UAS-lacZ.UW23-1}UW23-1 - - - 7...t. lateral cell cluster, ch, tr, mt - - - - - - - - Show 114063 DGRC Number 114063 Link to Original Genotype
International Nuclear Information System (INIS)
Shiotsuki, Masao; Miyahara, Kaname
2003-01-01
The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)
International Nuclear Information System (INIS)
Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.
2011-01-01
South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
International Nuclear Information System (INIS)
Hoshiba, Takashi; Tanaka, Masaru
2013-01-01
Highlights: •Models mimicking ECM in tumor with different malignancy were prepared. •Cancer cell proliferation was suppressed on benign tumor ECM. •Benign tumor cell proliferation was suppressed on cancerous ECM. •Chemoresistance of cancer cell was enhanced on cancerous ECM. -- Abstract: Extracellular matrix (ECM) has been focused to understand tumor progression in addition to the genetic mutation of cancer cells. Here, we prepared “staged tumorigenesis-mimicking matrices” which mimic in vivo ECM in tumor tissue at each malignant stage to understand the roles of ECM in tumor progression. Breast tumor cells, MDA-MB-231 (invasive), MCF-7 (non-invasive), and MCF-10A (benign) cells, were cultured to form their own ECM beneath the cells and formed ECM was prepared as staged tumorigenesis-mimicking matrices by decellularization treatment. Cells showed weak attachment on the matrices derived from MDA-MB-231 cancer cells. The proliferations of MDA-MB-231 and MCF-7 was promoted on the matrices derived from MDA-MB-231 cancer cells whereas MCF-10A cell proliferation was not promoted. MCF-10A cell proliferation was promoted on the matrices derived from MCF-10A cells. Chemoresistance of MDA-MB-231 cells against 5-fluorouracil increased on only matrices derived from MDA-MB-231 cells. Our results showed that the cells showed different behaviors on staged tumorigenesis-mimicking matrices according to the malignancy of cell sources for ECM preparation. Therefore, staged tumorigenesis-mimicking matrices might be a useful in vitro ECM models to investigate the roles of ECM in tumor progression
Energy Technology Data Exchange (ETDEWEB)
Hoshiba, Takashi [Graduate School of Science and Engineering, Yamagata University, 4-3-16 Jonan, Yonezawa, Yamagata 992-8510 (Japan); International Center for Materials Nanoarchitectonics (MANA), National Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan); Tanaka, Masaru, E-mail: tanaka@yz.yamagata-u.ac.jp [Graduate School of Science and Engineering, Yamagata University, 4-3-16 Jonan, Yonezawa, Yamagata 992-8510 (Japan)
2013-09-20
Highlights: •Models mimicking ECM in tumor with different malignancy were prepared. •Cancer cell proliferation was suppressed on benign tumor ECM. •Benign tumor cell proliferation was suppressed on cancerous ECM. •Chemoresistance of cancer cell was enhanced on cancerous ECM. -- Abstract: Extracellular matrix (ECM) has been focused to understand tumor progression in addition to the genetic mutation of cancer cells. Here, we prepared “staged tumorigenesis-mimicking matrices” which mimic in vivo ECM in tumor tissue at each malignant stage to understand the roles of ECM in tumor progression. Breast tumor cells, MDA-MB-231 (invasive), MCF-7 (non-invasive), and MCF-10A (benign) cells, were cultured to form their own ECM beneath the cells and formed ECM was prepared as staged tumorigenesis-mimicking matrices by decellularization treatment. Cells showed weak attachment on the matrices derived from MDA-MB-231 cancer cells. The proliferations of MDA-MB-231 and MCF-7 was promoted on the matrices derived from MDA-MB-231 cancer cells whereas MCF-10A cell proliferation was not promoted. MCF-10A cell proliferation was promoted on the matrices derived from MCF-10A cells. Chemoresistance of MDA-MB-231 cells against 5-fluorouracil increased on only matrices derived from MDA-MB-231 cells. Our results showed that the cells showed different behaviors on staged tumorigenesis-mimicking matrices according to the malignancy of cell sources for ECM preparation. Therefore, staged tumorigenesis-mimicking matrices might be a useful in vitro ECM models to investigate the roles of ECM in tumor progression.
Directory of Open Access Journals (Sweden)
Yusra Al Dhaheri
Full Text Available BACKGROUND: We have recently reported that Origanummajorana exhibits anticancer activity by promoting cell cycle arrest and apoptosis of the metastatic MDA-MB-231 breast cancer cell line. Here, we extended our study by investigating the effect of O. majorana on the migration, invasion and tumor growth of these cells. RESULTS: We demonstrate that non-cytotoxic concentrations of O. majorana significantly inhibited the migration and invasion of the MDA-MB-231 cells as shown by wound-healing and matrigel invasion assays. We also show that O. majorana induce homotypic aggregation of MDA-MB-231 associated with an upregulation of E-cadherin protein and promoter activity. Furthermore, we show that O. majorana decrease the adhesion of MDA-MB-231 to HUVECs and inhibits transendothelial migration of MDA-MB-231 through TNF-α-activated HUVECs. Gelatin zymography assay shows that O. majorana suppresses the activities of matrix metalloproteinase-2 and -9 (MMP-2 and MMP-9. ELISA, RT-PCR and Western blot results revealed that O. majorana decreases the expression of MMP-2, MMP-9, urokinase plasminogen activator receptor (uPAR, ICAM-1 and VEGF. Further investigation revealed that O. majorana suppresses the phosphorylation of IκB, downregulates the nuclear level of NFκB and reduces Nitric Oxide (NO production in MDA-MB-231 cells. Most importantly, by using chick embryo tumor growth assay, we also show that O. majorana promotes inhibition of tumor growth and metastasis in vivo. CONCLUSION: Our findings identify Origanummajorana as a promising chemopreventive and therapeutic candidate that modulate breast cancer growth and metastasis.
International Nuclear Information System (INIS)
Lee, Carol M; Tannock, Ian F
2010-01-01
Poor distribution of some anticancer drugs in solid tumors may limit their anti-tumor activity. Here we used immunohistochemistry to quantify the distribution of the therapeutic monoclonal antibodies cetuximab and trastuzumab in relation to blood vessels and to regions of hypoxia in human tumor xenografts. The antibodies were injected into mice implanted with human epidermoid carcinoma A431 or human breast carcinoma MDA-MB-231 transfected with ERBB2 (231-H2N) that express high levels of ErbB1 and ErbB2 respectively, or wild-type MDA-MB-231, which expresses intermediate levels of ErbB1 and low levels of ErbB2. The distribution of cetuximab in A431 xenografts and trastuzumab in 231-H2N xenografts was time and dose dependent. At early intervals after injection of 1 mg cetuximab into A431 xenografts, the concentration of cetuximab decreased with increasing distance from blood vessels, but became more uniformly distributed at later times; there remained however limited distribution and binding in hypoxic regions of tumors. Injection of lower doses of cetuximab led to heterogeneous distributions. Similar results were observed with trastuzumab in 231-H2N xenografts. In MDA-MB-231 xenografts, which express lower levels of ErbB1, homogeneity of distribution of cetuximab was achieved more rapidly. Cetuximab and trastuzumab distribute slowly, but at higher doses achieve a relatively uniform distribution after about 24 hours, most likely due to their long half-lives in the circulation. There remains poor distribution within hypoxic regions of tumors
2013-07-16
... Prepare a Supplemental Environmental Impact Statement (EIS) SUMMARY: Consistent with the regulations... 248; Central Planning Area (CPA) Lease Sales 227, 231, 235, 241, and 247, Final Environmental Impact... Supplemental Environmental Impact Statement (OCS EIS/EA BOEM 2013-0118) (WPA 233/CPA 231 Supplemental EIS). The...
Vaccination of High-Risk Breast Cancer Patients with Carbohydrate Mimicking Peptides
2008-05-01
we tested sera from immunized C57Bl6 mice against several carbohydrate expressing cells such as EL4 cells and MDA-231 for their ability to mediate... EL4 231 0 5 10 15 20 Na•ve anti-P10S Serum % o f c yt ot ox ic ity Figure 1. P10s anti-sera does not mediate CDC against antigen tumor cell ...lines. MDA-231 and EL4 cells were incubated with 1:50 P10s anti-sera and 1:4 rabbit serum for 4 hours. The number of viable cells was determined and the
Energy Technology Data Exchange (ETDEWEB)
Tang, Shihao [Department of Occupational Health and Occupational Medicine, School of Public Health and Tropical Medicine, Southern Medical University, Guangzhou, Guangdong (China); Guangzhou No.12 Hospital, Guangzhou (China); Wang, Xubu [Department of Occupational Health and Occupational Medicine, School of Public Health and Tropical Medicine, Southern Medical University, Guangzhou, Guangdong (China); Shen, Qiang [Department of Clinical Cancer Prevention, The University of Texas MD Anderson Cancer Center, Houston, TX (United States); Yang, Xinyi; Yu, Changhui; Cai, Chunqing [Department of Occupational Health and Occupational Medicine, School of Public Health and Tropical Medicine, Southern Medical University, Guangzhou, Guangdong (China); Cai, Guoshuai [Department of Bioinformatics and Computational Biology, The University of Texas MD Anderson Cancer Center, Houston, TX (United States); Meng, Xiaojing, E-mail: xiaojingmeng@smu.edu.cn [Department of Occupational Health and Occupational Medicine, School of Public Health and Tropical Medicine, Southern Medical University, Guangzhou, Guangdong (China); Zou, Fei, E-mail: zoufei616@163.com [Department of Occupational Health and Occupational Medicine, School of Public Health and Tropical Medicine, Southern Medical University, Guangzhou, Guangdong (China)
2015-02-27
Metastasis of cancer cells is a complicated multistep process requiring extensive and continuous cytosolic calcium modulation. Mitochondrial Ca{sup 2+} uniporter (MCU), a regulator of mitochondrial Ca{sup 2+} uptake, has been implicated in energy metabolism and various cellular signaling processes. However, whether MCU contributes to cancer cell migration has not been established. Here we examined the expression of MCU mRNA in the Oncomine database and found that MCU is correlated to metastasis and invasive breast cancer. MCU inhibition by ruthenium red (RuR) or MCU silencing by siRNA abolished serum-induced migration in MDA-MB-231 breast cancer cells and reduced serum- or thapsigargin (TG)-induced store-operated Ca2+ entry (SOCE). Serum-induced migrations in MDA-MB-231 cells were blocked by SOCE inhibitors. Our results demonstrate that MCU plays a critical role in breast cancer cell migration by regulating SOCE. - Highlights: • MCU is correlated to metastasis and invasive breast cancer. • MCU inhibition abolished serum-induced migration in MDA-MB-231 breast cancer cells and reduced serum- or TG-induced SOCE. • Serum-induced migrations in MDA-MB-231 cells were blocked by SOCE inhibitors. • MCU plays a critical role in MDA-MB-231 cell migration by regulating SOCE.
International Nuclear Information System (INIS)
Tang, Shihao; Wang, Xubu; Shen, Qiang; Yang, Xinyi; Yu, Changhui; Cai, Chunqing; Cai, Guoshuai; Meng, Xiaojing; Zou, Fei
2015-01-01
Metastasis of cancer cells is a complicated multistep process requiring extensive and continuous cytosolic calcium modulation. Mitochondrial Ca 2+ uniporter (MCU), a regulator of mitochondrial Ca 2+ uptake, has been implicated in energy metabolism and various cellular signaling processes. However, whether MCU contributes to cancer cell migration has not been established. Here we examined the expression of MCU mRNA in the Oncomine database and found that MCU is correlated to metastasis and invasive breast cancer. MCU inhibition by ruthenium red (RuR) or MCU silencing by siRNA abolished serum-induced migration in MDA-MB-231 breast cancer cells and reduced serum- or thapsigargin (TG)-induced store-operated Ca2+ entry (SOCE). Serum-induced migrations in MDA-MB-231 cells were blocked by SOCE inhibitors. Our results demonstrate that MCU plays a critical role in breast cancer cell migration by regulating SOCE. - Highlights: • MCU is correlated to metastasis and invasive breast cancer. • MCU inhibition abolished serum-induced migration in MDA-MB-231 breast cancer cells and reduced serum- or TG-induced SOCE. • Serum-induced migrations in MDA-MB-231 cells were blocked by SOCE inhibitors. • MCU plays a critical role in MDA-MB-231 cell migration by regulating SOCE
Lifescience Database Archive (English)
Full Text Available 69 3 NP line. Received from the National Institute of Genetics. TM6UW23-1 - 2 - - 0 - a small # of cells sg ... Number 169 Chr. 3 Comments NP line. Received from the National Institute of Genetics. Balancer TM6UW23-1 Li
Lifescience Database Archive (English)
Full Text Available 42 3 NP line. Received from the National Institute of Genetics. TM6UW23-1 - 2 - - 0 - sg, a small # of cells...mber 242 Chr. 3 Comments NP line. Received from the National Institute of Genetics. Balancer TM6UW23-1 Link
NCBI nr-aa BLAST: CBRC-FCAT-01-1240 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-1240 ref|ZP_01126060.1| DNA internalization-related competence protein... ComEC/Rec2 [Nitrococcus mobilis Nb-231] gb|EAR23543.1| DNA internalization-related competence protein ComEC/Rec2 [Nitrococcus mobilis Nb-231] ZP_01126060.1 3.6 31% ...
