WorldWideScience

Sample records for actinium 230

  1. Synthesis and Characterization of the Actinium Aquo Ion

    OpenAIRE

    Maryline G. Ferrier; Benjamin W. Stein; Enrique R. Batista; John M. Berg; Eva R. Birnbaum; Jonathan W. Engle; Kevin D. John; Stosh A. Kozimor; Juan S. Lezama Pacheco; Lindsay N. Redman

    2017-01-01

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H2O) x 3+) is critical for current ef...

  2. Synthesis and Characterization of the Actinium Aquo Ion.

    Science.gov (United States)

    Ferrier, Maryline G; Stein, Benjamin W; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Engle, Jonathan W; John, Kevin D; Kozimor, Stosh A; Lezama Pacheco, Juan S; Redman, Lindsay N

    2017-03-22

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H 2 O) x 3+ ) is critical for current efforts to develop 225 Ac [ t 1/2 = 10.0(1) d] as a targeted anticancer therapeutic agent. However, given the limited amount of actinium available for study and its high radioactivity, many aspects of actinium chemistry remain poorly defined. We overcame these challenges using the longer-lived 227 Ac [ t 1/2 = 21.772(3) y] isotope and report the first characterization of this fundamentally important Ac-aquo coordination complex. Our X-ray absorption fine structure study revealed 10.9 ± 0.5 water molecules directly coordinated to the Ac III cation with an Ac-O H2O distance of 2.63(1) Å. This experimentally determined distance was consistent with molecular dynamics density functional theory results that showed (over the course of 8 ps) that Ac III was coordinated by 9 water molecules with Ac-O H2O distances ranging from 2.61 to 2.76 Å. The data is presented in the context of other actinide(III) and lanthanide(III) aquo ions characterized by XAFS and highlights the uniqueness of the large Ac III coordination numbers and long Ac-O H2O bond distances.

  3. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  4. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  5. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  6. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  7. LaPO4 Nanoparticles Doped with Actinium-225 that Partially Sequester Daughter Radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Woodward, Jonathan [ORNL; Kennel, Steve J [ORNL; Stucnkey, Alan [University of Tennessee, Knoxville (UTK); Osborne, Dustin [University of Tennessee, Knoxville (UTK); Wall, Jonathan [University of Tennessee, Knoxville (UTK); Rondinone, Adam Justin [ORNL; Standaert, Robert F [ORNL; Mirzadeh, Saed [ORNL

    2011-01-01

    Nanoscale materials have been envisioned as carriers for various therapeutic drugs, including radioisotopes. Inorganic nanoparticles (NPs) are particularly appealing vehicles for targeted radiotherapy because they can package several radioactive atoms into a single carrier and can potentially retain daughter radioisotopes produced by in vivo generators such as actinium -225 (225Ac, t1/2=10 d). Decay of this radioisotope to stable bismuth-209 proceeds through a chain of short-lived daughters accompanied by the emission of four -particles that release >27 MeV of energy. The challenge in realizing the enhanced cytotoxic potential of in vivo generators lies in retaining the daughter nuclei at the therapy site. When 225Ac is attached to targeting agents via standard chelate conjugation methods, all of the daughter radionuclides are released after the initial -decay occurs. In this work, 225Ac was incorporated into lanthanum phosphate NPs to determine whether the radioisotope and its daughters would be retained within the dense mineral lattice. Further, the 225Ac-doped NPs were conjugated to the monoclonal antibody mAb 201B, which targets mouse lung endothelium through the vasculature, to ascertain the targeting efficacy and in vivo retention of radioisotopes. Standard biodistribution techniques and microSPECT/CT imaging of 225Ac as well as the daughter radioisotopes showed that the NPs accumulated rapidly in mouse lung after intravenous injection. By showing that excess, competing, uncoupled antibodies or NPs coupled to control mAbs are deposited primarily in the liver and spleen, specific targeting of NP-mAb 201B conjugates was demonstrated. Biodistribution analysis showed that ~30% of the total injected dose of La(225Ac)PO4 NPs accumulated in mouse lungs 1 h post-injection yielding a value of % ID/g >200. Furthermore, after 24 h, 80% of the 213Bi daughter produced from 225Ac decay was retained within the target organ and 213Bi retention increased to ~87% at 120 h. In

  8. 17 CFR 230.800 - Definitions for §§ 230.800, 230.801 and 230.802.

    Science.gov (United States)

    2010-04-01

    ... private issuer's) incorporation, organization or chartering and the principal foreign market where the... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Definitions for §§ 230.800, 230.801 and 230.802. 230.800 Section 230.800 Commodity and Securities Exchanges SECURITIES AND...

  9. Dicty_cDB: CFK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFK230 (Link to dictyBase) - - - Contig-U16381-1 CFK230P (Link to Original site) CFK230...F 158 CFK230Z 757 CFK230P 895 - - Show CFK230 Library CF (Link to library) Clone ID CFK230... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFK2-B/CFK230Q.Seq.d/ Representative seq. ID CFK230...P (Link to Original site) Representative DNA sequence >CFK230 (CFK230Q) /CSM/CF/CFK2-B/CFK230... cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CFK230

  10. 40 CFR 230.97 - Management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Management. 230.97 Section 230.97... Losses of Aquatic Resources § 230.97 Management. (a) Site protection. (1) The aquatic habitats, riparian.... For government property, long-term protection may be provided through federal facility management...

  11. 22 CFR 230.16 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 230.16 Section 230.16 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States of...

  12. 33 CFR 230.21 - Adoption.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Adoption. 230.21 Section 230.21 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.21 Adoption. See 40 CFR 1506.3. A district commander will normally adopt...

  13. 15 CFR 230.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE STANDARD REFERENCE MATERIALS STANDARD REFERENCE MATERIALS General Information § 230.1 Introduction. This part states the procedure for ordering Standard Reference... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Introduction. 230.1 Section 230.1...

  14. 49 CFR 230.47 - Boiler number.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Boiler number. 230.47 Section 230.47..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.47 Boiler number. (a) Generally. The builder's number of the boiler, if known, shall...

  15. 29 CFR 99.230 - Audit costs.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Audit costs. 99.230 Section 99.230 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.230 Audit costs. (a) Allowable costs. Unless prohibited by law, the cost of audits made in accordance with the...

  16. 21 CFR 556.230 - Erythromycin.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Erythromycin. 556.230 Section 556.230 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... Residues of New Animal Drugs § 556.230 Erythromycin. Tolerances for residues of erythromycin in food are...

  17. 40 CFR 230.53 - Aesthetics.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Aesthetics. 230.53 Section 230.53... Characteristics § 230.53 Aesthetics. (a) Aesthetics associated with the aquatic ecosystem consist of the perception of beauty by one or a combination of the senses of sight, hearing, touch, and smell. Aesthetics of...

  18. 40 CFR 230.42 - Mud flats.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Mud flats. 230.42 Section 230.42... Aquatic Sites § 230.42 Mud flats. (a) Mud flats are broad flat areas along the sea coast and in coastal rivers to the head of tidal influence and in inland lakes, ponds, and riverine systems. When mud flats...

  19. 22 CFR 230.14 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 230.14 Section 230.14 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.14 Arbitration. Any... arbitration to be held in Washington, DC in accordance with the then prevailing rules of the American...

  20. 7 CFR 65.230 - Production step.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Production step. 65.230 Section 65.230 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards..., PEANUTS, AND GINSENG General Provisions Definitions § 65.230 Production step. Production step means, in...

  1. 49 CFR 230.62 - Dry pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dry pipe. 230.62 Section 230.62 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Pipes § 230...

  2. 21 CFR 173.230 - Ethylene dichloride.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ethylene dichloride. 173.230 Section 173.230 Food... Solvents, Lubricants, Release Agents and Related Substances § 173.230 Ethylene dichloride. A tolerance of 30 parts per million is established for ethylene dichloride in spice oleoresins when present therein...

  3. 40 CFR 230.44 - Coral reefs.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Coral reefs. 230.44 Section 230.44... Aquatic Sites § 230.44 Coral reefs. (a) Coral reefs consist of the skeletal deposit, usually of calcareous... by increasing the level of suspended particulates. Coral organisms are extremely sensitive to even...

  4. 46 CFR 183.230 - Temperature ratings.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Temperature ratings. 183.230 Section 183.230 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION General Requirements § 183.230 Temperature ratings. Temperature ratings of electrical...

  5. 49 CFR 230.105 - Lateral motion.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lateral motion. 230.105 Section 230.105... Tenders Running Gear § 230.105 Lateral motion. (a) Condemning limits. The total lateral motion or play... require additional lateral motion. (c) Non-interference with other parts. The lateral motion shall in all...

  6. 40 CFR 230.4 - Organization.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Organization. 230.4 Section 230.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL General § 230.4 Organization. The...

  7. 49 CFR 230.59 - Fusible plugs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fusible plugs. 230.59 Section 230.59 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Fusible Plugs § 230.59 Fusible plugs. If boilers are equipped with fusible plugs, the plugs shall be...

  8. 49 CFR 230.114 - Wheel centers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Wheel centers. 230.114 Section 230.114... Tenders Wheels and Tires § 230.114 Wheel centers. (a) Filling blocks and shims. Driving and trailing wheel... and the wheel center, not more than two thicknesses of shims may be used, one of which must extend...

  9. 34 CFR 300.230 - SEA flexibility.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false SEA flexibility. 300.230 Section 300.230 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES Local Educational Agency Eligibility § 300.230 SEA flexibility. (a) Adjustment to State fiscal...

  10. 49 CFR 230.83 - Cylinder cocks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Cylinder cocks. 230.83 Section 230.83... Tenders Cabs, Warning Signals, Sanders and Lights § 230.83 Cylinder cocks. Each steam locomotive shall be equipped with cylinder cocks which can be operated from the cab of the steam locomotive. All cylinder cocks...