Lifescience Database Archive (English)
Full Text Available 090 3 NP line. Received from the National Institute of Genetics. TM6UW23-1 - 2 - - 0 - weak tr (DT) sg, tr -...0 Chr. 3 Comments NP line. Received from the National Institute of Genetics. Balancer TM6UW23-1 Link to Clon
2014-09-18
9 2.3.1 The Lune Aqueduct... Lune Aqueduct, 9 January 2010 (Taylor 2010) .............................. 10 5 Pontcysyllte Aqueduct, 3 December 2010...full in winter or are drained. Below we discuss existing aqueducts that op- erate in cold regions, and Table 1 summarizes these. 2.3.1 The Lune
International Nuclear Information System (INIS)
Wang, Yifan; Li, Shu Jie; Pan, Juncheng; Che, Yongzhe; Yin, Jian; Zhao, Qing
2011-01-01
Highlights: → Hv1 is specifically expressed in highly metastatic human breast tumor tissues. → Hv1 regulates breast cancer cytosolic pH. → Hv1 acidifies extracellular milieu. → Hv1 exacerbates the migratory ability of metastatic cells. -- Abstract: The newly discovered human voltage-gated proton channel Hv1 is essential for proton transfer, which contains a voltage sensor domain (VSD) without a pore domain. We report here for the first time that Hv1 is specifically expressed in the highly metastatic human breast tumor tissues, but not in poorly metastatic breast cancer tissues, detected by immunohistochemistry. Meanwhile, real-time RT-PCR and immunocytochemistry showed that the expression levels of Hv1 have significant differences among breast cancer cell lines, MCF-7, MDA-MB-231, MDA-MB-468, MDA-MB-453, T-47D and SK-BR-3, in which Hv1 is expressed at a high level in highly metastatic human breast cancer cell line MDA-MB-231, but at a very low level in poorly metastatic human breast cancer cell line MCF-7. Inhibition of Hv1 expression in the highly metastatic MDA-MB-231 cells by small interfering RNA (siRNA) significantly decreases the invasion and migration of the cells. The intracellular pH of MDA-MB-231 cells down-regulated Hv1 expression by siRNA is obviously decreased compared with MDA-MB-231 with the scrambled siRNA. The expression of matrix metalloproteinase-2 and gelatinase activity in MDA-MB-231 cells suppressed Hv1 by siRNA were reduced. Our results strongly suggest that Hv1 regulates breast cancer intracellular pH and exacerbates the migratory ability of metastatic cells.
TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER
International Nuclear Information System (INIS)
Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.
2004-01-01
As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and
Area Handbook Series: Cyprus: A Country Study
1991-01-01
the forces of the Egyptian pharaoh, Thutmose III, invaded the island. After 1400 B.C., Mycenaean and Mycenaean -Achaean traders from the northeastern... Mycenaeans : as settlers, 5; trade with, ish, 33 5-7 military spending, 230-31; amount, 231; ’udgets for, 230; as percentage of GNP, 231; sources of, 230
Miller, Scott R.; Brody, Gene H.; Murry, Velma M.
2010-01-01
We assessed the extent to which youths' (n = 231) shyness and social acceptance in preadolescence were associated with parents' responsive problem solving 1 year later after controlling for initial levels of parents' problem solving. Teachers (n = 176) completed assessments of youths' shyness and social acceptance, and parents (n = 231 married…
111In-BnDTPA-F3: an Auger electron-emitting radiotherapeutic agent that targets nucleolin.
Cornelissen, Bart; Waller, Andrew; Target, Carol; Kersemans, Veerle; Smart, Sean; Vallis, Katherine A
2012-02-20
The F3 peptide (KDEPQRRSARLSAKPAPPKPEPKPKKAPAKK), a fragment of the human high mobility group protein 2, binds nucleolin. Nucleolin is expressed in the nuclei of normal cells but is also expressed on the membrane of some cancer cells. The goal was to investigate the use of 111In-labeled F3 peptide for Auger electron-targeted radiotherapy. F3 was labeled with fluorescein isothiocyanate (FITC) for confocal microscopy and conjugated to p-SCN-benzyl-diethylenetriaminepentaacetic acid (BnDTPA) for labeling with 111In to form 111In-BnDTPA-F3. MDA-MB-231-H2N (231-H2N) human breast cancer cells were exposed to 111In-BnDTPA-F3 and used in cell fractionation, γH2AX immunostaining (a marker of DNA double-strand breaks), and clonogenic assays. In vivo, biodistribution studies of 111In-BnDTPA-F3 were performed in 231-H2N xenograft-bearing mice. In tumor growth delay studies, 111In-BnDTPA-F3 (3 μg, 6 MBq/μg) was administered intravenously to 231-H2N xenograft-bearing mice once weekly for 3 weeks. Membrane-binding of FITC-F3 was observed in 231-H2N cells, and there was co-localization of FITC-F3 with nucleolin in the nuclei. After exposure of 231-H2N cells to 111In-BnDTPA-F3 for 2 h, 1.7% of 111In added to the medium was membrane-bound. Of the bound 111In, 15% was internalized, and of this, 37% was localized in the nucleus. Exposure of 231-H2N cells to 111In-BnDTPA-F3 (1 μM, 6 MBq/μg) resulted in a dose-dependent increase in γH2AX foci and in a significant reduction of clonogenic survival compared to untreated cells or cells exposed to unlabeled BnDTPA-F3 (46 ± 4.1%, 100 ± 1.8%, and 132 ± 7.7%, respectively). In vivo, tumor uptake of 111In-BnDTPA-F3 (3 μg, 6 MBq/μg) at 3-h post-injection was 1% of the injected dose per gram (%ID/g), and muscle uptake was 0.5%ID/g. In tumor growth delay studies, tumor growth rate was reduced 19-fold compared to untreated or unlabeled BnDTPA-F3-treated mice (p = 0.023). 111In-BnDTPA-F3 is internalized into 231-H2N cells and translocates
DEFF Research Database (Denmark)
Thorsen, Thor S; Madsen, Kenneth L; Rebola, Nelson
2010-01-01
interacting protein 1 (GRIP1). Pretreatment of cultured hippocampal neurons with FSC231 inhibited coimmunopreciptation of the AMPA receptor GluR2 subunit with PICK1. In agreement with inhibiting the role of PICK1 in GluR2 trafficking, FSC231 accelerated recycling of pHluorin-tagged GluR2 in hippocampal...
Richard Tran Mills; Jitendra Kumar; Forrest M. Hoffman; William W. Hargrove; Joseph P. Spruce; Steven P. Norman
2013-01-01
We investigated the use of principal components analysis (PCA) to visualize dominant patterns and identify anomalies in a multi-year land surface phenology data set (231 m à 231 m normalized difference vegetation index (NDVI) values derived from the Moderate Resolution Imaging Spectroradiometer (MODIS)) used for detecting threats to forest health in the conterminous...
Octupole Deformed Nuclei in the Actinide Region
Thorsteinsen, T; Rubio barroso, B; Simpson, J; Gulda, K; Sanchez-vega, M; Cocks, J; Nybo, K; Garcia borge, M; Aas, A; Fogelberg, B; Honsi, J; Smith, G; Naumann, R; Grant, I
2002-01-01
The aim of the present study is to investigate the limits of the "island" of octupole deformation in the mass region A=225. It is of particular importance to demonstrate experimentally the sudden disappearance of the stable octupole deformation in the presence of a well developed quadrupole field. \\\\ \\\\In order to establish the upper border line the $\\beta$ -decay chains of $^{227}$Rn $\\rightarrow ^{227}$Fr $\\rightarrow ^{227}$Ra and $^{231}$Fr $\\rightarrow ^{231}$Ra $\\rightarrow ^{231}$Ac were studied at PSB-ISOLDE using advanced fast timing and $\\gamma$-ray spectroscopy techniques. The lifetimes of the excited states have been measured in the picosecond range using the time-delayed $\\beta\\gamma\\gamma$(t) method.
The diverse roles of glutathione-associated cell resistance against hypericin photodynamic therapy
Directory of Open Access Journals (Sweden)
Theodossis A. Theodossiou
2017-08-01
Full Text Available The diverse responses of different cancers to treatments such as photodynamic therapy of cancer (PDT have fueled a growing need for reliable predictive markers for treatment outcome. In the present work we have studied the differential response of two phenotypically and genotypically different breast adenocarcinoma cell lines, MCF7 and MDA-MB-231, to hypericin PDT (HYP-PDT. MDA-MB-231 cells were 70% more sensitive to HYP PDT than MCF7 cells at LD50. MCF7 were found to express a substantially higher level of glutathione peroxidase (GPX4 than MDA-MB-231, while MDA-MB-231 differentially expressed glutathione-S-transferase (GSTP1, mainly used for xenobiotic detoxification. Eighty % reduction of intracellular glutathione (GSH by buthionine sulfoximine (BSO, largely enhanced the sensitivity of the GSTP1 expressing MDA-MB-231 cells to HYP-PDT, but not in MCF7 cells. Further inhibition of the GSH reduction however by carmustine (BCNU resulted in an enhanced sensitivity of MCF7 to HYP-PDT. HYP loading studies suggested that HYP can be a substrate of GSTP for GSH conjugation as BSO enhanced the cellular HYP accumulation by 20% in MDA-MB-231 cells, but not in MCF7 cells. Studies in solutions showed that L-cysteine can bind the GSTP substrate CDNB in the absence of GSTP. This means that the GSTP-lacking MCF7 may use L-cysteine for xenobiotic detoxification, especially during GSH synthesis inhibition, which leads to L-cysteine build-up. This was confirmed by the lowered accumulation of HYP in both cell lines in the presence of BSO and the L-cysteine source NAC. NAC reduced the sensitivity of MCF7, but not MDA-MB-231, cells to HYP PDT which is in accordance with the antioxidant effects of L-cysteine and its potential as a GSTP substrate. As a conclusion we have herein shown that the different GSH based cell defense mechanisms can be utilized as predictive markers for the outcome of PDT and as a guide for selecting optimal combination strategies. Keywords
Perumalsamy, Haribalan; Sankarapandian, Karuppasamy; Kandaswamy, Narendran; Balusamy, Sri Renukadevi; Periyathambi, Dhaiveegan; Raveendiran, Nanthini
2017-11-01
Coumarins occurs naturally across plant kingdoms exhibits significant pharmacological properties and pharmacokinetic activity. The conventional, therapeutic agents are often associated with poor stability, absorption and increased side effects. Therefore, identification of a drug that has little or no-side effect on humans is consequential. Here, we investigated the antiproliferative activity of styrene substituted biscoumarin against various human breast cancer cell lines, such as MCF-7, (ER-) MDA-MB-231 and (AR+) MDA-MB-453. Styrene substituted biscoumarin induced cell death by apoptosis in MDA-MB-231 cell line was analyzed. Antiproliferative activity of Styrene substituted biscoumarin was performed by using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT) assay. Styrene substituted biscoumarin induced apoptosis was assessed by Hoechst staining, Annexin V-fluorescein isothiocyanate/propidium iodide (Annexin V-FITC/PI) staining and flow cytometric analysis. Migratory and proliferating characteristic of breast cancer cell line MDA-MB-231 was also analyzed by wound healing and colony formation assay. Furthermore, mRNA expression of BAX and BCL-2 were quantified using qRT-PCR and protein expression level analyzed by Western blot. The inhibition concentration (IC 50 ) of styrene substituted biscoumarin was assayed against three breast cancer cell lines. The inhibition concentration (IC 50 ) value of styrene substituted biscoumarin toward MDA-MB-231, MDA-MB-453 and MCF-7 cell lines was 5.63, 7.30 and 10.84μg/ml respectively. Styrene substituted biscoumarin induced apoptosis was detected by Hoechst staining, DAPI/PI analysis and flow-cytometric analysis. The migration and proliferative efficiency of MDA-MB-231 cells were completely arrested upon styrene substituted biscoumarin treatment. Also, mRNA gene expression and protein expression of pro-apoptotic (BAX) and anti-apoptotic (BCL-2) genes were analyzed by qRT-PCR and western blot analysis upon
Directory of Open Access Journals (Sweden)
Yang XL
2014-06-01
Full Text Available Xiao Li Yang, Feng Juan Lin, Ya Jie Guo, Zhi Min Shao, Zhou Luo Ou Key Laboratory of Breast Cancer in Shanghai, Breast Cancer Institute, Cancer Hospital, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai, People's Republic of China Abstract: Chemoresistance is a major cause of cancer treatment failure and leads to a reduction in the survival rate of cancer patients. Phosphatidylinositol 3-kinase/protein kinase B/mammalian target of rapamycin (PI3K/AKT/mTOR and mitogen-activated protein kinase (MAPK pathways are aberrantly activated in many malignant tumors, including breast cancer, which may indicate an association with breast cancer chemoresistance. In this study, we generated a chemoresistant human breast cancer cell line, MDA-MB-231/gemcitabine (simplified hereafter as “231/Gem”, from MDA-MB-231 human breast cancer cells. Flow cytometry studies revealed that with the same treatment concentration of gemcitabine, 231/Gem cells displayed more robust resistance to gemcitabine, which was reflected by fewer apoptotic cells and enhanced percentage of S-phase cells. Through the use of inverted microscopy, Cell Counting Kit-8, and Transwell assays, we found that compared with parental 231 cells, 231/Gem cells displayed more morphologic projections, enhanced cell proliferative ability, and improved cell migration and invasion. Mechanistic studies revealed that the PI3K/AKT/mTOR and mitogen-activated protein kinase kinase (MEK/MAPK signaling pathways were activated through elevated expression of phosphorylated (p-extracellular signal-regulated kinase (ERK, p-AKT, mTOR, p-mTOR, p-P70S6K, and reduced expression of p-P38 and LC3-II (the marker of autophagy in 231/Gem in comparison to control cells. However, there was no change in the expression of Cyclin D1 and p-adenosine monophosphate-activated protein kinase (AMPK. In culture, inhibitors of PI3K/AKT and mTOR, but not of MEK/MAPK, could reverse the enhanced proliferative
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
12 CFR 23.1 - Authority, purpose, and scope.
2010-01-01
....1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY LEASING General.... The purpose of this part is to set forth standards for personal property lease financing transactions authorized for national banks. (c) Scope. This part applies to the acquisition of personal property by a...
32 CFR 231.8 - Procedures-overseas credit unions.
2010-07-01
... geographic franchise. (2) The extension of credit union service overseas is encouraged consistent with the... geographic franchise with a specific field of membership, the Secretary of the Military Department (or... geographic franchises assigned to credit unions serving DoD overseas installations. (ii) Where there is no Do...
32 CFR 231.7 - Procedures-domestic credit unions.
2010-07-01
... facility of an existing credit union under the common bond principle. (1) DoD personnel seeking to... changes in fair market value. Duration of this lease shall be commensurate with the extent of the... should be assigned to comptroller or resource management personnel. The CULO's name and duty telephone...
48 CFR 352.231-70 - Salary rate limitation.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Salary rate limitation... Salary rate limitation. As prescribed in 331.101-70, the Contracting Officer shall insert the following clause: Salary Rate Limitation (January 2010) (a) Pursuant to the current and applicable prior HHS...
42 CFR 456.231 - Continued stay review required.
2010-10-01
... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Ur Plan... a review of each recipient's continued stay in the mental hospital to decide whether it is needed...
48 CFR 231.205-70 - External restructuring costs.
2010-10-01
... subsection: (1) Business combination means a transaction whereby assets or operations of two or more... after a business combination that affect the operations of companies not previously under common ownership or control. They do not include restructuring activities occurring after a business combination...
14 CFR 25.231 - Longitudinal stability and control.
2010-01-01
... takeoff. In addition— (1) Wheel brakes must operate smoothly and may not cause any undue tendency to nose over; and (2) If a tail-wheel landing gear is used, it must be possible, during the takeoff ground run...
DEFF Research Database (Denmark)
Frandsen, Stine Krog; Gehl, Julie
2017-01-01
cancer cell lines: Breast (MDA-MB231) and colon (HT29), and in normal human fibroblasts (HDF-n), as well as investigating viability in human bladder cancer cells (SW780) and human small cell lung cancer cells (H69) where we have previously published intracellular ATP levels. RESULTS: Calcium...... with calcium alone (pHDF-n, and MDA-MB231; p
Chiotaki, Rena; Polioudaki, Hara; Theodoropoulos, Panayiotis A
2014-08-01
Cancer cells often exhibit characteristic aberrations in their nuclear architecture, which are indicative of their malignant potential. In this study, we have examined the nuclear and cytoskeletal composition, attachment configuration dynamics, and osmotic or drug treatment response of invasive (Hs578T and MDA-MB-231) and non-invasive (MCF-10A and MCF-7) breast cancer cell lines. Unlike MCF-10A and MCF-7, Hs578T and MDA-MB-231 cells showed extensive nuclear elasticity and deformability and displayed distinct kinetic profiles during substrate attachment. The nuclear shape of MCF-10A and MCF-7 cells remained almost unaffected upon detachment, hyperosmotic shock, or cytoskeleton depolymerization, while Hs578T and MDA-MB-231 revealed dramatic nuclear contour malformations following actin reorganization.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH242 (Link to dictyBase) - - - Contig-U16343-1 SLH242Z (Link... to Original site) - - SLH242Z 476 - - - - Show SLH242 Library SL (Link to library) Clone ID SLH242 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH242Q.Seq.d/ Representative seq. ID SLH24...2Z (Link to Original site) Representative DNA sequence >SLH242 (SLH242Q) /CSM/SL/SLH2-B/SLH242Q.Seq.d/ XXXXX...d/ 910 0.0 SLI231 (SLI231Q) /CSM/SL/SLI2-B/SLI231Q.Seq.d/ 910 0.0 SLH242 (SLH242Q) /CSM/SL/SLH2-B/SLH2
T cell antigen receptor expression by subsets of Ly-2-L3T4- (CD8-CD4-) thymocytes
DEFF Research Database (Denmark)
Wilson, A; Ewing, T; Owens, T
1988-01-01
. No positive cells were detected among Ly-2-L3T4- thymocytes from V beta 8-negative SJL mice. In contrast to the adult thymus, Ly-2-L3T4- cells from embryonic CBA thymus lacked F23.1-positive cells. Subsets of adult CBA Ly-2-L3T4- thymocytes were separated to determine which expressed V beta 8. The major...... B2A2-M1/69- and Pgp-1+ all included strongly F23.1-positive cells. A minor subset, negative for most markers except Pgp-1 and presumed on the basis of this phenotype and some reconstitution studies to include the earliest intrathymic precursors, contained 28% F23.1-positive cells. However, no F.23...
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
Energy Technology Data Exchange (ETDEWEB)
Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)
2011-03-15
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
International Nuclear Information System (INIS)
Kulagin, N.A.
2011-01-01
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.
Review of radionuclide source terms used for performance-assessment analyses
International Nuclear Information System (INIS)
Barnard, R.W.
1993-06-01
Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides
Energy Technology Data Exchange (ETDEWEB)
Morinaga, H [Department of Physics, Tohoku University, Sendai (Japan)
1962-01-15
des cibles internes n'a ete employee que pour les travaux de spectroscopie nucleaire; elle a permis d'identifier huit nouvelles especes d'isotopes radioactifs (cobalt-63, gallium-75, arsenic-81, indium-121, indium-123, thulium-173, thulium-175 et actinium-231) et de decouvrir plusieurs nouveaux isomeres. L'efficacite de cette technique de bombardement ouvre de nouvelles perspectives, car les betatrons employes a des fins medicales ou industrielles ou pour la recherche peuvent aussi servir a la production de radioelements. Les radioisotopes de courte periode sont souvent plus commodes a utiliser dans diverses applications en raison de leur desintegration rapide et des rayonnements de haute energie qu'ils emettent, et peuvent etre fabriques facilement sans exiger d'operations compliquees. (author) [Spanish] El autor ha ideado y empleado con exito un nuevo metodo para obtener en el betatron radioisotopos de elevada actividad especifica. Los materiales que se desee activar se colocan en el extremo de una varilla que se introduce desde el exterior en el tubo toroidal, y se irradian a la presion de una atmosfera en un lugar situado inmediatamente detras clel blanco que emite las radiaciones de frenado, en el que la intensidad de las radiaciones es extremadamente elevada. El autor produjo en una pieza pequena de cobre una actividad de saturacion de {sup 62}Cu superior a un milicurie, y la actividad especifica mas elevada que pudo alcanzar era unas 500 veces mayor que la obtenida con ayuda de los dispositivos corrientes. Por ahora, la tecnica del blanco interior solo se emplea para trabajos de espectroscopia nuclear. El autor ha Identificado por este metodo ocho nuevas especies radioisotopicas ({sup 63}Co, {sup 75}Ga, {sup 81}As, {sup 121}In, {sup 123}In, {sup 173}Tm, {sup 175}Tm y {sup 231}Ac) y ha encontrado varios nuevos isomeros. Esta tecnica de bombardeo abre posibilidades nuevas porque los betatrones que hoy se emplean en medicina, en la industria o en la investigacion
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)
2011-02-07
Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.
International Nuclear Information System (INIS)
Koyama, Mutsuo
1989-01-01
Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology
International Nuclear Information System (INIS)
Amniai, Laziza; Lippens, Guy; Landrieu, Isabelle
2011-01-01
Highlights: → pThr231 of the Tau protein is necessary for the binding of the AT180 antibody. → pSer235 of the Tau protein does not interfere with the AT180 recognition of pThr231. → Epitope mapping is efficiently achieved by combining NMR and FRET spectroscopy. -- Abstract: We present here the characterization of the epitope recognized by the AT180 monoclonal antibody currently used to define an Alzheimer's disease (AD)-related pathological form of the phosphorylated Tau protein. Some ambiguity remains as to the exact phospho-residue(s) recognized by this monoclonal: pThr231 or both pThr231 and pSer235. To answer this question, we have used a combination of nuclear magnetic resonance (NMR) and fluorescence spectroscopy to characterize in a qualitative and quantitative manner the phospho-residue(s) essential for the epitope recognition. Data from the first step of NMR experiments are used to map the residues bound by the antibodies, which were found to be limited to a few residues. A fluorophore is then chemically attached to a cystein residue introduced close-by the mapped epitope, at arginine 221, by mutagenesis of the recombinant protein. The second step of Foerster resonance energy transfer (FRET) between the AT180 antibody tryptophanes and the phospho-Tau protein fluorophore allows to calculate a dissociation constant Kd of 30 nM. We show that the sole pThr231 is necessary for the AT180 recognition of phospho-Tau and that phosphorylation of Ser235 does not interfere with the binding.
A possible usage of a CDK4 inhibitor for breast cancer stem cell-targeted therapy
International Nuclear Information System (INIS)
Han, Yu Kyeong; Lee, Jae Ho; Park, Ga-Young; Chun, Sung Hak; Han, Jeong Yun; Kim, Sung Dae; Lee, Janet; Lee, Chang-Woo; Yang, Kwangmo; Lee, Chang Geun
2013-01-01
Highlights: ► A CDK4 inhibitor may be used for breast cancer stem cell-targeted therapy. ► The CDK4 inhibitor differentiated the cancer stem cell population (CD24 − /CD44 + ) of MDA-MB-231. ► The differentiation of the cancer stem cells by the CDK4 inhibitor radiosensitized MDA-MB-231. -- Abstract: Cancer stem cells (CSCs) are one of the main reasons behind cancer recurrence due to their resistance to conventional anti-cancer therapies. Thus, many efforts are being devoted to developing CSC-targeted therapies to overcome the resistance of CSCs to conventional anti-cancer therapies and decrease cancer recurrence. Differentiation therapy is one potential approach to achieve CSC-targeted therapies. This method involves inducing immature cancer cells with stem cell characteristics into more mature or differentiated cancer cells. In this study, we found that a CDK4 inhibitor sensitized MDA-MB-231 cells but not MCF7 cells to irradiation. This difference appeared to be associated with the relative percentage of CSC-population between the two breast cancer cells. The CDK4 inhibitor induced differentiation and reduced the cancer stem cell activity of MDA-MB-231 cells, which are shown by multiple marker or phenotypes of CSCs. Thus, these results suggest that radiosensitization effects may be caused by reducing the CSC-population of MDA-MB-231 through the use of the CDK4 inhibitor. Thus, further investigations into the possible application of the CDK4 inhibitor for CSC-targeted therapy should be performed to enhance the efficacy of radiotherapy for breast cancer
International Nuclear Information System (INIS)
Basu, Gargi D; Pathangey, Latha B; Tinder, Teresa L; Gendler, Sandra J; Mukherjee, Pinku
2005-01-01
Inhibitors of cyclo-oxygenase (COX)-2 are being extensively studied as anticancer agents. In the present study we evaluated the mechanisms by which a highly selective COX-2 inhibitor, celecoxib, affects tumor growth of two differentially invasive human breast cancer cell lines. MDA-MB-231 (highly invasive) and MDA-MB-468 (moderately invasive) cell lines were treated with varying concentrations of celecoxib in vitro, and the effects of this agent on cell growth and angiogenesis were monitored by evaluating cell proliferation, apoptosis, cell cycle arrest, and vasculogenic mimicry. The in vitro results of MDA-MB-231 cell line were further confirmed in vivo in a mouse xenograft model. The highly invasive MDA-MB-231 cells express higher levels of COX-2 than do the less invasive MDA-MB-468 cells. Celecoxib treatment inhibited COX-2 activity, indicated by prostaglandin E 2 secretion, and caused significant growth arrest in both breast cancer cell lines. In the highly invasive MDA-MB-231 cells, the mechanism of celecoxib-induced growth arrest was by induction of apoptosis, associated with reduced activation of protein kinase B/Akt, and subsequent activation of caspases 3 and 7. In the less invasive MDA-MB-468 cells, growth arrest was a consequence of cell cycle arrest at the G 0 /G 1 checkpoint. Celecoxib-induced growth inhibition was reversed by addition of exogenous prostaglandin E 2 in MDA-MB-468 cells but not in MDA-MB-231 cells. Furthermore, MDA-MB-468 cells formed significantly fewer extracellular matrix associated microvascular channels in vitro than did the high COX-2 expressing MDA-MB-231 cells. Celecoxib treatment not only inhibited cell growth and vascular channel formation but also reduced vascular endothelial growth factor levels. The in vitro findings corroborated in vivo data from a mouse xenograft model in which daily administration of celecoxib significantly reduced tumor growth of MDA-MB-231 cells, which was associated with reduced vascularization and
Hidden Pair of Supermassive Black Holes
Kohler, Susanna
2015-08-01
Could a pair of supermassive black holes (SMBHs) be lurking at the center of the galaxy Mrk 231? A recent study finds that this may be the case and the unique spectrum of this galaxy could be the key to discovering more hidden binary SMBH systems.Where Are the Binary Supermassive Black Holes?Its believed that most, if not all, galaxies have an SMBH at their centers. As two galaxies merge, the two SMBHs should evolve into a closely-bound binary system before they eventually merge. Given the abundance of galaxy mergers, we would expect to see the kinematic and visual signatures of these binary SMBHs among observed active galactic nuclei yet such evidence for sub-parsec binary SMBH systems remains scarce and ambiguous. This has led researchers to wonder: is there another way that we might detect these elusive systems?A collaboration led by Chang-Shuo Yan (National Astronomical Observatories, Chinese Academy of Sciences) thinks that there is. The group suggests that these systems might have distinct signatures in their optical-to-UV spectra, and they identify a system that might be just such a candidate: Mrk 231.A Binary CandidateProposed model of Mrk 231. Two supermassive black holes, each with their own mini-disk, orbit each other in the center of a circumbinary disk. The secondary black hole has cleared gap in the circumbinary disk as a result of its orbit around the primary black hole. [Yan et al. 2015]Mrk 231 is a galaxy with a disturbed morphology and tidal tails strong clues that it might be in the final stages of a galactic merger. In addition to these signs, Mrk 231 also has an unusual spectrum for a quasar: its continuum emission displays an unexpected drop in the near-UV band.Yan and her collaborators propose that the odd behavior of Mrk 231s spectrum can be explained if the center of the galaxy houses a pair of SMBHs each with its own mini accretion disk surrounded by a circumbinary accretion disk. As the secondary SMBH orbits the primary SMBH (with a
International Nuclear Information System (INIS)
Al-Assar, Osama; Muschel, Ruth J.; Mantoni, Tine S.; McKenna, W. Gillies; Brunner, Thomas B.