  11. 7 CFR 932.230 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 932.230 Section 932.230 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE OLIVES GROWN IN CALIFORNIA Rules and Regulations § 932.230 Assessment rate....

  12. 40 CFR 230.25 - Salinity gradients.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Salinity gradients. 230.25 Section 230... Physical and Chemical Characteristics of the Aquatic Ecosystem § 230.25 Salinity gradients. (a) Salinity... fresh or salt water may change existing salinity gradients. For example, partial blocking of the...

  13. 40 CFR 230.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 230.3 Section 230.3...) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL General § 230.3 Definitions. For... chemical or biological substance in a form that can be incorporated into, onto or be ingested by and that...

  14. 40 CFR 230.22 - Water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water. 230.22 Section 230.22... Chemical Characteristics of the Aquatic Ecosystem § 230.22 Water. (a) Water is the part of the aquatic... the liquid phase and is contained by the substrate. Water forms part of a dynamic aquatic life...

  15. 49 CFR 230.76 - Piston travel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Piston travel. 230.76 Section 230.76... Tenders Brake and Signal Equipment § 230.76 Piston travel. (a) Minimum piston travel. The minimum piston travel shall be sufficient to provide proper brake shoe clearance when the brakes are released. (b...

  16. 32 CFR 230.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 230.5 Section 230.5 National... FINANCIAL INSTITUTIONS ON DOD INSTALLATIONS § 230.5 Responsibilities. (a) The Under Secretary of Defense... affect the morale and welfare of DoD personnel. (d) DoD Component responsibilities pertaining to this...

  17. 12 CFR 230.4 - Account disclosures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Account disclosures. 230.4 Section 230.4 Banks... IN SAVINGS (REGULATION DD) § 230.4 Account disclosures. (a) Delivery of account disclosures—(1) Account opening. (i) General. A depository institution shall provide account disclosures to a consumer...

  18. 12 CFR 230.8 - Advertising.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Advertising. 230.8 Section 230.8 Banks and... SAVINGS (REGULATION DD) § 230.8 Advertising. (a) Misleading or inaccurate advertisements. An advertisement... obtain the advertised annual percentage yield. For tiered-rate accounts, the minimum balance required for...

  19. 49 CFR 230.89 - Reverse gear.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Reverse gear. 230.89 Section 230.89 Transportation... Reversing Gear § 230.89 Reverse gear. (a) General provisions. Reverse gear, reverse levers, and quadrants... quadrant. Proper counterbalance shall be provided for the valve gear. (b) Air-operated power reverse gear...

  20. β -delayed fission of 230Am

    Science.gov (United States)

    Wilson, G. L.; Takeyama, M.; Andreyev, A. N.; Andel, B.; Antalic, S.; Catford, W. N.; Ghys, L.; Haba, H.; Heßberger, F. P.; Huang, M.; Kaji, D.; Kalaninova, Z.; Morimoto, K.; Morita, K.; Murakami, M.; Nishio, K.; Orlandi, R.; Smith, A. G.; Tanaka, K.; Wakabayashi, Y.; Yamaki, S.

    2017-10-01

    The exotic decay process of β -delayed fission (β DF ) has been studied in the neutron-deficient isotope 230Am. The 230Am nuclei were produced in the complete fusion reaction 207Pb(27Al,4 n )230Am and separated by using the GARIS gas-filled recoil ion separator. A lower limit for the β DF probability Pβ DF(230Am)>0.30 was deduced, which so far is the highest value among all known β DF nuclei. The systematics of β DF in the region of 230Am will be discussed.

  1. Dicty_cDB: VFK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFK230 (Link to dictyBase) - - - Contig-U15118-1 VFK230E (Link to Original site) VFK230...F 637 VFK230Z 349 VFK230P 966 VFK230E 744 Show VFK230 Library VF (Link to library) Clone ID VFK230...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-B/VFK230Q.Seq.d/ Representative seq. ID VFK230...E (Link to Original site) Representative DNA sequence >VFK230 (VFK230Q) /CSM/VF/VFK2-B/VFK230...mgyrtscxyhrwcsq lpirxcx Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFK230 (VFK230

  2. Dicty_cDB: VSK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK230 (Link to dictyBase) - - - Contig-U08358-1 VSK230P (Link to Original site) VSK230...F 494 VSK230Z 475 VSK230P 969 - - Show VSK230 Library VS (Link to library) Clone ID VSK230... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSK2-B/VSK230Q.Seq.d/ Representative seq. ID VSK230...P (Link to Original site) Representative DNA sequence >VSK230 (VSK230Q) /CSM/VS/VSK2-B/VSK230...roducing significant alignments: (bits) Value VSK230 (VSK230Q) /CSM/VS/VSK2-B/VSK230

  3. Dicty_cDB: VHK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK230 (Link to dictyBase) - - - Contig-U16571-1 VHK230P (Link to Original site) VHK230...F 597 VHK230Z 784 VHK230P 1361 - - Show VHK230 Library VH (Link to library) Clone ID VHK230...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-B/VHK230Q.Seq.d/ Representative seq. ID VHK230...P (Link to Original site) Representative DNA sequence >VHK230 (VHK230Q) /CSM/VH/VHK2-B/VHK230...kp Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHK230 (VHK230Q) /CSM/VH/VHK2-B/VHK230

  4. Dicty_cDB: VHP230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP230 (Link to dictyBase) - - - Contig-U16260-1 VHP230P (Link to Original site) VHP...230F 531 VHP230Z 681 VHP230P 1192 - - Show VHP230 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-B/VHP230Q.Seq.d/ Representative seq. ID VHP...230P (Link to Original site) Representative DNA sequence >VHP230 (VHP230Q) /CSM/VH/VHP2-B/VHP...frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsfli--- ---rmg*k*chehlvfrsrr*rcqsxrqchqrcsife*n*rffrwcfpmghqrrccl**k herypfqsl*chp

  5. Dicty_cDB: SLJ230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ230 (Link to dictyBase) - - - - SLJ230Z (Link to Original site) - - SLJ...230Z 354 - - - - Show SLJ230 Library SL (Link to library) Clone ID SLJ230 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ2-B/SLJ...230Q.Seq.d/ Representative seq. ID SLJ230Z (Link to Original site) R...epresentative DNA sequence >SLJ230 (SLJ230Q) /CSM/SL/SLJ2-B/SLJ230Q.Seq.d/ XXXXXXXXXXGAAACCACCTACAACTCCATCAT

  6. Nuclear Data Sheets for A = 230

    Energy Technology Data Exchange (ETDEWEB)

    Browne, E.; Tuli, J.K. [National Nuclear Data Center, Brookhaven National Laboratory, Upton, New York 11973-5000 (United States)

    2012-08-15

    The evaluators present in this publication spectroscopic data and level schemes from radioactive decay and nuclear reactions for all isobars with mass number A=230. This evaluation includes the first experimental evidence of {sup 230}Am, produced through the {sup 197}Au({sup 40}Ar,3n){sup 234}Bk ({alpha} decay to {sup 230}Am) reaction, E({sup 40}Ar)=188.4 MeV (2003MoZX).

  7. Dicty_cDB: SSK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK230 (Link to dictyBase) - - - Contig-U16247-1 SSK230E (Link... to Original site) - - - - - - SSK230E 210 Show SSK230 Library SS (Link to library) Clone ID SSK230 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSK2-B/SSK230Q.Seq.d/ Representative seq. ID SSK230...E (Link to Original site) Representative DNA sequence >SSK230 (SSK230Q) /CSM/SS/SSK2-B/SSK230Q.Seq.d/ GCTCA... SSK380 (SSK380Q) /CSM/SS/SSK3-D/SSK380Q.Seq.d/ 327 4e-89 SSK230 (SSK230Q) /CSM/SS/SSK2-B/SSK230

  8. Dicty_cDB: AFK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK230 (Link to dictyBase) - - - Contig-U13965-1 AFK230P (Link to Original site) AFK230...F 126 AFK230Z 648 AFK230P 774 - - Show AFK230 Library AF (Link to library) Clone ID AFK230... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK230Q.Seq.d/ Representative seq. ID AFK230...P (Link to Original site) Representative DNA sequence >AFK230 (AFK230Q) /CSM/AF/AFK2-B/AFK230...35Q) /CSM/VF/VFI1-B/VFI135Q.Seq.d/ 1285 0.0 VFG553 (VFG553Q) /CSM/VF/VFG5-C/VFG553Q.Seq.d/ 1285 0.0 AFK230

  9. Dicty_cDB: SFK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFK230 (Link to dictyBase) - - - Contig-U11360-1 SFK230F (Link to Original site) SFK230...F 174 - - - - - - Show SFK230 Library SF (Link to library) Clone ID SFK230 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFK2-B/SFK230Q.Seq.d/ Representative seq. ID SFK230...F (Link to Original site) Representative DNA sequence >SFK230 (SFK230Q) /CSM/SF/SFK2-B/SFK230Q.Seq.d/ ATTCA... producing significant alignments: (bits) Value SFK230 (SFK230Q) /CSM/SF/SFK2-B/SFK230Q.Seq.d/ 345 1e-94 CHH

  10. 2 CFR 230.25 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Definitions. 230.25 Section 230.25 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR NON... scientific, educational, service, charitable, or similar purposes in the public interest; (2) Is not...

  11. 22 CFR 230.04 - Guarantee eligibility.

    Science.gov (United States)

    2010-04-01

    ... Financial Officer, Assistant Administrator and Deputy, Bureau for Economic Growth, Agriculture and Trade... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Guarantee eligibility. 230.04 Section 230.04 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ISRAEL LOAN GUARANTEES ISSUED UNDER THE EMERGENCY...

  12. 40 CFR 230.11 - Factual determinations.

    Science.gov (United States)

    2010-07-01

    ...-compliance with the restrictions on discharge in § 230.10. The evaluation and testing procedures described in.... Tests as described in § 230.61 (Evaluation and Testing), may be required to provide information on the... sanitary landfill located in waters of the U.S. Activities to be conducted on fast land created by the...

  13. 23 CFR 230.121 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Reports. 230.121 Section 230.121 Highways FEDERAL... Reports. (a) Employment reports on Federal-aid highway construction contracts not subject to “Hometown” or... reporting requirements. FHWA Form PR-1391, Federal-Aid Highway Construction Contractors Annual EEO Report...

  14. 24 CFR 583.230 - Environmental review.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Environmental review. 583.230... § 583.230 Environmental review. (a) Activities under this part are subject to HUD environmental regulations in part 58 of this title, except that HUD will perform an environmental review in accordance with...

  15. 36 CFR 230.35 - FLEP elements.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false FLEP elements. 230.35 Section... FORESTRY ASSISTANCE Forest Land Enhancement Program § 230.35 FLEP elements. (a) States may use FLEP funds... through the following elements: (1) Development and implementation of educational programs; (2) Resource...

  16. 24 CFR 91.230 - Monitoring.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Monitoring. 91.230 Section 91.230 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development CONSOLIDATED SUBMISSIONS FOR COMMUNITY PLANNING AND DEVELOPMENT PROGRAMS Local Governments; Contents of...

  17. 12 CFR 230.5 - Subsequent disclosures.

    Science.gov (United States)

    2010-01-01

    ... required to be disclosed under § 230.4(b) of this part if the change may reduce the annual percentage yield... accounts. (ii) Check printing fees. Changes in fees assessed for check printing. (iii) Short-term time...

  18. 12 CFR 230.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the advertising requirements in § 230.8 of this part, the term also includes an account at a....” (p) Passbook savings account means a savings account in which the consumer retains a book or other...

  19. Dicty_cDB: SHK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK230 (Link to dictyBase) - - - Contig-U16475-1 - (Link to Original site) - - SHK230...Z 667 - - - - Show SHK230 Library SH (Link to library) Clone ID SHK230 (Link to dicty...iol.tsukuba.ac.jp/CSM/SH/SHK2-B/SHK230Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SHK230 (SHK230Q) /CSM/SH/SHK2-B/SHK230Q.Seq.d/ XXXXXXXXXXTGTGTAG...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SHK230 (SHK230Q) /CSM/SH/SHK2-B/SHK230

  20. Dicty_cDB: CHK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHK230 (Link to dictyBase) - - - Contig-U11241-1 - (Link to Original site) - - CHK230...Z 374 - - - - Show CHK230 Library CH (Link to library) Clone ID CHK230 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHK2-B/CHK230Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHK230 (CHK230Q) /CSM/CH/CHK2-B/CHK230Q.Seq.d/ XXXXXXXXXXCAACAAC...234 8e-61 CHK709 (CHK709Q) /CSM/CH/CHK7-A/CHK709Q.Seq.d/ 234 8e-61 CHK230 (CHK230Q) /CSM/CH/CHK2-B/CHK230Q.S

  1. Dicty_cDB: SLK230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLK230 (Link to dictyBase) - - - Contig-U16245-1 SLK230F (Link to Original site) SLK230...F 204 - - - - - - Show SLK230 Library SL (Link to library) Clone ID SLK230 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLK2-B/SLK230Q.Seq.d/ Representative seq. ID SLK230...F (Link to Original site) Representative DNA sequence >SLK230 (SLK230Q) /CSM/SL/SLK2-B/SLK230Q.Seq.d/ GAACT...00 m3b: 0.00 m_ : 1.00 52.0 %: cytoplasmic 40.0 %: nuclear 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for SLK230

  2. Dicty_cDB: CHF230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF230 (Link to dictyBase) - - - Contig-U16290-1 CHF230P (Link to Original site) CHF...230F 659 CHF230Z 613 CHF230P 1252 - - Show CHF230 Library CH (Link to library) Clone ID CHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF2-B/CHF230Q.Seq.d/ Representative seq. ID CHF...230P (Link to Original site) Representative DNA sequence >CHF230 (CHF230Q) /CSM/CH/CHF2-B/CHF...sequence update 2002.10.25 Translated Amino Acid sequence nnhfiylyifildfififnyyynff*nqylnyyysikvticlysrkkinlmtkrknmtkl iikk*rlhkehf

  3. 17 CFR 230.252 - Offering statement.

    Science.gov (United States)

    2010-04-01

    ..., language and pagination. The requirements for offering statements are the same as those specified in § 230... Officer, a majority of the members of its board of directors or other governing body, and each selling... that contains the following language: This offering statement shall become qualified on the 20th...

  4. 14 CFR 1253.230 - Transition plans.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 1253.230 Transition plans... one administratively separate unit may submit either a single transition plan applicable to all such...

  5. 15 CFR 8a.230 - Transition plans.

    Science.gov (United States)

    2010-01-01

    ... SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 8a.230... more than one administratively separate unit may submit either a single transition plan applicable to... order to be approved by the Secretary of Education, a transition plan shall: (1) State the name, address...

  6. 31 CFR 28.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 28.230... more than one administratively separate unit may submit either a single transition plan applicable to... order to be approved by the Secretary of Education, a transition plan shall: (1) State the name, address...

  7. 40 CFR 5.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 5.230 Transition plans... one administratively separate unit may submit either a single transition plan applicable to all such...

  8. 43 CFR 41.230 - Transition plans.

    Science.gov (United States)

    2010-10-01

    ... Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 41.230 Transition plans... one administratively separate unit may submit either a single transition plan applicable to all such...

  9. 6 CFR 17.230 - Transition plans.

    Science.gov (United States)

    2010-01-01

    ... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 17.230 Transition plans... one administratively separate unit may submit either a single transition plan applicable to all such...

  10. 28 CFR 54.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 54.230 Transition plans... one administratively separate unit may submit either a single transition plan applicable to all such...

  11. 49 CFR 230.43 - Gauge siphon.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.43 Gauge siphon. The steam gauge supply pipe shall have a siphon on it of ample capacity to prevent steam from entering the gauge. The supply pipe shall directly enter the boiler and be maintained steam...

  12. 49 CFR 230.35 - Pressure testing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Pressure Testing of Boilers § 230.35 Pressure testing. The temperature of the steam locomotive boiler shall be raised to at least 70 deg. F any time hydrostatic pressure is applied to the boiler. ...

  13. 49 CFR 230.46 - Badge plates.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.46 Badge plates. A metal badge plate showing the allowed steam pressure shall be attached to the boiler backhead in the cab. If boiler backhead is lagged, the lagging and jacket shall be cut away so...

  14. 24 CFR 582.230 - Environmental review.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Environmental review. 582.230... Environmental review. (a) Activities under this part are subject to HUD environmental regulations in part 58 of this title, except that HUD will perform an environmental review in accordance with part 50 of this...

  15. 33 CFR 230.9 - Categorical exclusions.

    Science.gov (United States)

    2010-07-01

    ... Section 230.9 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF... Clean Water Act, etc., is always mandatory, even for actions not requiring an EA or EIS. (a) For a... property to the General Services Administration for disposal. (n) Boundary line agreements and disposal of...

  16. 17 CFR 230.457 - Computation of fee.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Computation of fee. 230.457 Section 230.457 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 Filings; Fees; Effective Date § 230.457 Computation of fee. (a) If a...

  17. 49 CFR 230.99 - Tender truck axles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender truck axles. 230.99 Section 230.99 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Tenders Running Gear § 230.99 Tender truck axles. The minimum diameters of axles for various axle loads...

  18. 49 CFR 230.107 - Tender frame and body.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender frame and body. 230.107 Section 230.107... Tenders Trucks, Frames and Equalizing System § 230.107 Tender frame and body. (a) Maintenance. Tender... repaired: (1) Portions of the tender frame or body (except wheels) that have less than a 21/2 inches...

  19. 7 CFR 58.230 - Heavy duty vacuum cleaners.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Heavy duty vacuum cleaners. 58.230 Section 58.230....230 Heavy duty vacuum cleaners. Each plant handling dry milk products shall be equipped with a heavy duty industrial vacuum cleaner. The vacuum cleaner shall be of a type that has a collector or...

  20. 2 CFR 230.45 - Relationship to previous issuance.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Relationship to previous issuance. 230.45 Section 230.45 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-122) § 230.45 Relationship to previous issuance. (a...

  1. 49 CFR 230.52 - Water glass valves.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Water glass valves. 230.52 Section 230.52... Water Glasses and Gauge Cocks § 230.52 Water glass valves. All water glasses shall be equipped with no more than two valves capable of isolating the water glass from the boiler. They shall also be equipped...

  2. 49 CFR 230.56 - Water glass lamps.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Water glass lamps. 230.56 Section 230.56... Water Glasses and Gauge Cocks § 230.56 Water glass lamps. All water glasses must be supplied with a suitable lamp properly located to enable the engine crew to easily see the water in the glass. Injectors...

  3. 49 CFR 230.115 - Feed water tanks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Feed water tanks. 230.115 Section 230.115... Tenders Steam Locomotive Tanks § 230.115 Feed water tanks. (a) General provisions. Tanks shall be... water. Feed water tanks shall be equipped with a device that permits the measurement of the quantity of...

  4. 40 CFR 230.74 - Actions related to technology.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Actions related to technology. 230.74 Section 230.74 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... Minimize Adverse Effects § 230.74 Actions related to technology. Discharge technology should be adapted to...

  5. 49 CFR 230.30 - Lap-joint seam boilers.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Inspection and Repair § 230.30 Lap-joint seam boilers. Every boiler having lap-joint longitudinal seams... 49 Transportation 4 2010-10-01 2010-10-01 false Lap-joint seam boilers. 230.30 Section 230.30...

  6. 49 CFR 230.36 - Hydrostatic testing of boilers.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Pressure Testing of Boilers § 230.36 Hydrostatic testing of boilers. (a) Time of test. The... 49 Transportation 4 2010-10-01 2010-10-01 false Hydrostatic testing of boilers. 230.36 Section 230...