2009-01-01
Purpose: A subpopulation of cancer stem-like cells (CSLC) is hypothesized to exist in different cancer cell lines and to mediate radioresistance in solid tumors. Methods and Materials: Cells were stained for CSLC markers and sorted (fluorescence-activated cell sorter/magnetic beads) to compare foci and radiosensitivity of phosphorylated histone H2AX at Ser 139 (γ-H2AX) in sorted vs. unsorted populations in eight cell lines from different organs. CSLC properties were examined using anchorage-independent growth and levels of activated Notch1. Validation consisted of testing tumorigenicity and postirradiation enrichment of CSLC in xenograft tumors. Results: The quantity of CSLC was generally in good agreement with primary tumors. CSLC from MDA-MB-231 (breast) and Panc-1 and PSN-1 (both pancreatic) cells had fewer residual γ-H2AX foci than unsorted cells, pointing to radioresistance of CSLC. However, only MDA-MB-231 CSLC were more radioresistant than unsorted cells. Furthermore, MDA-MB-231 CSLC showed enhanced anchorage-independent growth and overexpression of activated Notch1 protein. The expression of cancer stem cell surface markers in the MDA-MB-231 xenograft model was increased after exposure to fractionated radiation. In contrast to PSN-1 cells, a growth advantage for MDA-MB-231 CSLC xenograft tumors was found compared to tumors arising from unsorted cells. Conclusions: CSLC subpopulations showed no general radioresistant phenotype, despite the quantities of CSLC subpopulations shown to correspond relatively well in other reports. Likewise, CSLC characteristics were found in some but not all of the tested cell lines. The reported problems in testing for CSLC in cell lines may be overcome by additional techniques, beyond sorting for markers.
Liu, Hongyu; Tan, Beiping; Yang, Jinfang; Lin, Yingbo; Chi, Shuyan; Dong, Xiaohui; Yang, Qihui
2014-09-01
To investigate the influence of sodium to potassium (Na/K) ratios on the growth performance and physiological response of the Pacific white shrimp ( Litopenaeus vananmei), various concentrations of KCl were added to low-salinity well water (salinity 4) in an 8-week culture trial. Six treatments with Na/K ratios of 60:1, 42:1, 33:1, 23:1, 17:1, and 14:1 were replicated in triplicate. The highest weight-gain rate (3 506±48)% and survival rate (89.38±0.88)% was observed in well water with Na/K ratios of 23:1 and 42:1, respectively, while the feed conversion ratio (1.02±0.01), oxygen consumption, and ammonia-N excretion rate was the lowest in the medium with a Na/K ratio of 23:1. Gill Na+-K+-ATPase activity, as an indicator of osmoregulation, peaked in the treatment where the Na/K ratio was 17:1. The total hemocyte count, respiratory burst, and immune-related enzyme activities (ALP, LSZ, PO, and SOD) of L. vananmei were affected significantly by Na/K ratios ( Pshrimp reared in a Na/K ratio of 23:1 (30±14.14)% was significantly lower than the control (75±7.07)%. In conclusion, the addition of K+ to low-salinity well water in L. vannamei cultures is feasible. Na/K ratios ranging from 23:1 to 33:1 might improve survival and growth. Immunity and disease resistance are also closely related to the Na/K ratio of the low-salinity well water. The findings may contribute to the development of more efficient K + remediation strategies for L. vananmei culture in low-salinity well water.
Wang, Yuhui; Xu, Xiaotian; Zhao, Peng; Tong, Bei; Wei, Zhifeng; Dai, Yue
2016-04-26
The saponin fraction of Aesculus chinensis Bunge fruits (SFAC) could inhibit the invasion and migration of MDA-MB-231 cells. Among which, escin Ia showed more potent inhibition of the invasion than other five main saponin constituents. It selectively reduced the expression of LOXL2 mRNA and promoted the expression of E-cadherin mRNA, and prevented the EMT process of MDA-MB-231 cells and TNF-α/TGF-β-stimulated MCF-7 cells. Moreover, it reduced the LOXL2 level in MDA-MB-231 cells but not in MCF-7 cells. When MCF-7 cells were stimulated with TNF-α/TGF-β, transfected with LOXL2 or treated with hypoxia, escin Ia down-regulated the level of LOXL2 in MCF-7 cells. Meanwhile, escin Ia suppressed the EMT process in LOXL2-transfected or hypoxia-treated MCF-7 cells. Of interest, escin Ia did not alter the level of HIF-1α in hypoxia-induced MCF-7 cells. In TNBC xenograft mice, the metastasis and EMT of MDA-MB-231 cells were suppressed by escin Ia. In conclusion, escin Ia was the main active ingredient of SFAC for the anti-TNBC metastasis activity, and its action mechanisms involved inhibition of EMT process by down-regulating LOXL2 expression.
Inhibition of SIRT1 by a small molecule induces apoptosis in breast cancer cells.
Kalle, Arunasree M; Mallika, A; Badiger, Jayasree; Alinakhi; Talukdar, Pinaki; Sachchidanand
2010-10-08
Overexpression of SIRT1, a NAD+-dependent class III histone deacetylases (HDACs), is implicated in many cancers and therefore could become a promising antitumor target. Here we demonstrate a small molecule SIRT1 inhibitor, ILS-JGB-1741(JGB1741) with potent inhibitory effects on the proliferation of human metastatic breast cancer cells, MDA-MB 231. The molecule has been designed using medicinal chemistry approach based on known SIRT1 inhibitor, sirtinol. The molecule showed a significant inhibition of SIRT1 activity compared to sirtinol. Studies on the antitumor effects of JGB on three different cancer cell lines, K562, HepG2 and MDA-MB 231 showed an IC₅₀ of 1, 10 and 0.5 μM, respectively. Further studies on MDA-MB 231 cells showed a dose-dependent increase in K9 and K382 acetylation of H3 and p53, respectively. Results also demonstrated that JGB1741-induced apoptosis is associated with increase in cytochrome c release, modulation in Bax/Bcl2 ratio and cleavage of PARP. Flowcytometric analysis showed increased percentage of apoptotic cells, decrease in mitochondrial membrane potential and increase in multicaspase activation. In conclusion, the present study indicates the potent apoptotic effects of JGB1741 in MDA-MB 231 cells. Copyright © 2010 Elsevier Inc. All rights reserved.
Investigating the effect of cell substrate on cancer cell stiffness by optical tweezers.
Yousafzai, Muhammad Sulaiman; Coceano, Giovanna; Bonin, Serena; Niemela, Joseph; Scoles, Giacinto; Cojoc, Dan
2017-07-26
The mechanical properties of cells are influenced by their microenvironment. Here we report cell stiffness alteration by changing the cell substrate stiffness for isolated cells and cells in contact with other cells. Polydimethylsiloxane (PDMS) is used to prepare soft substrates with three different stiffness values (173, 88 and 17kPa respectively). Breast cancer cells lines, namely HBL-100, MCF-7 and MDA-MB-231 with different level of aggressiveness are cultured on these substrates and their local elasticity is investigated by vertical indentation of the cell membrane. Our preliminary results show an unforeseen behavior of the MDA-MB-231 cells. When cultured on glass substrate as isolated cells, they are less stiff than the other two types of cells, in agreement with the general statement that more aggressive and metastatic cells are softer. However, when connected to other cells the stiffness of MDA-MB-231 cells becomes similar to the other two cell lines. Moreover, the stiffness of MDA-MB-231 cells cultured on soft PDMS substrates is significantly higher than the stiffness of the other cell types, demonstrating thus the strong influence of the environmental conditions on the mechanical properties of the cells. Copyright © 2017. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Vessella Robert L
2006-01-01
Full Text Available Abstract Background After development of hormone-refractory metastatic disease, prostate cancer is incurable. The recent history of chemotherapy has shown that with difficult disease targets, combinatorial therapy frequently offers the best chance of a cure. In this study we have examined the effects of a combination of zoledronic acid (ZOL, a new-generation bisphosphonate, and docetaxel on LuCaP 23.1, a prostate cancer xenograft that stimulates the osteoblastic reaction when grown in the bone environment. Methods Intra-tibial injections of LuCaP 23.1 cells were used to generate tumors in the bone environment, and animals were treated with ZOL, docetaxel, or a combination of these. Effects on bone and tumor were evaluated by measurements of bone mineral density and histomorphometrical analysis. Results ZOL decreased proliferation of LuCaP 23.1 in the bone environment, while docetaxel at a dose that effectively inhibited growth of subcutaneous tumors did not show any effects in the bone environment. The combination of the drugs significantly inhibited the growth of LuCaP 23.1 tumors in the bone. Conclusion In conclusion, the use of the osteolysis-inhibitory agent ZOL in combination with docetaxel inhibits growth of prostate tumors in bone and represents a potential treatment option.
Waste Isolation Pilot Plant Annual Site Environmental Report for 2016
Energy Technology Data Exchange (ETDEWEB)
Ward, Anderson [Carlsbad Field Office (CBFO), NM (United States); Basabilvazo, George T. [Carlsbad Field Office (CBFO), NM (United States)
2017-09-01
The purpose of the Waste Isolation Pilot Plant (WIPP) Annual Site Environmental Report for 2016 (ASER) is to provide the information required by U.S. Department of Energy (DOE) Order 231.1B, Environment, Safety, and Health Reporting. The DOE Carlsbad Field Office (CBFO) and the management and operating contractor (MOC) maintain and preserve the environmental resources at the WIPP facility. DOE Order 231.1B; DOE Order 436.1, Departmental Sustainability; and DOE Order 458.1, Radiation Protection of the Public and the Environment, require that the affected environment at and near DOE facilities be monitored to ensure the safety and health of the public and workers, and preservation of the environment. This report was prepared in accordance with DOE Order 231.1B, which requires DOE facilities to submit an ASER to the DOE Headquarters Chief Health, Safety, and Security Officer.
Nanomedicine for Early Disease Detection and Treatment
2013-09-01
Olympus, Tokyo , Japan). Briefl y, HeLa and MDA-MB231 cells were collected by trypsinization, counted, and plated in a 96-well black clear-bottom...negative specifi city control. After incubation, the particles were washed away, and MDA-MB231-luc2 cell luminescence was measured immediately after...anks 490 wileyonlinelibrary.com © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Wenude mice . The real-time gene silencing effect was investigated non
Ashes of history: colum mccann’s zoli Ashes of history: colum mccann’s zoli
Directory of Open Access Journals (Sweden)
Eluned Summers-Brenner
2010-06-01
Full Text Available
231f20; font-family: Palatino-RomanTh;">231f20; font-family: Palatino-RomanTh;">231f20; font-family: Palatino-RomanTh;">
My essay reads Colum McCann’s novel Zoli as an elaboration of the ethical work of poetry. In the novel the Slovakian poet Zoli Novotna, based on the life and work of the Polish Romani balladeer Papusza (Bronislawa Wajs, is irreversibly disowned by her people upon publishing poetry that is used, as is her image, to represent the enaction of Law 74, or the Big Halt, in the 1950s and 1960s. Disastrously, this process caused Eastern European Gypsies to lose their sense of belonging and livelihood through the confiscation of caravans, their being forced into apartment blocks in towns, and consequent opposition to traditional Gypsy skills, most of which were lost. McCann’s novel extends Papusza’s story beyond her exclusion from her people, having Zoli bear performative witness to the mistaken work her poetry once did. In walking roads from which Roma have been banished, and in taking on the bare remains of her lost identity, a mishmash of gadzi perceptions, Zoli makes the nothingness for which she stands into the means of travel and future hope for others. In my reading, the novel elaborates a claim that justice is not served by forcing everyone to have the same degree and kind of pleasures, but by allowing forms of chosen deprivation. The ashes of Zoli’s burned poems become 231f20; font-family: Palatino-RomanTh;">231f20; font-family: Palatino-RomanTh;">231f20; font-family: Palatino-RomanTh;">the ashes of a reconstituted identity around a space that holds nothing, equivalent to the nothing that gadzos are willing to know about Romani world-making and belonging
Directory of Open Access Journals (Sweden)
Leiv MARSTEINTREDET
2010-09-01
Full Text Available
231f20; font-size: 8.5pt; mso-bidi-font-family: SimonciniGaramond;">Este artículo analiza y compara la deposición del presidente de Honduras, Manuel Zelaya, con otras crisis presidenciales acontecidas en América Latina durante la tercera ola de democratización. El trabajo indaga sobre los procedimientos, causas y consecuencias en torno de esta caída presidencial con instrumentos de análisis previstos por la teoría de las rupturas presidenciales. La caída de Zelaya fue producto de una escalada de conflictos interinstitucionales, protagonizados por las elites civiles del país. En perspectiva comparada, el caso se distingue por la intervención de los militares como poder moderador a invitación de las instituciones civiles, la falta de movilización popular 231f20; font-size: 8.5pt; mso-bidi-font-family: SimonciniGaramond-Italic;">antes 231f20; font-size: 8.5pt; mso-bidi-font-family: SimonciniGaramond;">del golpe y la irrupción de una crisis internacional y conflictos callejeros 231f20; font-size: 8.5pt; mso-bidi-font-family: SimonciniGaramond-Italic;">después 231f20; font-size: 8.5pt; mso-bidi-font-family: SimonciniGaramond;">de que la caída presidencial tuviera lugar. El caso de Honduras contribuye a la teoría de las rupturas presidenciales al poner el acento en el papel de los militares y el estadio de desarrollo en que se encuentra el régimen político democrático al estallar la crisis.