  7. 49 CFR 230.24 - Maximum allowable stress.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Maximum allowable stress. 230.24 Section 230.24... Allowable Stress § 230.24 Maximum allowable stress. (a) Maximum allowable stress value. The maximum allowable stress value on any component of a steam locomotive boiler shall not exceed 1/4 of the ultimate...

  8. 20 CFR 637.230 - Use of incentive bonuses.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Use of incentive bonuses. 637.230 Section 637.230 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR PROGRAMS UNDER TITLE V OF THE JOB TRAINING PARTNERSHIP ACT Program Planning and Operation § 637.230 Use of incentive...

  9. 24 CFR 235.230 - Condition of multifamily structure.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Condition of multifamily structure. 235.230 Section 235.230 Housing and Urban Development Regulations Relating to Housing and Urban... Involving Condominium Units § 235.230 Condition of multifamily structure. (a) When a family unit is conveyed...

  10. 46 CFR 172.230 - Character of damage.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Character of damage. 172.230 Section 172.230 Shipping... PERTAINING TO BULK CARGOES Special Rules Pertaining to Great Lakes Dry Bulk Cargo Vessels § 172.230 Character of damage. (a) Design calculations must show that each vessel can survive damage— (1) To any location...

  11. 17 CFR 230.135a - Generic advertising.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Generic advertising. 230.135a Section 230.135a Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.135a Generic advertising. (a) For the purposes only of...

  12. 2 CFR 1.230 - Maintenance of this subtitle.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Maintenance of this subtitle. 1.230 Section 1.230 Grants and Agreements ABOUT TITLE 2 OF THE CODE OF FEDERAL REGULATIONS AND SUBTITLE A Introduction toSubtitle A § 1.230 Maintenance of this subtitle. OMB issues guidance in this subtitle after...

  13. 49 CFR 230.77 - Foundation brake gear.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Foundation brake gear. 230.77 Section 230.77... Tenders Brake and Signal Equipment § 230.77 Foundation brake gear. (a) Maintenance. Foundation brake gear...) Distance above the rails. No part of the foundation brake gear of the steam locomotive or tender shall be...

  14. Determination of 230Th in soils; Determinacion de 230Th en suelos

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez, A.; Palomares, J.

    1988-07-01

    A method for the determination of 230Th in environmental soils is described. Hydroxides formed, previous fusion with sodium peroxide are dissolved with HNO3 8N. The thorium is coprecipitated with F3La and purified by anion exchange (AG 1x8 50-100 mesh). Thorium is electroplated onto a stainless steel disc, 230xh is counted by alpha spectrometry and 234'fn u;;ed as tracer by beta counting. The chemical yield for 1g of soil sample is 60-80%. Minimum detectable activities are about 2 mBq/g.

  15. 50 CFR 230.1 - Purpose and scope.

    Science.gov (United States)

    2010-10-01

    ... Act of 1973 (16 U.S.C. 1531 et seq.) also pertain to human interactions with whales. Rules elsewhere... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Purpose and scope. 230.1 Section 230.1 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...

  16. 21 CFR 172.230 - Microcapsules for flavoring substances.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Microcapsules for flavoring substances. 172.230... HUMAN CONSUMPTION Coatings, Films and Related Substances § 172.230 Microcapsules for flavoring substances. Microcapsules may be safely used for encapsulating discrete particles of flavoring substances...

  17. 49 CFR 230.101 - Steam locomotive driving journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive driving journal boxes. 230.101... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Steam Locomotives and Tenders Running Gear § 230.101 Steam locomotive driving journal boxes. (a) Driving journal...

  18. 17 CFR 230.419 - Offerings by blank check companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 230.419 Section 230.419 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... check companies. (a) Scope of the rule and definitions. (1) The provisions of this section shall apply to every registration statement filed under the Act relating to an offering by a blank check company...

  19. 6 CFR 27.230 - Risk-based performance standards.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Risk-based performance standards. 27.230 Section 27.230 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY... the facility and that discourages abuse through established disciplinary measures; (4) Deter, Detect...

  20. 17 CFR 230.480 - Title of securities.

    Science.gov (United States)

    2010-04-01

    ...) In the case of funded debt, the rate of interest; the date of maturity, or, if the issue matures... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Title of securities. 230.480 Section 230.480 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND...

  1. 27 CFR 44.230 - Proof of loss.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Proof of loss. 44.230..., WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Drawback of Tax § 44.230 Proof of loss. When the claimant... consequence of loss of the tobacco products, and cigarette papers and tubes, his application for relief shall...

  2. 49 CFR Appendix D to Part 230 - Civil Penalty Schedule

    Science.gov (United States)

    2010-10-01

    ...,000 2,000 230.59Failure to remove and properly clean fusible boiler plugs when required to do so...) Failure to clean fusible plugs when required to do so 1,500 3,000 230.61Arch tubes, water bar tubes...

  3. 46 CFR 199.230 - Stowage of survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stowage of survival craft. 199.230 Section 199.230... Stowage of survival craft. (a) To meet the requirements of § 199.130(b)(1), each lifeboat on a passenger... height of a survival craft must take into account the vessel's escape provisions, the vessel's size, and...

  4. 21 CFR 1.230 - When must you register?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false When must you register? 1.230 Section 1.230 Food... When must you register? The owner, operator, or agent in charge of a facility that manufactures/processes, packs or holds food for consumption in the United States must register the facility no later than...

  5. 40 CFR 230.40 - Sanctuaries and refuges.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Sanctuaries and refuges. 230.40 Section 230.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... for frequent maintenance activity; (4) Result in the establishment of undesirable competitive species...

  6. 49 CFR 230.102 - Tender plain bearing journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender plain bearing journal boxes. 230.102... Locomotives and Tenders Running Gear § 230.102 Tender plain bearing journal boxes. Plain bearing journal boxes... expected to damage the bearing; or have a detrimental effect on the lubrication of the journal and bearing...

  7. 49 CFR 230.103 - Tender roller bearing journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender roller bearing journal boxes. 230.103... Locomotives and Tenders Running Gear § 230.103 Tender roller bearing journal boxes. Tender roller bearing journal boxes shall be maintained in a safe and suitable condition. ...

  8. 33 CFR 2.30 - Exclusive Economic Zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Exclusive Economic Zone. 2.30... JURISDICTION Jurisdictional Terms § 2.30 Exclusive Economic Zone. (a) With respect to the United States... States exercises sovereignty, exclusive economic zone means the zone seaward of and adjacent to the...

  9. 40 CFR 230.52 - Water-related recreation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water-related recreation. 230.52... Effects on Human Use Characteristics § 230.52 Water-related recreation. (a) Water-related recreation... or fill disposal is to impair or destroy the resources which support recreation activities. The...

  10. Thorium-230 Stratigraphy of Alpha Ridge Sediment (Arctic Ocean)

    Science.gov (United States)

    Not, C.; Hillaire-Marcel, C.; Polyak, L.; Darby, D.

    2006-12-01

    The Alpha Ridge (central Arctic Ocean) is characterized by very uniform sedimentary deposition essentially linked to vertical particulate rain. This property led us to investigate the behavior of U-series isotopes (Th-230 and Pb-210) in such a setting, i.e., one without significant sedimentary advection. Two sites cored with a 70 cm-long multicorer during the 2005 Hotrax Expedition and located about 20 nautical miles apart and at different water depths (core 11: 2644 m and core 12: 1585 m) were selected for the purpose of this study. Lead-210 profiles are practically identical in both cores, with high activities at the surface (>30 dpm/g), followed by a first minimum at 1 cm (depth. This pattern suggests significant bioturbation, at least down to 8-10 cm, and some Pb-210 diffusion below. At three distinct depths the Th-230 activities are above supported Th-230 values (approx. 1.2 dpm/g): from 0 to 8 cm (with a maximum ranging 25-30 dpm/g), 15 to 20 cm (up to 7 dpm/g) and 26 cm to core bottom (34 and 38 cm, respectively in cores 12 and 11). Here again, despite their large bathymetric difference, the two sites yielded almost identical 230Th-profiles. 230Th-activities are highly correlated with the CaCO3 content, allowing for the decay of the excess-thorium 230 (230Thxs) downcore. Assuming a linear initial relationship between CaCO3 and Th-230xs, the assignment of the lowermost part (below 37 cm) of core 11 to the oxygen isotope 5e seems probable. Maximums in organic carbon and carbonate contents at the base and top of the cores would support this interpretation. In such settings, Th-230 reveals useful data to constrain the stratigraphy of the late Pleistocene sediments, and may compensate for the absence of a viable oxygen isotope stratigraphy.

  11. 49 CFR 230.44 - Time of testing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.44 Time of testing. Steam gauges shall be tested prior to being installed or being...

  12. 49 CFR 230.42 - Location of gauges.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.42 Location of gauges. Every boiler shall have at least one steam gauge which will...

  13. 49 CFR 230.53 - Time of cleaning.

    Science.gov (United States)

    2010-10-01

    ... Water Glasses and Gauge Cocks § 230.53 Time of cleaning. The spindles of all water glass valves and of all gauge cocks shall be removed and valves and cocks thoroughly cleaned of scale and sediment at...

  14. Temperature field investigation of the industrial autoclave ASCAMAT-230

    Directory of Open Access Journals (Sweden)

    Stolyanov A. V.

    2017-09-01

    Full Text Available Heterogeneity of the temperature field in the sterilization chambers of industrial autoclaves during heating and cooling phase is one of the problems in the development of new regime for product heat treatment on the preliminary selection and laboratory testing stages. This is the reason of studying the temperature field of the industrial autoclave ASCAMAT-230. The autoclave ASCAMAT-230 is a vertical autoclave of 230 liters capacity heated by three tubular electric heaters. Determination of temperature field parameters has been carried out according to the method for studying the temperature field of periodic devices' heating medium for sterilizing canned food. Six Thermochron iButton temperature loggers have been used to measure the temperatures in the sterilization chamber of the ASCAMAT-230 autoclave. Logger 1 has been put in the place of the standard thermometer installation, loggers 2 and 3, 5 and 6 – in the center and on periphery of the lower and upper parts of the autoclave respectively, logger 4 – in the center of the middle part of the autoclave's sterilization chamber. Temperature measurement in cans with the product has been carried out by temperature loggers from the Ellab TrackSense PRO complex. The loggers have been installed in two cans with homogeneous product located in the upper and lower parts of the autoclave. The time temperature dependences for the entire sterilization process, as well as for the heating and cooling stages have been constructed according to the acquired information. Based on these data conclusions about the uniformity of the temperature field inside the sterilization chamber of the autoclave ASCAMAT-230 during the heating, sterilization and cooling stages have been developed. Some recommendations for using the autoclave ASCAMAT-230 in the preliminary selection and verification of sterilization regimes for canned foods from hydrobionts, and also for the creation of an industrial autoclave control system

  15. 17 CFR 230.156 - Investment company sales literature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Investment company sales... GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.156 Investment company sales... is materially misleading in connection with the offer or sale of securities issued by an investment...

  16. 40 CFR 170.230 - Pesticide safety training for handlers.

    Science.gov (United States)

    2010-07-01

    ... acute and chronic effects, delayed effects, and sensitization. (iii) Routes by which pesticides can... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticide safety training for handlers...) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.230 Pesticide safety...

  17. 49 CFR 230.113 - Wheels and tire defects.

    Science.gov (United States)

    2010-10-01

    .... Except as provided in § 230.114, welding on wheels and tires is prohibited. A wheel that has been welded is a welded wheel for the life of the wheel. (a) Cracks or breaks. Wheels and tires may not have a crack or break in the flange, tread, rim, plate, hub or brackets. (b) Flat spots. Wheels and tires may...

  18. 40 CFR 230.94 - Planning and documentation.

    Science.gov (United States)

    2010-07-01

    ... compensatory mitigation project will address the needs of the watershed, ecoregion, physiographic province, or... erosion control measures. For stream compensatory mitigation projects, the mitigation work plan may also... management. (See § 230.97(d).) (12) Adaptive management plan. A management strategy to address unforeseen...

  19. Schweizer Gesetze das Wesentliche der Schweizer Gesetzgebung in 230 Gesetztexten

    CERN Document Server

    Suisse

    1999-01-01

    Ce CD-Rom contient 230 textes représentant les plus importantes lois et ordonnances du Recueil systématique fédéral (RS) : Constitution fédérale, Code civil, Code des obligations, Code pénal ...

  20. 17 CFR 230.251 - Scope of exemption.

    Science.gov (United States)

    2010-04-01

    ....) immediately before the offering; (3) Is not a development stage company that either has no specific business...) Written offers under § 230.255 may be made; (C) Printed advertisements may be published or radio or... general character and location of its property. (iii) After the Form 1-A offering statement has been...

  1. 23 CFR 230.204 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... 230.204 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL... the State highway agency provides supportive services by contract, formal advertising is not required by FHWA; however, the State highway agency shall solicit proposals from such qualified sources as...

  2. 23 CFR 230.409 - Contract compliance review procedures.

    Science.gov (United States)

    2010-04-01

    ... 230.409 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL...-6). (6) Compliance Determination and Formal Notification (Actions R-8, R-9, R-10, R-11, R-12). The... list of recruitment sources available and utilized; (v) A statement of the status of any action...

  3. 40 CFR 230.93 - General compensatory mitigation requirements.

    Science.gov (United States)

    2010-07-01

    ... storm water management or habitat conservation programs. It includes the protection and maintenance of... Compensatory Mitigation for Losses of Aquatic Resources § 230.93 General compensatory mitigation requirements... on what is practicable and capable of compensating for the aquatic resource functions that will be...

  4. 33 CFR 230.13 - Environmental Impact Statement (EIS).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Environmental Impact Statement..., DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.13 Environmental Impact Statement (EIS). An EIS... issues and impacts. The transmittal letter to EPA as well as the cover sheet should clearly identify the...

  5. 17 CFR 230.502 - General conditions to be met.

    Science.gov (United States)

    2010-04-01

    ... advertising, including, but not limited to, the following: (1) Any advertisement, article, notice or other communication published in any newspaper, magazine, or similar media or broadcast over television or radio; and... advertising; Provided, however, that publication by an issuer of a notice in accordance with § 230.135c or...

  6. 41 CFR 101-4.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 4-NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 101-4.230 Transition... than one administratively separate unit may submit either a single transition plan applicable to all...

  7. 13 CFR 108.230 - Private Capital for NMVC Companies.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Private Capital for NMVC Companies... VENTURE CAPITAL (âNMVCâ) PROGRAM Qualifications for the NMVC Program Capitalizing A Nmvc Company § 108.230 Private Capital for NMVC Companies. (a) General. Private Capital means the contributed capital of a NMVC...

  8. 40 CFR 230.30 - Threatened and endangered species.

    Science.gov (United States)

    2010-07-01

    ... Impacts on Biological Characteristics of the Aquatic Ecosystem § 230.30 Threatened and endangered species. (a) An endangered species is a plant or animal in danger of extinction throughout all or a..., fish and reptiles. (b) Possible loss of values: The major potential impacts on threatened or endangered...

  9. 49 CFR 230.64 - Leaks under lagging.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Leaks § 230.64 Leaks under lagging. The steam locomotive owner and/or operator shall take out of service at once any boiler that has developed a leak under the lagging due to a crack in the shell, or to...

  10. 49 CFR 230.45 - Method of testing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.45 Method of testing. Steam gauges shall be compared with an accurate test gauge or dead weight tester. While under test load at the MAWP of the boiler to which the gauge will be applied...

  11. 49 CFR 230.60 - Time of washing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Washing Boilers § 230.60 Time of washing. (a) Frequency of washing. All boilers shall thoroughly be washed... inspection. The date of the boiler wash shall be noted on the FRA Form No. 1 or FRA Form No. 3. (See appendix...

  12. Design of RF system for CYCIAE-230 superconducting cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Zhiguo, E-mail: bitbearAT@hotmail.com; Ji, Bin; Fu, Xiaoliang; Cao, Xuelong; Zhao, Zhenlu; Zhang, Tinajue

    2017-05-11

    The CYCIAE230 is a low-current, compact superconducting cyclotron designed for proton therapy. The Radio Frequency system consists of four RF cavities and applies second harmonic to accelerate beams. The driving power for the cavity system is estimated to be approximately 150 kW. The LLRF controller is a self-made device developed and tested at low power using a small-scale cavity model. In this paper, the resonator systems of an S.C. cyclotron in history are reviewed. Contrary to those RF systems, the cavities of the CYCIAE230 cyclotron connect two opposite dees. Two high-power RF windows are included in the system. Each window carries approximately 75 kW RF power from the driver to the cavities. Thus, the RF system for the CY-CIAE230 cyclotron is operated in driven push–pull mode. The two-way amplifier-coupler-cavity systems are operated with approximately the same amount of RF power but 180° out of phase compared with each other. The design, as well as the technical advantage and limitations of this operating mode, of the CYCIAE230 cyclotron RF system is analyzed.

  13. 49 CFR Appendix A to Part 230 - Inspection Requirements

    Science.gov (United States)

    2010-10-01

    ... pipe. 3. Renewal of tubular water glasses. 4. Testing and adjusting of safety relief valves. 5. Testing... of boiler. 5. Thickness verification of dry pipes. 6. Smoke box inspection. 7. Main reservoir hammer... longitudinal lap joint boiler seams. 5 Year Inspection Requirements; § 230.16 1. Inspection of flexible...

  14. 49 CFR 230.51 - Number and location.

    Science.gov (United States)

    2010-10-01

    ... Water Glasses and Gauge Cocks § 230.51 Number and location. Every boiler shall be equipped with at least two water glasses. The lowest reading of the water glasses shall not be less than 3 inches above the highest part of the crown sheet. If gauge cocks are used, the reading of the lowest gauge cock shall not...

  15. 36 CFR 230.21 - Implementation of the program.

    Science.gov (United States)

    2010-07-01

    ... STATE AND PRIVATE FORESTRY ASSISTANCE Urban and Community Forestry Assistance Program § 230.21 Implementation of the program. (a) The Urban and Community Forestry Assistance Program is implemented through the... Service, under the authority of the Cooperative Forestry Assistance Act of 1978 and through the Urban and...

  16. 36 CFR 230.20 - Scope and authority.

    Science.gov (United States)

    2010-07-01

    ... PRIVATE FORESTRY ASSISTANCE Urban and Community Forestry Assistance Program § 230.20 Scope and authority. The Urban and Community Forestry Assistance Program is authorized by Section 9 of the Cooperative Forestry Assistance Act of 1978, as amended (16 U.S.C. 2105). The scope of this authority includes the...

  17. 49 CFR 230.54 - Testing and maintenance.

    Science.gov (United States)

    2010-10-01

    ... Water Glasses and Gauge Cocks § 230.54 Testing and maintenance. (a) Testing. All water glasses must be blown out, all gauge cocks must be tested, and all passages verified to be open at the beginning of each.... Gauge cocks, water column drain valves, and water glass valves must be maintained in such condition that...

  18. 17 CFR 230.609 - Reports of sales hereunder.

    Science.gov (United States)

    2010-04-01

    ... Investment Companies § 230.609 Reports of sales hereunder. Within 30 days after the end of each six-month... report shall be made upon completion or termination of the offering and may be made prior to the end of the six-month period in which the last sale is made. 1 Filed as part of original document. ...