Status of thorium cycle nuclear data evaluations: Comparison of cross-section line shapes of JENDL-3 and ENDF-B-VI files for 230Th, 232Th, 231Pa, 233Pa, 232U, 233U and 234U
International Nuclear Information System (INIS)
Ganesan, S.; McLaughlin, P.K.
1992-02-01
Since 1990, one of the most interesting developments in the field of nuclear data for nuclear technology applications is that several new evaluated data files have been finalized and made available to the International Atomic Energy Agency (IAEA) for distribution to its Member States. Improved evaluated nuclear data libraries such as ENDF/B-VI from the United States and JENDL-3 from Japan were developed over a period of 10-15 years. This report is not an evaluation of the evaluations. The report as presented here gives a first look at the cross section line shapes of the isotopes that are important to the thorium fuel cycle derived from the two recently evaluated data files: JENDL-3 and ENDF/B-VI. The basic evaluated data files JENDL-3 and ENDF/B-VI were point-processed successfully using the codes LINEAR and RECENT. The point data were multigrouped in three different group structures using the GROUPIE code. Graphs of intercomparisons of cross section line shapes of JENDL-3 and ENDF/B-VI are presented in this paper for the following isotopes of major interest to studies of the thorium fuel cycle: 230 Th, 232 Th, 231 Pa, 233 Pa, 232 U, 233 U and 234 U. Comparisons between JENDL-3 and ENDF/B-VI which were performed at the point and group levels show large discrepancies in various cross sections. We conclude this report with a general remark that it is necessary to perform sensitivity studies to assess the impacts of the discrepancies between the two different sets of data on calculated reactor design and safety parameters of specific reactor systems and, based on the results of such sensitivity studies, to undertake new tasks of evaluations. (author). 2 refs, 245 figs, 8 tabs
Paracoccus hibiscisoli sp. nov., isolated from the rhizosphere of Mugunghwa (Hibiscus syriacus).
Lin, Pei; Yan, Zheng-Fei; Won, Kyung-Hwa; Yang, Jung-Eun; Li, Chang-Tian; Kook, MooChang; Wang, Qi-Jun; Yi, Tae-Hoo
2017-07-01
A Gram-reaction-negative, aerobic, non-motile, short-rod-shaped bacterium (THG-T2.31T) was isolated from the rhizosphere of Mugunghwa (Hibiscus syriacus). Growth occurred at 10-35 °C (optimum 28 °C), at pH 5.0-8.0 (optimum pH 7.0) and with 0-4.0 % NaCl (optimum 1.0 %). Based on 16S rRNA gene sequence analysis, the nearest phylogenetic neighbours of strain THG-T2.31T were identified as Paracoccus marcusii DSM 11574T (98.4 %), Paracoccus haeundaensis BC74171T (98.3 %), Paracoccus carotinifaciens E-396T (98.3 %), Paracoccus aestuarii B7T (97.3 %) and Paracoccus seriniphilus MBT-A4T (97.0 %); levels of similarity with the type strains of other species of the genus Paracoccus were lower than 97.0 %. The polar lipids were diphosphatidylglycerol, phosphatidylmethylethanolamine, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylcholine, one unidentified aminolipid and two unidentified phospholipids. The major fatty acids were C16 : 0, C18 : 0, C10 : 0 3-OH, and C18 : 1ω7c. The quinone was ubiquinone-10 (Q-10). The DNA G+C content of strain THG-T2.31T was 69.1 mol%. DNA-DNA hybridization values between strain THG-T2.31T and P. marcusii DSM 11574T, P. haeundaensis BC74171T, P. carotinifaciens E-396T, P. aestuarii B7T and P. seriniphilus MBT-A4T were 38.9 % (34.9 %, reciprocal analysis), 29.1 % (23.5 %), 28.0 % (19.7 %), 18.9 % (9.3) and 13.1 % (6.2 %). On the basis of the phylogenetic analysis, chemotaxonomic data, physiological characteristics and DNA-DNA hybridization data, strain THG-T2.31T represents a novel species of the genus Paracoccus, for which the name Paracoccus hibiscisoli sp. nov. is proposed. The type strain is THG-T2.31T (=KACC 18933T=CCTCC AB 2016182T).
TRIM44 Is a Poor Prognostic Factor for Breast Cancer Patients as a Modulator of NF-κB Signaling.
Kawabata, Hidetaka; Azuma, Kotaro; Ikeda, Kazuhiro; Sugitani, Ikuko; Kinowaki, Keiichi; Fujii, Takeshi; Osaki, Akihiko; Saeki, Toshiaki; Horie-Inoue, Kuniko; Inoue, Satoshi
2017-09-08
Many of the tripartite motif (TRIM) proteins function as E3 ubiquitin ligases and are assumed to be involved in various events, including oncogenesis. In regard to tripartite motif-containing 44 (TRIM44), which is an atypical TRIM family protein lacking the RING finger domain, its pathophysiological significance in breast cancer remains unknown. We performed an immunohistochemical study of TRIM44 protein in clinical breast cancer tissues from 129 patients. The pathophysiological role of TRIM44 in breast cancer was assessed by modulating TRIM44 expression in MCF-7 and MDA-MB-231 breast cancer cells. TRIM44 strong immunoreactivity was significantly associated with nuclear grade ( p = 0.033), distant disease-free survival ( p = 0.031) and overall survival ( p = 0.027). Multivariate analysis revealed that the TRIM44 status was an independent prognostic factor for distant disease-free survival ( p = 0.005) and overall survival ( p = 0.002) of patients. siRNA-mediated TRIM44 knockdown significantly decreased the proliferation of MCF-7 and MDA-MB-231 cells and inhibited the migration of MDA-MB-231 cells. Microarray analysis and qRT-PCR showed that TRIM44 knockdown upregulated CDK19 and downregulated MMP1 in MDA-MB-231 cells. Notably, TRIM44 knockdown impaired nuclear factor-kappa B (NF-κB)-mediated transcriptional activity stimulated by tumor necrosis factor α (TNFα). Moreover, TRIM44 knockdown substantially attenuated the TNFα-dependent phosphorylation of the p65 subunit of NF-κB and IκBα in both MCF-7 and MDA-MB-231 cells. TRIM44 would play a role in the progression of breast cancer by promoting cell proliferation and migration, as well as by enhancing NF-κB signaling.
Sigma-2 ligands and PARP inhibitors synergistically trigger cell death in breast cancer cells
International Nuclear Information System (INIS)
McDonald, Elizabeth S.; Mankoff, Julia; Makvandi, Mehran; Chu, Wenhua; Chu, Yunxiang; Mach, Robert H.; Zeng, Chenbo
2017-01-01
The sigma-2 receptor is overexpressed in proliferating cells compared to quiescent cells and has been used as a target for imaging solid tumors by positron emission tomography. Recent work has suggested that the sigma-2 receptor may also be an effective therapeutic target for cancer therapy. Poly (ADP-ribose) polymerase (PARP) is a family of enzymes involved in DNA damage response. In this study, we looked for potential synergy of cytotoxicity between PARP inhibitors and sigma-2 receptor ligands in breast cancer cell lines. We showed that the PARP inhibitor, YUN3-6, sensitized mouse breast cancer cell line, EMT6, to sigma-2 receptor ligand (SV119, WC-26, and RHM-138) induced cell death determined by cell viability assay and colony forming assay. The PARP inhibitor, olaparib, sensitized tumor cells to a different sigma-2 receptor ligand SW43-induced apoptosis and cell death in human triple negative cell line, MDA-MB-231. Olaparib inhibited PARP activity and cell proliferation, and arrested cells in G2/M phase of the cell cycle in MDA-MB-231 cells. Subsequently cells became sensitized to SW43 induced cell death. In conclusion, the combination of sigma-2 receptor ligands and PARP inhibitors appears to hold promise for synergistically triggering cell death in certain types of breast cancer cells and merits further investigation. - Highlights: • PARPi, YUN3-6 and olaparib, and σ2 ligands, SV119 and SW43, were evaluated. • Mouse and human breast cancer cells, EMT6 and MDA-MB-231 respectively, were used. • YUN3-6 and SV119 synergistically triggered cell death in EMT6 cells. • Olaparib and SW43 additively triggered cell death in MDA-MB-231 cells. • Olaparib arrested cells in G2/M in MDA-MB-231 cells.
Contraction regulates site-specific phosphorylation of TBC1D1 in skeletal muscle.
Vichaiwong, Kanokwan; Purohit, Suneet; An, Ding; Toyoda, Taro; Jessen, Niels; Hirshman, Michael F; Goodyear, Laurie J
2010-10-15
TBC1D1 (tre-2/USP6, BUB2, cdc16 domain family member 1) is a Rab-GAP (GTPase-activating protein) that is highly expressed in skeletal muscle, but little is known about TBC1D1 regulation and function. We studied TBC1D1 phosphorylation on three predicted AMPK (AMP-activated protein kinase) phosphorylation sites (Ser231, Ser660 and Ser700) and one predicted Akt phosphorylation site (Thr590) in control mice, AMPKα2 inactive transgenic mice (AMPKα2i TG) and Akt2-knockout mice (Akt2 KO). Muscle contraction significantly increased TBC1D1 phosphorylation on Ser231 and Ser660, tended to increase Ser700 phosphorylation, but had no effect on Thr590. AICAR (5-aminoimidazole-4-carboxyamide ribonucleoside) also increased phosphorylation on Ser231, Ser660 and Ser700, but not Thr590, whereas insulin only increased Thr590 phosphorylation. Basal and contraction-stimulated TBC1D1 Ser231, Ser660 and Ser700 phosphorylation were greatly reduced in AMPKα2i TG mice, although contraction still elicited a small increase in phosphorylation. Akt2 KO mice had blunted insulin-stimulated TBC1D1 Thr590 phosphorylation. Contraction-stimulated TBC1D1 Ser231 and Ser660 phosphorylation were normal in high-fat-fed mice. Glucose uptake in vivo was significantly decreased in tibialis anterior muscles overexpressing TBC1D1 mutated on four predicted AMPK phosphorylation sites. In conclusion, contraction causes site-specific phosphorylation of TBC1D1 in skeletal muscle, and TBC1D1 phosphorylation on AMPK sites regulates contraction-stimulated glucose uptake. AMPK and Akt regulate TBC1D1 phosphorylation, but there must be additional upstream kinases that mediate TBC1D1 phosphorylation in skeletal muscle.
Directory of Open Access Journals (Sweden)
Hong-chang Li
2017-10-01
Full Text Available Background/Aims: Cantharidin, a type of terpenoid secreted by the blister beetle Mylabris phalerata (Pallas, has attracted great attention in cancer therapy because of its potential anti-cancer activities. Here, we report the effects on apoptosis and autophagy in human triple-negative breast cancer (TNBC cell lines after treatment with cantharidin and attempt to elucidate the underlying mechanisms. Methods: MDA-MB-231 and MDA-MB-468 cells were treated with cantharidin and cell proliferation was examined using CCK-8 and clone formation assays. The expression of apoptosis- and autophagy-associated proteins was detected by western blotting. Cells were infected with lentivirus carrying the Beclin-1 gene, and MDA-MB-231-beclin1 (MB231-Bec and MDA-MB-468-beclin-1(MB468-Bec cells stably expressing Beclin-1 were established. Autophagic vacuoles in cells were observed with LC3 staining using fluorescence microscopy, and apoptotic cells were detected via flow cytometry. Tumor growth was assessed by subcutaneous inoculation of TNBC cells into BALB/c nude mice. Results: Cantharidin inhibited the proliferation of MDA-MB-231 and MDA-MB-468 cells, and induced cell apoptosis. Cantharidin additionally inhibited the conversion of LC3 I to LC3 II and autophagosome formation by suppressing the expression of Beclin-1. Furthermore, overexpression of Beclin-1 in TNBC cells attenuated the cytotoxicity of cantharidin. In vivo, cantharidin inhibited the growth of MDA-MB-231 and MDA-MB-468 xenografts in nude mice by suppressing autophagy and inducing apoptosis, and Beclin-1 overexpression in TNBC cells reduced the efficacy of cantharidin. Conclusions: Cantharidin inhibits autophagy by suppressing Beclin-1 expression and inducing apoptosis of TNBC cells in vitro and in vivo, thereby representing a potential strategy for the treatment of TNBC.
Dr. Austin's Lab â C231 BNSN
Federal Laboratory Consortium — GC-MS (Gas Chromatography Mass Spectrometer) - This machine is a combination of two instruments (GC and MS). It uses gas chromatography to separate samples and then...
48 CFR 2152.231-70 - Accounting and allowable cost.
2010-10-01
... allowable cost. As prescribed in 2131.270, insert the following clause: Accounting and Allowable Cost (OCT... cost; (ii) Incurred with proper justification and accounting support; (iii) Determined in accordance... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Accounting and allowable...
Publications | Page 231 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Projet de recherche "intégration des technologies de l'information et de la communication dans les apprentissages de base à l'école élémentaire au Sénégal" : rapport technique final (restricted access) ...
Protopine Inhibits Heterotypic Celladhesion In Mda-Mb-231 Cells ...
African Journals Online (AJOL)
Background: A Chinese herb Corydalis yanhusuo W.T. Wang that showed anticancer and anti-angiogenesis effects in our previous studies was presented for further studies. In the present study, we studied the anticancer proliferation and adhesion effects of five alkaloids which were isolated from Corydalis yanhusuo.
231 Effects of Problem-Solving, Guided-Discovery and Expository ...
African Journals Online (AJOL)
User
2011-07-21
Jul 21, 2011 ... and 0.68, respectively, determined using test-retest method were used in ... nature. Basic chemical products such as ammonia, hydrogen and nearly all ... enzymatic oxidation at ambient temperatures or during combustion at.
48 CFR 231.205-6 - Compensation for personal services.
2010-10-01
... employee, that are part of restructuring costs associated with a business combination, are unallowable... definitions of “business combination” and “restructuring costs.”) [57 FR 53600, Nov. 12, 1992, as amended at...
48 CFR 952.231-71 - Insurance-litigation and claims.
2010-10-01
... agencies, in connection with this contract. The Contractor shall proceed with such litigation in good faith... litigation in good faith and as directed from time to time by the Contracting Officer. (c)(1) Except as... insurance as required by law or approved in writing by the Contracting Officer. (2) The Contractor may, with...
All projects related to | Page 231 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-02-20
Non-communicable diseases (NCDs) are a major cause of death in Peru, accounting for 60% of deaths in 2010. Unhealthy diet is one of the four major risk factors for NCDs. Start Date: February 20, 2012. End Date: August 20, 2014. Topic: URBAN COMMUNITIES, NUTRITION, COMMUNITY SERVICES, PERU, LOW ...
Khan, Mohammed N; Haggag, Yusuf A; Lane, Majella E; McCarron, Paul A; Tambuwala, Murtaza M
2018-02-14
The anti-cancer potential of curcumin, a natural NFκβ inhibitor, has been reported extensively in breast, lung and other cancers. In vitro and in vivo studies indicate that the therapeutic efficacy of curcumin is enhanced when formulated in a nanoparticulate carrier. However, the mechanism of action of curcumin at the molecular level in the hypoxic tumour micro-environment is not fully understood. Hence, the aim of our study was to investigate the mechanism of action of curcumin formulated as nanoparticles in in vitro models of breast and lung cancer under an hypoxic microenvironment. Biodegradable poly(lactic-co-glycolic acid) PLGA nanoparticles (NP), loaded with curcumin (cur-PLGA-NP), were fabricated using a solvent evaporation technique to overcome solubility issues and to facilitate intracellular curcumin delivery. Cytotoxicity of free curcumin and cur-PLGA-NP was evaluated in MDA-MB-231 and A549 cell lines using migration, invasion and colony formation assays. All treatments were performed under an hypoxic micro-environment and whole cell lysates from controls and test groups were used to determine the expression of HIF-1α and p65 levels using ELISA assays. A ten-fold increase in solubility, three-fold increase in anti-cancer activity and a significant reduction in the levels of cellular HIF-1α and nuclear p65 (Rel A) were observed for cur-PLGA-NP, when compared to free curcumin. Our findings indicate that curcumin can effectively lower the elevated levels of HIF-1α and nuclear p65 (Rel A) in breast and lung cancer cells under an hypoxic tumour micro-environment when delivered in nanoparticulate form. This applied means of colloidal delivery could explain the improved anti-cancer efficacy of curcumin and has further potential applications in enhancing the activity of anti-cancer agents of low solubility. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Cytotoxic Activities against Breast Cancer Cells of Local Justicia gendarussa Crude Extracts
Abd Samad, Azman; Jamil, Shajarahtunnur
2014-01-01
Justicia gendarussa methanolic leaf extracts from five different locations in the Southern region of Peninsular Malaysia and two flavonoids, kaempferol and naringenin, were tested for cytotoxic activity. Kaempferol and naringenin were two flavonoids detected in leaf extracts using gas chromatography-flame ionization detection (GC-FID). The results indicated that highest concentrations of kaempferol and naringenin were detected in leaves extracted from Mersing with 1591.80 mg/kg and 444.35 mg/kg, respectively. Positive correlations were observed between kaempferol and naringenin concentrations in all leaf extracts analysed with the Pearson method. The effects of kaempferol and naringenin from leaf extracts were examined on breast cancer cell lines (MDA-MB-231 and MDA-MB-468) using MTT assay. Leaf extract from Mersing showed high cytotoxicity against MDA-MB-468 and MDA-MB-231 with IC50 values of 23 μg/mL and 40 μg/mL, respectively, compared to other leaf extracts. Kaempferol possessed high cytotoxicity against MDA-MB-468 and MDA-MB-231 with IC50 values of 23 μg/mL and 34 μg/mL, respectively. These findings suggest that the presence of kaempferol in Mersing leaf extract contributed to high cytotoxicity of both MDA-MB-231 and MDA-MB-468 cancer cell lines. PMID:25574182
Ficus umbellata Vahl. (Moraceae Stem Bark Extracts Exert Antitumor Activities In Vitro and In Vivo
Directory of Open Access Journals (Sweden)
Kevine Kamga Silihe
2017-05-01
Full Text Available A Ficus umbellata is used to treat cancer. The present work was therefore designed to assess antitumor potentials of F. umbellata extracts in nine different cell lines. Cell cycle, apoptosis, cell migration/invasion, levels of reactive oxygen species (ROS, mitochondrial membrane potential (MMP, caspases activities as well as Bcl-2 and Bcl-xL protein content were assessed in MDA-MB-231 cells. The 7,12-dimethylbenz(aanthracene (DMBA-induced carcinogenesis in rats were also used to investigate antitumor potential of F. umbellata extracts. The F. umbellata methanol extract exhibited a CC50 of 180 μg/mL in MDA-MB-231 cells after 24 h. It induced apoptosis in MCF-7 and MDA-MB-231 cells, while it did not alter their cell cycle phases. Further, it induced a decrease in MMP, an increase in ROS levels and caspases activities as well as a downregulation in Bcl-2 and Bcl-xL protein contents in MDA-MB-231 cells. In vivo, F. umbellata aqueous (200 mg/kg and methanol (50 mg/kg extracts significantly (p < 0.001 reduced ovarian tumor incidence (10%, total tumor burden (58% and 46%, respectively, average tumor weight (57.8% and 45.6%, respectively as compared to DMBA control group. These results suggest antitumor potential of F. umbellata constituents possibly due to apoptosis induction mediated through ROS-dependent mitochondrial pathway.
Ren, Wei; Sun, Xiaoxiao; Wang, Ke; Feng, Honglei; Liu, Yuehong; Fei, Chang; Wan, Shaoheng; Wang, Wei; Luo, Jinyong; Shi, Qiong; Tang, Min; Zuo, Guowei; Weng, Yaguang; He, Tongchuan; Zhang, Yan
2014-03-01
Bone morphogenetic proteins (BMPs), which belong to the transforming growth factor-β superfamily, regulate a wide range of cellular responses including cell proliferation, differentiation, adhesion, migration, and apoptosis. BMP9, the latest BMP to be discovered, is reportedly expressed in a variety of human carcinoma cell lines, but the role of BMP9 in breast cancer has not been fully clarified. In a previous study, BMP9 was found to inhibit the growth, migration, and invasiveness of MDA-MB-231 breast cancer cells. In the current study, the effect of BMP9 on the bone metastasis of breast cancer cells was investigated. After absent or low expression of BMP9 was detected in the MDA-MB-231 breast cancer cells and breast non-tumor adjacent tissues using Western blot and immunohistochemistry, In our previous study, BMP9 could inhibit the proliferation and invasiveness of breast cancer cells MDA-MB-231 in vitro and in vivo. This paper shows that BMP9 inhibit the bone metastasis of breast cancer cells by activating the BMP/Smad signaling pathway and downregulating connective tissue growth factor (CTGF); however, when CTGF expression was maintained, the inhibitory effect of BMP9 on the MDA-MB-231 cells was abolished. Together, these observations indicate that BMP9 is an important mediator of breast cancer bone metastasis and a potential therapeutic target for treating this deadly disease.
Matić, Ivana Z; Aljancić, Ivana; Vajs, Vlatka; Jadranin, Milka; Gligorijević, Nevenka; Milosavljević, Slobodan; Juranić, Zorica D
2013-09-01
Helichrysum zivojinii Cernjavski & Soska is an endemic plant species that grows in the National Park Galicica in Macedonia. Five extracts were isolated as fractions from the aerial parts of the plant: a n-hexane extract (1), a dichloromethane extract (2), an ethyl-acetate extract (3), a n-butanol extract (4) and a methanol extract (5). A dose-dependent cytotoxic activity of the extracts on MDA-MB-231 and EA.hy926 cells was observed. Extracts exhibited more pronounced cytotoxic actions on MDA-MB-231 cells than on EA.hy926 cells. The n-hexane extract (1), at a non-toxic concentration, exhibited an inhibitory effect on the migration as well the invasiveness of MDA-MB-231 cells. The dichloromethane extract (2), at a non-toxic concentration, demonstrated inhibition of MDA-MB-231 cells invasion. Each of the five extracts applied at non-toxic concentrations inhibited migration of EA.hy926 cells. The prominent inhibitory effect of the n-hexane extract on EA.hy926 cells migration was associated with a notable anti-angiogenic action of this extract. The other four tested extracts demonstrated mild anti-angiogenic activity. Our data highlight the prominent anticancer potential of n-hexane (1) and dichloromethane (2) extracts, which could be attributed to their very pronounced and selective cytotoxic activities as well as their anti-invasive and anti-angiogenic properties.
History and stabilization of the Plutonium Finishing Plant (PFP) complex, Hanford Site
Energy Technology Data Exchange (ETDEWEB)
Gerber, M.S., Fluor Daniel Hanford
1997-02-18
The 231-Z Isolation Building or Plutonium Metallurgy Building is located in the Hanford Site`s 200 West Area, approximately 300 yards north of the Plutonium Finishing Plant (PFP) (234-5 Building). When the Hanford Engineer Works (HEW) built it in 1944 to contain the final step for processing plutonium, it was called the Isolation Building. At that time, HEW used a bismuth phosphate radiochemical separations process to make `AT solution,` which was then dried and shipped to Los Alamos, New Mexico. (AT solution is a code name used during World War II for the final HEW product.) The process was carried out first in T Plant and the 224-T Bulk Reduction Building and B Plant and the 224-B Bulk Reduction Building. The 224-T and -B processes produced a concentrated plutonium nitrate stream, which then was sent in 8-gallon batches to the 231-Z Building for final purification. In the 231-Z Building, the plutonium nitrate solution underwent peroxide `strikes` (additions of hydrogen peroxide to further separate the plutonium from its carrier solutions), to form the AT solution. The AT solution was dried and shipped to the Los Alamos Site, where it was made into metallic plutonium and then into weapons hemispheres.` The 231-Z Building began `hot` operations (operations using radioactive materials) with regular runs of plutonium nitrate on January 16, 1945.
Xu, Hui; Kong, Ying-Yu; Chen, Xin; Guo, Meng-Yuan; Bai, Xiao-Hui; Lu, Yu-Jia; Li, Wei; Zhou, Xuan-Wei
2016-04-06
FIP-gat, an immunomodulatory protein isolated from Ganoderma atrum, is a new member of the FIP family. Little is known, however, about its expressional properties and antitumor activities. It was availably expressed in Escherichia coli with a total yield of 29.75 mg/L. The migration of recombinant FIP-gat (rFIP-gat) on SDS-PAGE corresponded to the predicted molecular mass, and the band was correctly detected by a specific antibody. To characterize the direct effects of rFIP-gat on MDA-MB-231 breast cancer cells, MDA-MB-231 cells were treated with different concentrations of rFIP-gat in vitro; the results showed that this protein could reduce cell viability dose-dependently with a median inhibitory concentration (IC50) of 9.96 μg/mL and agglutinate the MDA-MB-231 cells at a concentration as low as 5 μg/mL. Furthermore, FIP-gat at a concentration of 10 μg/mL can induce significant growth inhibition and cell death in MDA-MB-231 cells. Notably, FIP-gat treatment triggers significant cell cycle arrest at the G1/S transition and pronounced increase in apoptotic cell population. Molecular assays based on microarray and real-time PCR further revealed the potential mechanisms encompassing growth arrest, apoptosis, and autophagy underlying the phenotypic effects.