  19. 48 CFR 52.230-2 - Cost Accounting Standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Accounting Standards....230-2 Cost Accounting Standards. As prescribed in 30.201-4(a), insert the following clause: Cost Accounting Standards (OCT 2010) (a) Unless the contract is exempt under 48 CFR 9903.201-1 and 9903.201-2, the...

  20. 40 CFR 230.50 - Municipal and private water supplies.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Municipal and private water supplies... Potential Effects on Human Use Characteristics § 230.50 Municipal and private water supplies. (a) Municipal and private water supplies consist of surface water or ground water which is directed to the intake of...

  1. Design of RF system for CYCIAE-230 superconducting cyclotron

    Science.gov (United States)

    Yin, Zhiguo; Ji, Bin; Fu, Xiaoliang; Cao, Xuelong; Zhao, Zhenlu; Zhang, Tinajue

    2017-05-01

    The CYCIAE230 is a low-current, compact superconducting cyclotron designed for proton therapy. The Radio Frequency system consists of four RF cavities and applies second harmonic to accelerate beams. The driving power for the cavity system is estimated to be approximately 150 kW. The LLRF controller is a self-made device developed and tested at low power using a small-scale cavity model. In this paper, the resonator systems of an S.C. cyclotron in history are reviewed. Contrary to those RF systems, the cavities of the CYCIAE230 cyclotron connect two opposite dees. Two high-power RF windows are included in the system. Each window carries approximately 75 kW RF power from the driver to the cavities. Thus, the RF system for the CY-CIAE230 cyclotron is operated in driven push-pull mode. The two-way amplifier-coupler-cavity systems are operated with approximately the same amount of RF power but 180° out of phase compared with each other. The design, as well as the technical advantage and limitations of this operating mode, of the CYCIAE230 cyclotron RF system is analyzed.

  2. 33 CFR 230.10 - Environmental Assessments (EA).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Environmental Assessments (EA..., DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.10 Environmental Assessments (EA). (a) Purpose... potential environmental effects of the proposed action and, if appropriate, its alternatives, for...

  3. 40 CFR 230.51 - Recreational and commercial fisheries.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recreational and commercial fisheries... Potential Effects on Human Use Characteristics § 230.51 Recreational and commercial fisheries. (a) Recreational and commercial fisheries consist of harvestable fish, crustaceans, shellfish, and other aquatic...

  4. Identification and decay of /sup 190/W, /sup 196/Os, /sup 230/Ra, and /sup 230/Ac. [Half-life

    Energy Technology Data Exchange (ETDEWEB)

    Katcoff, S.; Gilat, J.; Haustein, P.E.; Franz, E.M.; Morcos, N.A.; Ward, T.E.; Smith, H.A. Jr.; Hill, J.C.; Petry, R.F.

    1976-05-19

    Several new or poorly characterized neutron-rich nuclides were produced and studied at the Brookhaven Medium Energy Intense Neutron facility, MEIN. /sup 190/W decays with T/sub 1/2/ = 30.0 +- 1.5 min, E/sub beta/ = 0.93 +- 0.07 MeV, and ..gamma..'s of 157.6 and 162.1 keV. /sup 196/Os decays with T/sub 1/2/ = 35.0 +- 0.4 min and ..gamma..'s at 126.1, 200.7, 207.0, 257.0, 315.3, 407.6, 522.2, and 628.9 keV. /sup 230/Ra decays with T/sub 1/2/ = 93 +- 2 min to 122 +- 3 sec /sup 230/Ac; ..gamma..-ray energies and intensities are tabulated. A decay scheme is proposed for /sup 190/W, and many of the transitions following the decay of /sup 230/Ac are between known levels in /sup 230/Th.

  5. 42 CFR 436.230 - Essential spouses of aged, blind, or disabled individuals receiving cash assistance.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Essential spouses of aged, blind, or disabled individuals receiving cash assistance. 436.230 Section 436.230 Public Health CENTERS FOR MEDICARE & MEDICAID... Coverage of the Aged, Blind, and Disabled § 436.230 Essential spouses of aged, blind, or disabled...

  6. 40 CFR 408.230 - Applicability; description of the hand-shucked clam processing subcategory.

    Science.gov (United States)

    2010-07-01

    ...-shucked clam processing subcategory. 408.230 Section 408.230 Protection of Environment ENVIRONMENTAL... SOURCE CATEGORY Hand-Shucked Clam Processing Subcategory § 408.230 Applicability; description of the hand-shucked clam processing subcategory. The provisions of this subpart are applicable to discharges resulting...

  7. 40 CFR 158.230 - Experimental use permit data requirements for toxicology.

    Science.gov (United States)

    2010-07-01

    ... requirements for toxicology. 158.230 Section 158.230 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR PESTICIDES Experimental Use Permits § 158.230 Experimental use permit data requirements for toxicology. All toxicology data, as described in paragraph (c) of...

  8. 43 CFR 46.230 - Role of cooperating agencies in the NEPA process.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Role of cooperating agencies in the NEPA process. 46.230 Section 46.230 Public Lands: Interior Office of the Secretary of the Interior IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT OF 1969 Initiating the NEPA Process § 46.230 Role of...

  9. Construction of recombinant ZNF230/GFP fused plasmids and their expression and cellular localization

    DEFF Research Database (Denmark)

    Xu, Wen-Ming; Zhang, Si-Zhong; Qiu, Wei-Min

    2004-01-01

    cutting, the mutated human and mouse ZNF230(znf230) were inserted into mammalian expression plasmid pEGFP-N1. Thus we constructed the plasmid with fusion gene of ZNF230 and green fluorescent protein(GFP). Then the Cos cell was transfected with the fused gene by liposome. Fluorescence microscopy showed...

  10. 17 CFR 230.491 - Information to be furnished under paragraph (6) of Schedule B.

    Science.gov (United States)

    2010-04-01

    ... under paragraph (6) of Schedule B. 230.491 Section 230.491 Commodity and Securities Exchanges SECURITIES... Governments Or Political Subdivisions Thereof § 230.491 Information to be furnished under paragraph (6) of... state, in furnishing the information required by paragraph (6), the names and addresses only of...

  11. 17 CFR 230.490 - Information to be furnished under paragraph (3) of Schedule B.

    Science.gov (United States)

    2010-04-01

    ... under paragraph (3) of Schedule B. 230.490 Section 230.490 Commodity and Securities Exchanges SECURITIES... Governments Or Political Subdivisions Thereof § 230.490 Information to be furnished under paragraph (3) of... the detailed information specified in paragraph (3) as to issues of outstanding funded debt the...

  12. 33 CFR 209.230 - Use of reservoir areas for recreation.

    Science.gov (United States)

    2010-07-01

    ... recreation. 209.230 Section 209.230 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.230 Use of reservoir areas for recreation... control for recreation and other related purposes, when such use is consistent with the operation and...

  13. 48 CFR 52.230-4 - Disclosure and Consistency of Cost Accounting Practices-Foreign Concerns.

    Science.gov (United States)

    2010-10-01

    ... of Cost Accounting Practices-Foreign Concerns. 52.230-4 Section 52.230-4 Federal Acquisition... CONTRACT CLAUSES Text of Provisions and Clauses 52.230-4 Disclosure and Consistency of Cost Accounting... Consistency of Cost Accounting Practices—Foreign Concerns (JUN 2010) (a) The Contractor, in connection with...

  14. 48 CFR 52.230-3 - Disclosure and Consistency of Cost Accounting Practices.

    Science.gov (United States)

    2010-10-01

    ... of Cost Accounting Practices. 52.230-3 Section 52.230-3 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.230-3 Disclosure and Consistency of Cost Accounting Practices. As prescribed in 30.201-4(b)(1), insert the following clause: Disclosure and Consistency of Cost Accounting...

  15. 17 CFR 230.145 - Reclassification of securities, mergers, consolidations and acquisitions of assets.

    Science.gov (United States)

    2010-04-01

    ..., mergers, consolidations and acquisitions of assets. 230.145 Section 230.145 Commodity and Securities... § 230.145 Reclassification of securities, mergers, consolidations and acquisitions of assets.... A statutory merger or consolidation or similar plan or acquisition in which securities of such...

  16. 40 CFR 230.54 - Parks, national and historical monuments, national seashores, wilderness areas, research sites...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Parks, national and historical monuments, national seashores, wilderness areas, research sites, and similar preserves. 230.54 Section 230... Human Use Characteristics § 230.54 Parks, national and historical monuments, national seashores...

  17. 230.pdf | jan252009 | currsci | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; currsci; jan252009; 230.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Associates – 2017. Posted on 30 August 2017. Click here to see the list · 28th Mid Year Meeting. Posted on ...

  18. Dicty_cDB: AFL230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available im test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 247 length of database: 80,480,566 effective HSP length: 17 effect...ive length of query: 230 effective length of database: 78,821,179 effective search space: 18128871170 effect...h of database: Z,316,359,891 effective HSP length: 22 effective length of query: 225 effective length of database: Y,489,630,911 effe...ctive search space: 9335166954975 effective search space used: 9335166954975 T: 0 A...ive search space used: 18128871170 T: 0 A: 0 X1: 6 (11.9

  19. Distribution of Th-230 and Th-228 in food (I)

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Hee Dong; Kim, Wan; Lim, X. J.; Choi, M. S.; Kim, C. J.; Zheng, Y. Z. [Kyungpook National Univ., Daegu (Korea, Republic of); Kim, Do Sung [Daegu Univ., Daegu (Korea, Republic of)

    2003-03-15

    Natural radioisotopes contained in foods can enter the human body by ingestion and contribute to internal doses to the population. It is necessary to measure the concentration of natural radioisotopes especially thorium in Korean foods and estimate the internal doses. In this study, we have established the thorium measuring process based on the thorium extraction chemical process and alpha spectroscopic method. The concentration of Th-228, Th-230 and Th-232 in Korean milk, meats(pork, beef and chicken) and grain (wheat, bean and rice) are measured and internal doses are estimated.