PEG-detachable lipid-polymer hybrid nanoparticle for delivery of chemotherapy drugs to cancer cells.
Du, Jiang-bo; Song, Yan-feng; Ye, Wei-liang; Cheng, Ying; Cui, Han; Liu, Dao-zhou; Liu, Miao; Zhang, Bang-le; Zhou, Si-yuan
2014-08-01
The experiment aimed to increase the drug-delivery efficiency of poly-lactic-co-glycolic acid (PLGA) nanoparticles. Lipid-polymer hybrid nanoparticles (LPNs-1) were prepared using PLGA as a hydrophobic core and FA-PEG-hyd-DSPE as an amphiphilic shell. Uniform and spherical nanoparticles with an average size of 185 nm were obtained using the emulsification solvent evaporation method. The results indicated that LPNs-1 showed higher drug loading compared with naked PLGA nanoparticles (NNPs). Drug release from LPNs-1 was faster in an acidic environment than in a neutral environment. LPNs-1 showed higher cytotoxicity on KB cells, A549 cells, MDA-MB-231 cells, and MDA-MB-231/ADR cells compared with free doxorubicin (DOX) and NNPs. The results also showed that, compared with free DOX and NNPs, LPNs-1 delivered more DOX to the nuclear of KB cells and MDA-MB-231/ADR cells. LPNs-1 induced apoptosis in KB cells and MDA-MB-231/ADR cells in a dose-dependent manner. The above data indicated that DOX-loaded LPNs-1 could kill not only normal tumor cells but also drug-resistant tumor cells. These results indicated that modification of PLGA nanoparticles with FA-PEG-hyd-DSPE could considerably increase the drug-delivery efficiency and LPNs-1 had potential in the delivery of chemotherapeutic agents in the treatment of cancer.
Emanations and 'induced' radioactivity: from mystery to (mis)use
International Nuclear Information System (INIS)
Kolar, Z.I.
1999-01-01
The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
Energy Technology Data Exchange (ETDEWEB)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)
2014-05-15
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.
Covering radii are not matroid invariants
DEFF Research Database (Denmark)
Britz, Thomas Johann; Rutherford, Carrie G.
2005-01-01
We show by example that the covering radius of a binary linear code is not generally determined by the Tutte polynomial of the matroid. This answers Problem 361 (P.J. Cameron (Ed.), Research problems, Discrete Math. 231 (2001) 469–478).......We show by example that the covering radius of a binary linear code is not generally determined by the Tutte polynomial of the matroid. This answers Problem 361 (P.J. Cameron (Ed.), Research problems, Discrete Math. 231 (2001) 469–478)....
2004-09-01
Databases 2-2 2.3.1 Translanguage English Database 2-2 2.3.2 Australian National Database of Spoken Language 2-3 2.3.3 Strange Corpus 2-3 2.3.4...some relevance to speech technology research. 2.3.1 Translanguage English Database In a daring plan Joseph Mariani, then at LIMSI-CNRS, proposed to...native speakers. The database is known as the ‘ Translanguage English Database’ but is often referred to as the ‘terrible English database.’ About 28
Energy Technology Data Exchange (ETDEWEB)
Rojas C, E. L.; Perez A, M., E-mail: leticia.rojas@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)
2011-11-15
The necessity to design innovative treatments and to diagnose the cancer early, has taken to investigate therapies at cellular and molecular level. The design of appropriate radio-molecules to these therapies makes necessary to characterize in way exhaustive radionuclides that they are of accessible production in our country and to study as distributing the dose at cellular level with bio-molecules glued them. In this context, was realized the present work. Using Monte Carlo simulation, the energy deposited in a geometric model of cells of breast cancer was obtained, MDA-MB231, due to different radionuclides. The energy deposited in the nucleus was evaluated, in the cytoplasm and in the membrane of the cell, using the simulation code Monte Carlo Penelope 2008. A punctual source was simulated in the center of the cell nucleus. In each case all the emissions of each radionuclide majors to 400 eV were simulated. The energies deposited by disintegration in the nucleus, cytoplasm, membrane of the cell and in a sphere of 2 cm surrounding the source (in eV) were: 4.30E3, 4.85E2, 1.07E2 and 3.29E4, correspondingly, for the {sup 111}In; 4.46E3, 3.76E3, 1.26E3 and 1.33E5 for the {sup 177}Lu and; 2.12E3, 2.58E2, 9.33E1 and 1.88E4 for the {sup 99m}Tc. We can conclude that if the union of these radionuclides happens to a compound that was internalized to the cell nucleus, the best for therapy at this level is the conjugate with the {sup 177}Lu, followed by that with {sup 111}In and in third place that with {sup 99m}Tc. (Author)
International Nuclear Information System (INIS)
Kang, Hua; Watkins, Gareth; Parr, Christian; Douglas-Jones, Anthony; Mansel, Robert E; Jiang, Wen G
2005-01-01
Stromal cell-derived factor (SDF)-1 (CXC chemokine ligand-12) is a member of the CXC subfamily of chemokines, which, through its cognate receptor (CXC chemokine receptor [CXCR]4), plays an important role in chemotaxis of cancer cells and in tumour metastasis. We conducted the present study to evaluate the effect of SDF-1 on the invasiveness and migration of breast cancer cells, and we analyzed the expression of SDF-1 and its relation to clinicopathological features and clinical outcomes in human breast cancer. Expression of SDF-1 mRNA in breast cancer, endothelial (HECV) and fibroblast (MRC5) cell lines and in human breast tissues were studied using RT-PCR. MDA-MB-231 cells were transfected with a SDF-1 expression vector, and their invasiveness and migration was tested in vitro. In addition, the expression of SDF-1 was investigated using immunohistochemistry and quantitative RT-PCR in samples of normal human mammary tissue (n = 32) and mammary tumour (n = 120). SDF-1 expression was identified in MRC5, MDA-MB-435s and MDA-MB-436 cell lines, but CXCR4 expression was detected in all cell lines and breast tissues. An autocrine loop was created following transfection of MDA-MB-231 (which was CXCR4 positive and SDF-1 negative) with a mammalian expression cassette encoding SDF-1 (MDA-MB-231SDF1 +/+ ) or with control plasmid pcDNA4/GFP (MDA-MB-231 +/- ). MDA-MB-231SDF1 +/+ cells exhibited significantly greater invasion and migration potential (in transfected cells versus in wild type and empty MDA-MB-231 +/- ; P < 0.01). In mammary tissues SDF-1 staining was primarily seen in stromal cells and weakly in mammary epithelial cells. Significantly higher levels of SDF-1 were seen in node-positive than in node-negative tumours (P = 0.05), in tumours that metastasized (P = 0.05), and tumours from patients who died (P = 0.03) than in tumours from patients who were disease free. It was most notable that levels of SDF-1 correlated significantly with overall survival (P = 0.001) and
Autophagy contributes to resistance of tumor cells to ionizing radiation.
Chaachouay, Hassan; Ohneseit, Petra; Toulany, Mahmoud; Kehlbach, Rainer; Multhoff, Gabriele; Rodemann, H Peter
2011-06-01
Autophagy signaling is a novel important target to improve anticancer therapy. To study the role of autophagy on resistance of tumor cells to ionizing radiation (IR), breast cancer cell lines differing in their intrinsic radiosensitivity were used. Breast cancer cell lines MDA-MB-231 and HBL-100 were examined with respect to clonogenic cell survival and induction of autophagy after radiation exposure and pharmacological interference of the autophagic process. As marker for autophagy the appearance of LC3-I and LC3-II proteins was analyzed by SDS-PAGE and Western blotting. Formation of autophagic vacuoles was monitored by immunofluorescence staining of LC3. LC3-I and LC3-II formation differs markedly in radioresistant MDA-MB-231 versus radiosensitive HBL-100 cells. Western blot analyses of LC3-II/LC3-I ratio indicated marked induction of autophagy by IR in radioresistant MDA-MB-231 cells, but not in radiosensitive HBL-100 cells. Indirect immunofluorescence analysis of LC3-II positive vacuoles confirmed this differential effect. Pre-treatment with 3-methyladenine (3-MA) antagonized IR-induced autophagy. Likewise, pretreatment of radioresistant MDA-231 cells with autophagy inhibitors 3-MA or chloroquine (CQ) significantly reduced clonogenic survival of irradiated cells. Our data clearly indicate that radioresistant breast tumor cells show a strong post-irradiation induction of autophagy, which thus serves as a protective and pro-survival mechanism in radioresistance. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Mechanisms underlying differential expression of interleukin-8 in breast cancer cells
Freund, Ariane; Jolivel, Valérie; Durand, Sébastien; Kersual, Nathalie; Chalbos, Dany; Chavey, Carine; Vignon, Françoise; Lazennec, Gwendal
2004-01-01
We have recently reported that Interleukin-8 (IL-8) expression was inversely correlated to estrogen-receptor (ER)-status and was overexpressed in invasive breast cancer cells. In the present study, we show that IL-8 overexpression in breast cancer cells involves a higher transcriptional activity of IL-8 gene promoter. Cloning of IL-8 promoter from MDA-MB-231 and MCF-7 cells expressing high and low levels of IL-8, respectively, shows the integrity of the promoter in both cell lines. Deletion and site-directed mutagenesis of the promoter demonstrate that NF-κB and AP-1 and to a lesser extent C/EBP binding sites play a crucial role in the control of IL-8 promoter activity in MDA-MB-231 cells. Knock-down of NF-κB and AP-1 activities by adenovirus-mediated expression of a NF-κB super-repressor and RNA interference, respectively, decreased IL-8 expression in MDA-MB-231 cells. On the contrary, restoration of Fra-1, Fra-2, c-Jun, p50, p65, C/EBPα and C/EBPβ expression levels in MCF-7 cells led to a promoter activity comparable to that observed in MDA-MB-231 cells. Our data constitute the first extensive study of IL-8 gene overexpression in breast cancer cells and suggest that the high expression of IL-8 in invasive cancer cells requires a complex cooperation between NF-κB, AP-1 and C/EBP transcription factors. PMID:15208657
Directory of Open Access Journals (Sweden)
Xiaohua Pan
2016-02-01
Full Text Available Epigallocatechin-3-gallate (EGCG is a type of catechin extracted from green tea, which is reported to have anticancer effects. EGCG is also reported to inhibit the cancer stem/progenitor cells in several estrogen receptor (ER-negative breast cancer cell lines, such as SUM-149, SUM-190 and MDA-MB-231. And all these cancer cells are highly expressed a new variant of ER-α, ER-α36. The aim of our present study is to determine the role of ER-α36 in the growth inhibitory activity of EGCG towards ER-negative breast cancer MDA-MB-231 and MDA-MB-436 cells. We found that EGCG potently inhibited the growth of cancer stem/progenitor cells in MDA-MB-231 and MDA-MB-436 cells, and also reduced the expression of ER-α36 in these cells. However, in ER-α36 knocked-down MDA-MB-231 and MDA-MB-436 cells, no significant inhibitory effects of EGCG on cancer stem/progenitor cells were observed. We also found that down-regulation of ER-α36 expression was in accordance with down-regulation of EGFR, which further verified a loop between ER-α36 and EGFR. Thus, our study indicated ER-α36 is involved in EGCG's inhibitory effects on ER-negative breast cancer stem/progenitor cells, which supports future preclinical and clinical evaluation of EGCG as a therapeutic option for ER-α36 positive breast cancer.
The origin, global distribution, and functional impact of the human 8p23 inversion polymorphism.
Salm, Maximilian P A; Horswell, Stuart D; Hutchison, Claire E; Speedy, Helen E; Yang, Xia; Liang, Liming; Schadt, Eric E; Cookson, William O; Wierzbicki, Anthony S; Naoumova, Rossi P; Shoulders, Carol C
2012-06-01
Genomic inversions are an increasingly recognized source of genetic variation. However, a lack of reliable high-throughput genotyping assays for these structures has precluded a full understanding of an inversion's phylogenetic, phenotypic, and population genetic properties. We characterize these properties for one of the largest polymorphic inversions in man (the ∼4.5-Mb 8p23.1 inversion), a structure that encompasses numerous signals of natural selection and disease association. We developed and validated a flexible bioinformatics tool that utilizes SNP data to enable accurate, high-throughput genotyping of the 8p23.1 inversion. This tool was applied retrospectively to diverse genome-wide data sets, revealing significant population stratification that largely follows a clinal "serial founder effect" distribution model. Phylogenetic analyses establish the inversion's ancestral origin within the Homo lineage, indicating that 8p23.1 inversion has occurred independently in the Pan lineage. The human inversion breakpoint was localized to an inverted pair of human endogenous retrovirus elements within the large, flanking low-copy repeats; experimental validation of this breakpoint confirmed these elements as the likely intermediary substrates that sponsored inversion formation. In five data sets, mRNA levels of disease-associated genes were robustly associated with inversion genotype. Moreover, a haplotype associated with systemic lupus erythematosus was restricted to the derived inversion state. We conclude that the 8p23.1 inversion is an evolutionarily dynamic structure that can now be accommodated into the understanding of human genetic and phenotypic diversity.