  20. Spermatogenesis-related ring finger gene ZNF230 promoter: identification and functional analysis

    DEFF Research Database (Denmark)

    Xu, Wenming; Zhang, Sizhong; Qiu, Weimin

    2009-01-01

    The ZNF230 gene is a recently cloned gene which is transcribed only in fertile male testes and may be related to human spermatogenesis. To characterize the multiple stage-specific transcription elements necessary for ZNF230 expression, we cloned ZNF230 promoter and constructed chimeric luciferase...... reporter Plasmids. Overexpression and site-directed mutation test were used to characterize the cis-element. The results showed ZNF230 gene promoter to be GC rich and not contain a TATA box. Deletion analysis of the 5'-flanking region of ZNF230 in HEK293 cells indicated that the sequence encompassing from...... nt -131 to +152 has a basal transcriptional activity. Site-directed mutation test and mithramycin A treatment demonstrated that the ZNF230 promoter contained a functional Sp1 site. Overexpression of the Sox5 protein activated the promoter activity. A 312-bp fragment surrounding the transcription...

  1. Cross-sections of the reaction 232Th(p,3n)230Pa for production of 230U for targeted alpha therapy.

    Science.gov (United States)

    Morgenstern, Alfred; Apostolidis, Christos; Bruchertseifer, Frank; Capote, Roberto; Gouder, Thomas; Simonelli, Federica; Sin, Mihaela; Abbas, Kamel

    2008-10-01

    (230)U/(226)Th is a promising novel alpha-emitter system for application in targeted alpha therapy of cancer. The therapeutic nuclides can be produced by proton irradiation of natural (232)Th according to the reaction (232)Th(p,3n)(230)Pa, followed by subsequent beta decay of (230)Pa to (230)U. In this study, the experimental excitation function for the (232)Th(p,3n)(230)Pa reaction up to 34 MeV proton energy has been measured using the stacked-foil technique. The proton energies in the various foils were calculated with the SRIM 2003 code and gamma-ray spectrometry was used to measure the activities of the various radioisotopes produced. The measured cross-sections are in good agreement with selected literature values and with model calculations using the EMPIRE II code. The reaction (232)Th(p,3n)(230)Pa allows the production of carrier-free (230)U in clinically relevant levels.

  2. Calculation of 230Th U isochrons, ages, and errors

    Science.gov (United States)

    Ludwig, K. R.; Titterington, D.M.

    1994-01-01

    If analytical errors are responsible for the scatter of points on a 230Th-234U-238U isochron diagram, the isochron should be fitted by a technique that 1. (1) weights the points according to their analytical errors and error correlations, and 2. (2) either takes into account the presence of some of the same data in two coupled XY isochrons or (equivalently) uses a single, three-dimensional XYZ isochron. A method based on maximum-likelihood estimation is presented that fulfills these requirements, and the relevant equations for errors in age and initial 234U 238U are given. Equations for estimating the necessary isotope-ratio errors and error-correlations for both alpha-spectrometric and mass-spectrometric data are also developed. ?? 1994.

  3. 49 CFR 230.98 - Driving, trailing, and engine truck axles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Driving, trailing, and engine truck axles. 230.98... Locomotives and Tenders Running Gear § 230.98 Driving, trailing, and engine truck axles. (a) Condemning defects. Driving, trailing, and engine truck axles with any of the following defects shall be removed from...

  4. 27 CFR 24.230 - Examination of tank car or tank truck.

    Science.gov (United States)

    2010-04-01

    ... tank truck. 24.230 Section 24.230 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... truck. Upon arrival of a tank car or tank truck at the bonded wine premises, the proprietor shall carefully examine the car or truck to see whether the seals are intact and whether there is any evidence of...

  5. 2 CFR Appendix B to Part 230 - Selected Items of Cost

    Science.gov (United States)

    2010-01-01

    ... fraud or similar misconduct, a determination of organizational liability. (c) In the case of any civil... PRINCIPLES FOR NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-122) Pt. 230, App. B Appendix B to Part 230—Selected... and prosecution of criminal and civil proceedings, claims, appeals and patent infringement 11...

  6. 40 CFR 52.230 - Control strategy and regulations: Nitrogen dioxide.

    Science.gov (United States)

    2010-07-01

    ...: Nitrogen dioxide. 52.230 Section 52.230 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Control strategy and regulations: Nitrogen dioxide. (a) The requirements of § 52.14(c)(3) of this chapter... attainment and maintenance of NAAQS for nitrogen dioxide in the Metropolitan Los Angeles Intrastate AQCR: (1...

  7. 49 CFR 230.108 - Steam locomotive leading and trailing trucks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive leading and trailing trucks. 230... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Steam Locomotives and Tenders Trucks, Frames and Equalizing System § 230.108 Steam locomotive leading...

  8. 49 CFR 230.65 - Steam blocking view of engine crew.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam blocking view of engine crew. 230.65 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Leaks § 230.65 Steam blocking view of engine crew. The steam locomotive owner and/or...

  9. 49 CFR 230.37 - Steam test following repairs or alterations.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam test following repairs or alterations. 230... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Pressure Testing of Boilers § 230.37 Steam test following repairs or alterations...

  10. 25 CFR 171.230 - What are my responsibilities for wastewater?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are my responsibilities for wastewater? 171.230... OPERATION AND MAINTENANCE Irrigation Service § 171.230 What are my responsibilities for wastewater? (a) You are responsible for your wastewater. (b) Wastewater may be returned to our facilities, but only at...

  11. 49 CFR 230.100 - Defects in tender truck axles and journals.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defects in tender truck axles and journals. 230... Steam Locomotives and Tenders Running Gear § 230.100 Defects in tender truck axles and journals. (a... wheel seats that is more than 1/8 of an inch in depth. (b) Tender truck journal condemning defects...

  12. 49 CFR 230.63 - Smoke box, steam pipes and pressure parts.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Pipes § 230.63 Smoke box, steam pipes and pressure parts. The smoke box, steam pipes and... 49 Transportation 4 2010-10-01 2010-10-01 false Smoke box, steam pipes and pressure parts. 230.63...

  13. 41 CFR 102-36.230 - Where do we send the reports of excess personal property?

    Science.gov (United States)

    2010-07-01

    .... For the categories of property listed in § 102-36.125(b), forward the SF 120 to the corresponding... reports of excess personal property? 102-36.230 Section 102-36.230 Public Contracts and Property... PROPERTY 36-DISPOSITION OF EXCESS PERSONAL PROPERTY Disposition of Excess Personal Property Reporting...

  14. 40 CFR 230.31 - Fish, crustaceans, mollusks, and other aquatic organisms in the food web.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Fish, crustaceans, mollusks, and other aquatic organisms in the food web. 230.31 Section 230.31 Protection of Environment ENVIRONMENTAL..., crustaceans, mollusks and other food web organisms through the release of contaminants which adversely affect...

  15. 5 CFR 230.401 - Agency authority to take personnel actions in a national emergency disaster.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agency authority to take personnel actions in a national emergency disaster. 230.401 Section 230.401 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ORGANIZATION OF THE GOVERNMENT FOR PERSONNEL MANAGEMENT Agency Authority To Take Personnel Actions in a...

  16. 46 CFR 169.230 - Underwater Survey in Lieu of Drydocking (UWILD).

    Science.gov (United States)

    2010-10-01

    ... method used to accurately determine the diver's or remotely operated vehicle's (ROV) location relative to... 46 Shipping 7 2010-10-01 2010-10-01 false Underwater Survey in Lieu of Drydocking (UWILD). 169.230... SCHOOL VESSELS Inspection and Certification Drydocking Or Hauling Out § 169.230 Underwater Survey in Lieu...

  17. 17 CFR 230.154 - Delivery of prospectuses to investors at the same address.

    Science.gov (United States)

    2010-04-01

    ... investors at the same address. 230.154 Section 230.154 Commodity and Securities Exchanges SECURITIES AND... prospectuses to investors at the same address. (a) Delivery of a single prospectus. If you must deliver a... all of the following conditions are met: (1) The investor has the same last name as the other...

  18. 75 FR 56051 - Bemidji to Grand Rapids Minnesota 230 kV Transmission Line Project

    Science.gov (United States)

    2010-09-15

    ...; ] DEPARTMENT OF AGRICULTURE Rural Utilities Service Bemidji to Grand Rapids Minnesota 230 kV Transmission Line... Rapids, Minnesota 230 kV Transmission Line Project (``Project'') in Minnesota. The Final EIS was prepared...) transmission line between the Wilton Substation near Bemidji, Minnesota and the Boswell Substation near Grand...

  19. 27 CFR 26.230 - Containers of distilled spirits to bear closures.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Containers of distilled spirits to bear closures. 26.230 Section 26.230 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO... distilled spirits to bear closures. Containers of 1 gallon (3.785 liters) or less of distilled spirits, upon...

  20. (232)Th(d,4n)(230)Pa cross-section measurements at ARRONAX facility for the production of (230)U.

    Science.gov (United States)

    Duchemin, C; Guertin, A; Haddad, F; Michel, N; Métivier, V

    2014-05-01

    (226)Th (T1/2=31 min) is a promising therapeutic radionuclide since results, published in 2009, showed that it induces leukemia cells death and activates apoptosis pathways with higher efficiencies than (213)Bi. (226)Th can be obtained via the (230)U α decay. This study focuses on the (230)U production using the (232)Th(d,4n)(230)Pa(β-)(230)U reaction. Experimental cross sections for deuteron-induced reactions on (232)Th were measured from 30 down to 19 MeV using the stacked-foil technique with beams provided by the ARRONAX cyclotron. After irradiation, all foils (targets as well as monitors) were measured using a high-purity germanium detector. Our new (230)Pa cross-section values, as well as those of (232)Pa and (233)Pa contaminants created during the irradiation, were compared with previous measurements and with results given by the TALYS code. Experimentally, same trends were observed with slight differences in orders of magnitude mainly due to the nuclear data change. Improvements are ongoing about the TALYS code to better reproduce the data for deuteron-induced reactions on (232)Th. Using our cross-section data points from the (232)Th(d,4n)(230)Pa reaction, we have calculated the thick-target yield of (230)U, in Bq/μA·h. This value allows now to a full comparison between the different production routes, showing that the proton routes must be preferred. Copyright © 2014 Elsevier Inc. All rights reserved.