ORF Alignment: NC_003071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DSPIQCFIKRNRATATYILYYGLMPSETENDKLLLAARRIRRATCTDFIISLSAK 60 ... Query: 231 ITYELNVLRTRGPRRMHCAMDSIPLSSVIAEPSVVQG...IEEEVSSSPSPKGETITTDKEIP 290 ... ITYELNVLRTRGPRRMHCAMDSIPLSSVIAEPSVVQGIEEEVSSSPSPKGETITTDKEIP Sbjct: 121 ITYELNVLRTRGPRRMHC
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 231 ... Query: 171 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 230 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 231 ... Query: 198 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 257 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL
Lifescience Database Archive (English)
Full Text Available 112124 Link to Original y[*] w[*]; P{GawB}NP0278 / TM6, P{UAS-lacZ.UW23-1}UW23-1 62...E7 Link to DGRC Genome Viewer: 112124 dos RpL8 CG16984 278 3 FlyBase Insertion: P{GawB}NP0278 NP line. Recei...56 1 Request - scattered cells no larva sg internal - - - - - - - Show 112124 DGRC Number 11212... Site 62E7 Map Viewer Link to DGRC Genome Viewer: 112124 Related Genes dos RpL8 CG16984 Original Number 278
Synthesis and Anticancer Activities of Glycyrrhetinic Acid Derivatives
Directory of Open Access Journals (Sweden)
Yang Li
2016-02-01
Full Text Available A total of forty novel glycyrrhetinic acid (GA derivatives were designed and synthesized. The cytotoxic activity of the novel compounds was tested against two human breast cancer cell lines (MCF-7, MDA-MB-231 in vitro by the MTT method. The evaluation results revealed that, in comparison with GA, compound 42 shows the most promising anticancer activity (IC50 1.88 ± 0.20 and 1.37 ± 0.18 µM for MCF-7 and MDA-MB-231, respectively and merits further exploration as a new anticancer agent.
Lifescience Database Archive (English)
Full Text Available 112099 Link to Original w[*]; P{GawB}NP0230 / TM6, P{UAS-lacZ.UW23-1}UW23-1 --- Lin...k to DGRC Genome Viewer: 112099 CG40245 CG40249 230 3 NP line. Received from the National Institute of Genet...lls weak tr. - - - comment1:C, comment2:61A-B d1 d2 d3 d4 d5 - - - Show 112099 DGRC Number 11209...ertion Site --- Map Viewer Link to DGRC Genome Viewer: 112099 Related Genes CG40245 CG40249 Original Number
Medical Surveillance Monthly Report (MSMR). Volume 21, Number 4, April 2014
2014-04-01
Disorders of fl uid electrolyte/acid-base balance 178 33.5 Other cellulitis and abscess 1,031 70.7 Diabetes mellitus 156 29.4 Pilonidal cyst 100 6.9...Nontoxic nodular goiter 39 7.3 Cellulitis and abscess of fi nger and toe 98 6.7 Thyrotoxicosis with or without goiter 29 5.5 Other disorders of skin...31 34.1 Other cellulitis and abscess 109 58.9 Other and unspecifi ed anemias 21 23.1 Pilonidal cyst 21 11.4 Diseases of white blood cells 21 23.1
Benzyl isothiocyanate causes FoxO1-mediated autophagic death in human breast cancer cells.
Directory of Open Access Journals (Sweden)
Dong Xiao
Full Text Available Benzyl isothiocyanate (BITC, a constituent of edible cruciferous vegetables, inhibits growth of breast cancer cells but the mechanisms underlying growth inhibitory effect of BITC are not fully understood. Here, we demonstrate that BITC treatment causes FoxO1-mediated autophagic death in cultured human breast cancer cells. The BITC-treated breast cancer cells (MDA-MB-231, MCF-7, MDA-MB-468, BT-474, and BRI-JM04 and MDA-MB-231 xenografts from BITC-treated mice exhibited several features characteristic of autophagy, including appearance of double-membrane vacuoles (transmission electron microscopy and acidic vesicular organelles (acridine orange staining, cleavage of microtubule-associated protein 1 light chain 3 (LC3, and/or suppression of p62 (p62/SQSTM1 or sequestosome 1 expression. On the other hand, a normal human mammary epithelial cell line (MCF-10A was resistant to BITC-induced autophagy. BITC-mediated inhibition of MDA-MB-231 and MCF-7 cell viability was partially but statistically significantly attenuated in the presence of autophagy inhibitors 3-methyl adenine and bafilomycin A1. Stable overexpression of Mn-superoxide dismutase, which was fully protective against apoptosis, conferred only partial protection against BITC-induced autophagy. BITC treatment decreased phosphorylation of mTOR and its downstream targets (P70s6k and 4E-BP1 in cultured MDA-MB-231 and MCF-7 cells and MDA-MB-231 xenografts, but activation of mTOR by transient overexpression of its positive regulator Rheb failed to confer protection against BITC-induced autophagy. Autophagy induction by BITC was associated with increased expression and acetylation of FoxO1. Furthermore, autophagy induction and cell growth inhibition resulting from BITC exposure were significantly attenuated by small interfering RNA knockdown of FoxO1. In conclusion, the present study provides novel insights into the molecular circuitry of BITC-induced cell death involving FoxO1-mediated autophagy.
Wei, Zhengxi; Shan, Zhongguo; Shaikh, Zahir A
2018-04-01
Epidemiological and experimental studies have implicated cadmium (Cd) with breast cancer. In breast epithelial MCF10A and MDA-MB-231 cells, Cd has been shown to promote cell growth. The present study examined whether Cd also promotes epithelial-mesenchymal transition (EMT), a hallmark of cancer progression. Human breast epithelial cells consisting of non-cancerous MCF10A, non-metastatic HCC 1937 and HCC 38, and metastatic MDA-MB-231 were treated with 1 or 3 μM Cd for 4 weeks. The MCF10A epithelial cells switched to a more mesenchymal-like morphology, which was accompanied by a decrease in the epithelial marker E-cadherin and an increase in the mesenchymal markers N-cadherin and vimentin. In both non-metastatic HCC 1937 and HCC 38 cells, treatment with Cd decreased the epithelial marker claudin-1. In addition, E-cadherin also decreased in the HCC 1937 cells. Even the mesenchymal-like MDA-MB-231 cells exhibited an increase in the mesenchymal marker vimentin. These changes indicated that prolonged treatment with Cd resulted in EMT in both normal and cancer-derived breast epithelial cells. Furthermore, both the MCF10A and MDA-MB-231 cells labeled with Zcad, a dual sensor for tracking EMT, demonstrated a decrease in the epithelial marker E-cadherin and an increase in the mesenchymal marker ZEB-1. Treatment of cells with Cd significantly increased the level of Snail, a transcription factor involved in the regulation of EMT. However, the Cd-induced Snail expression was completely abolished by actinomycin D. Luciferase reporter assay indicated that the expression of Snail was regulated by Cd at the promotor level. Snail was essential for Cd-induced promotion of EMT in the MDA-MB-231 cells, as knockdown of Snail expression blocked Cd-induced cell migration. Together, these results indicate that Cd promotes EMT in breast epithelial cells and does so by modulating the transcription of Snail. Copyright © 2018 Elsevier Inc. All rights reserved.
Estrogen enhanced cell-cell signalling in breast cancer cells exposed to targeted irradiation
International Nuclear Information System (INIS)
Shao, Chunlin; Folkard, Melvyn; Held, Kathryn D; Prise, Kevin M
2008-01-01
Radiation-induced bystander responses, where cells respond to their neighbours being irradiated are being extensively studied. Although evidence shows that bystander responses can be induced in many types of cells, it is not known whether there is a radiation-induced bystander effect in breast cancer cells, where the radiosensitivity may be dependent on the role of the cellular estrogen receptor (ER). This study investigated radiation-induced bystander responses in estrogen receptor-positive MCF-7 and estrogen receptor-negative MDA-MB-231 breast cancer cells. The influence of estrogen and anti-estrogen treatments on the bystander response was determined by individually irradiating a fraction of cells within the population with a precise number of helium-3 using a charged particle microbeam. Damage was scored as chromosomal damage measured as micronucleus formation. A bystander response measured as increased yield of micronucleated cells was triggered in both MCF-7 and MDA-MB-231 cells. The contribution of the bystander response to total cell damage in MCF-7 cells was higher than that in MDA-MB-231 cells although the radiosensitivity of MDA-MB-231 was higher than MCF-7. Treatment of cells with 17β-estradiol (E2) increased the radiosensitivity and the bystander response in MCF-7 cells, and the effect was diminished by anti-estrogen tamoxifen (TAM). E2 also increased the level of intracellular reactive oxygen species (ROS) in MCF-7 cells in the absence of radiation. In contrast, E2 and TAM had no influence on the bystander response and ROS levels in MDA-MB-231 cells. Moreover, the treatment of MCF-7 cells with antioxidants eliminated both the E2-induced ROS increase and E2-enhanced bystander response triggered by the microbeam irradiation, which indicates that ROS are involved in the E2-enhanced bystander micronuclei formation after microbeam irradiation. The observation of bystander responses in breast tumour cells may offer new potential targets for radiation
GPER mediated estradiol reduces miR-148a to promote HLA-G expression in breast cancer
Energy Technology Data Exchange (ETDEWEB)
Tao, Sifeng, E-mail: taosifeng@aliyun.com; He, Haifei; Chen, Qiang; Yue, Wenjie
2014-08-15
Highlights: • E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells. • GPER mediates the E2-induced increase of miR-148a in MCF-7 and MDA-MB-231 cells. • E2-GPER regulates the expression of HLA-G by miR-148a. - Abstract: Breast cancer is the most common malignant diseases in women. miR-148a plays an important role in regulation of cancer cell proliferation and cancer invasion and down-regulation of miR-148a has been reported in both estrogen receptor (ER) positive and triple-negative (TN) breast cancer. However, the regulation mechanism of miR-148a is unclear. The role of estrogen signaling, a signaling pathway is important in development and progression of breast cancer. Therefore, we speculated that E2 may regulate miR-148a through G-protein-coupled estrogen receptor-1 (GPER). To test our hypothesis, we checked the effects of E2 on miR-148a expression in ER positive breast cancer cell MCF-7 and TN cancer cell MDA-MB-231. Then we used GPER inhibitor G15 to investigate whether GPER is involved in regulation of E2 on miR-148a. Furthermore, we analyzed whether E2 affects the expression of HLA-G, which is a miR-148a target gene through GPER. The results showed that E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells, GPER mediates the E2-induced increase in miR-148a expression in MCF-7 and MDA-MB-231 cells and E2-GPER regulates the expression of HLA-G by miR-148a. In conclusion, our findings offer important new insights into the ability of estrogenic GPER signaling to trigger HLA-G expression through inhibiting miR-148a that supports immune evasion in breast cancer.
Zirconium phosphate nanoplatelets: a biocompatible nanomaterial for drug delivery to cancer
Saxena, Vipin; Diaz, Agustin; Clearfield, Abraham; Batteas, James D.; Hussain, Muhammad Delwar
2013-02-01
The objective of this study was to evaluate the biocompatibility of zirconium phosphate (ZrP) nanoplatelets (NPs), and their use in drug delivery. ZrP and doxorubicin-intercalated ZrP (DOX:ZrP) NPs were characterized by using X-Ray Powder Diffraction (XRPD), Thermogravimetric Analysis (TGA), Transmission Electron Micrography (TEM), Scanning Electron Microscopy (SEM) and Atomic Force Microscopy (AFM). Biocompatibility of ZrP NPs was evaluated in human embryonic kidney (HEK-293), breast cancer (MCF-7), metastatic breast cancer (MDA-MB-231), ovarian cancer (OVCAR-3), resistant cancer (NCI-RES/ADR) cells and mouse macrophage (RAW 264.7) cell lines. Hemocompatibility of ZrP NPs was evaluated with human red blood cells. Simulated body fluid (SBF) of pH 7.4 was used to determine the in vitro release of doxorubicin from DOX:ZrP NPs. Cellular uptake and in vitro cytotoxicity studies of DOX:ZrP NPs were determined in MDA-MB-231. The ZrP nanomaterial can be prepared in the 100-200 nm size range with a platelet-like shape. The ZrP NPs themselves are biocompatible, hemocompatible and showed no toxicity to the macrophage cells. ZrP NPs can intercalate high loads (35% w/w) of doxorubicin between their layers. The release of DOX was sustained for about 2 weeks. DOX:ZrP NPs showed higher cellular uptake and increased cytotoxicity than free DOX in MDA-MB-231 cells. ZrP NPs are highly biocompatible, can intercalate large amounts of drugs and sustain the release of drugs. ZrP NPs improved the cellular uptake and cytotoxicity of DOX to MDA-MB-231 cells. ZrP NPs are promising nanocarriers for drug delivery in cancer therapy.The objective of this study was to evaluate the biocompatibility of zirconium phosphate (ZrP) nanoplatelets (NPs), and their use in drug delivery. ZrP and doxorubicin-intercalated ZrP (DOX:ZrP) NPs were characterized by using X-Ray Powder Diffraction (XRPD), Thermogravimetric Analysis (TGA), Transmission Electron Micrography (TEM), Scanning Electron Microscopy (SEM
ORF Alignment: NC_004354 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available L) ... Length = 231 ... Query: 9 ... KVIPSASEEQLVQALGDLLQRCSQEALAKHDKFXXXXXXXXX...XXXXTKALKSCNLKTAKW 68 ... KVIPSASEEQLVQALGDLLQRCSQEALAKHDKF ... TKALKSCNLKTAKW Sbjct: 1 ... KVIPSAS