  1. 29 CFR 553.230 - Maximum hours standards for work periods of 7 to 28 days-section 7(k).

    Science.gov (United States)

    2010-07-01

    ...-section 7(k). 553.230 Section 553.230 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR... Compensation Rules § 553.230 Maximum hours standards for work periods of 7 to 28 days—section 7(k). (a) For... 28 consecutive days, no overtime compensation is required under section 7(k) until the number of...

  2. 17 CFR 230.506 - Exemption for limited offers and sales without regard to dollar amount of offering.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Exemption for limited offers and sales without regard to dollar amount of offering. 230.506 Section 230.506 Commodity and... Securities Act of 1933 § 230.506 Exemption for limited offers and sales without regard to dollar amount of...

  3. 17 CFR 230.157 - Small entities under the Securities Act for purposes of the Regulatory Flexibility Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Small entities under the Securities Act for purposes of the Regulatory Flexibility Act. 230.157 Section 230.157 Commodity and... General § 230.157 Small entities under the Securities Act for purposes of the Regulatory Flexibility Act...

  4. 75 FR 75170 - Minnkota Power Cooperative, Inc.: Bemidji to Grand Rapids 230 kV Transmission Line Project

    Science.gov (United States)

    2010-12-02

    ... to Grand Rapids 230 kV Transmission Line Project (Project) in Beltrami, Hubbard, Itasca, and Cass... construct the 230 kilovolt (kV) transmission line between the Wilton Substation near Bemidji, Minnesota and... . ] SUPPLEMENTARY INFORMATION: Minnkota's proposed Project is to construct a 230 kilovolt (kV) transmission line...

  5. 75 FR 63141 - Apalachicola National Forest; Florida; City of Tallahassee 230kV Southwestern Transmission Line

    Science.gov (United States)

    2010-10-14

    ... 230kV electric transmission line. The addition of an east-west 230kV transmission line would connect the Hopkins--Crawfordville 230kV transmission line south of the Tallahassee Regional Airport (near the... S.W./Woodville Highway intersection). The proposed transmission line would be approximately 8 miles...

  6. Mechanisms of TL for production of the 230 {sup o}C peak in natural sodalite

    Energy Technology Data Exchange (ETDEWEB)

    Cano, Nilo F., E-mail: nilocano@dfn.if.usp.b [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Blak, Ana R. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Ayala-Arenas, Jorge S. [Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil)

    2011-02-15

    The thermoluminescence (TL) peak in natural sodalite near 230 {sup o}C, which appears only after submitted to thermal treatments and to gamma irradiation, has been studied in parallel with electron paramagnetic resonance (EPR) spectrum appearing under the same procedure. This study revealed a full correlation between the 230 {sup o}C TL peak and the eleven hyperfine lines from EPR spectrum. In both case, the centers disappear at the same temperature and are restored after gamma irradiation. A complete model for the 230 {sup o}C TL peak is presented and discussed. In addition to the correlation and TL model, specific characteristics of the TL peaks are described.

  7. supplementary material taford, s. afr. j. chem., 2013, 66, 221–230 ...

    African Journals Online (AJOL)

    NICO

    230. TABLE S1. A SELECTION OF BIMOLECULAR COMPLEXES FORMED BETWEEN. BORON TRIFLUORIDE AND OTHER SMALL MOLECULES IN THE GAS PHASE. Base. Technique. References. Base. Technique. References. Ne infrared.

  8. Screening for TMEM230 mutations in young-onset Parkinson's disease.

    Science.gov (United States)

    Ma, Dongrui; Foo, Jia Nee; Yulin Ng, Ebonne; Zhao, Yi; Liu, Jian-Jun; Tan, Eng King

    2017-10-01

    TMEM230 gene mutations have been reported to be linked with Parkinson's disease (PD) recently. To investigate the prevalence of this gene in southeastern Chinese patients with PD, whole exome sequencing was performed in young-onset and familial PD patients and healthy controls in our Asian population. One heterozygous missense p.Phe121Ser mutation was detected in a healthy 76-year-old control subject and no other TMEM230 mutations were found in PD patients and controls. These data suggest that TMEM230 mutation might be a rare cause of Chinese familial and sporadic PD patients and a larger sample size will be needed to evaluate the association of TMEM230 polymorphic variants with PD. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Improving the synthesis of phenolic polymer using Coprinus cinereus peroxidase mutant Phe230Ala.

    Science.gov (United States)

    Kim, Su Jin; Joo, Jeong Chan; Song, Bong Keun; Yoo, Young Je; Kim, Yong Hwan

    2016-06-01

    The F230A mutant of Coprinus cinereus peroxidase (CiP), which has a high stability against radical-inactivation, was previously reported. In the present study, the radical-robust F230A mutant was applied to the oxidative polymerization of phenol. The F230A mutant exhibited better polymerization activities than the wild-type CiP in the presence of water-miscible alcohols i.e., methanol, ethanol, and isopropanol despite its lower stability against alcohols. In particular, the F230A mutant showed a higher consumption of phenol (40%) and yielded phenolic polymer of larger molecular weight (8850Da) in a 50% (v/v) isopropanol-buffer mixture compared with the wild-type CiP (2% and 1519Da, respectively). In addition, the wild-type CiP and F230A mutant had no significant differences in enzyme inactivation by physical adsorption on the polymeric products or by heat incubation, and showed comparable kinetic parameters. These results indicate that high radical stability of the F230A mutant and improved solubility of phenolic polymers in alcohol-water cosolvent systems may synergistically contribute to the production of the high molecular weight phenolic polymer. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Status of Testing and Characterization of CMS Alloy 617 and Alloy 230

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Weiju [ORNL; Santella, Michael L [ORNL; Battiste, Rick [ORNL; Terry, Totemeier [Idaho National Laboratory (INL); Denis, Clark [Idaho National Laboratory (INL)

    2006-08-01

    Status and progress in testing and characterizing CMS Alloy 617 and Alloy 230 tasks in FY06 at ORNL and INL are described. ORNL research has focused on CMS Alloy 617 development and creep and tensile properties of both alloys. In addition to refurbishing facilities to conduct tests, a significant amount of creep and tensile data on Alloy 230, worth several years of research funds and time, has been located and collected from private enterprise. INL research has focused on the creep-fatigue behavior of standard chemistry Alloy 617 base metal and fusion weldments. Creep-fatigue tests have been performed in air, vacuum, and purified Ar environments at 800 and 1000 C. Initial characterization and high-temperature joining work has also been performed on Alloy 230 and CCA Alloy 617 in preparation for creep-fatigue testing.

  11. 76 FR 60733 - Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton...

    Science.gov (United States)

    2011-09-30

    .... Basis and Purpose The Captain of the Port New Orleans has implemented a safety zone from mile marker 230... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton Rouge, LA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule...

  12. 40 CFR 745.230 - Work practice standards for conducting lead-based paint activities: public and commercial...

    Science.gov (United States)

    2010-07-01

    ... lead-based paint activities: public and commercial buildings, bridges and superstructures. 745.230... CONTROL ACT LEAD-BASED PAINT POISONING PREVENTION IN CERTAIN RESIDENTIAL STRUCTURES Lead-Based Paint Activities § 745.230 Work practice standards for conducting lead-based paint activities: public and...

  13. 23 CFR 230.111 - Implementation of special requirements for the provision of on-the-job training.

    Science.gov (United States)

    2010-04-01

    ... of on-the-job training. 230.111 Section 230.111 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT... requirements for the provision of on-the-job training. (a) The State highway agency shall determine which... agency may modify the special provisions to specify the numbers to be trained in specific job...

  14. 20 CFR 661.230 - What are the requirements for modification of the State Workforce Investment Plan?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What are the requirements for modification of the State Workforce Investment Plan? 661.230 Section 661.230 Employees' Benefits EMPLOYMENT AND..., performance indicators, the methodology used to determine local allocation of funds, reorganizations which...

  15. 17 CFR 230.158 - Definitions of certain terms in the last paragraph of section 11(a).

    Science.gov (United States)

    2010-04-01

    ... in the last paragraph of section 11(a). 230.158 Section 230.158 Commodity and Securities Exchanges... Definitions of certain terms in the last paragraph of section 11(a). (a) An “earning statement” made generally available to securityholders of the registrant pursuant to the last paragraph of section 11(a) of the Act...

  16. 77 FR 514 - Notice of Availability of the Record of Decision for the North Steens 230 Kilovolt Transmission...

    Science.gov (United States)

    2012-01-05

    ..., maintenance and termination of a 230-kV transmission line, tensioning sites and related access across lands... Kilovolt Transmission Line, Harney County, OR AGENCY: Bureau of Land Management, Interior. ACTION: Notice... Record of Decision (ROD) for the North Steens 230 kilovolt (kV) Transmission Line Project. The Secretary...

  17. 17 CFR 230.140 - Definition of “distribution” in section 2(11) for certain transactions.

    Science.gov (United States)

    2010-04-01

    ... in section 2(11) for certain transactions. 230.140 Section 230.140 Commodity and Securities Exchanges... Definition of “distribution” in section 2(11) for certain transactions. A person, the chief part of whose..., to furnish the proceeds with which to acquire the securities of such issuer or affiliated issuers, is...

  18. 24 CFR 572.230 - Cash and Management Information (C/MI) System.

    Science.gov (United States)

    2010-04-01

    ... HOMES PROGRAM (HOPE 3) Grants § 572.230 Cash and Management Information (C/MI) System. Disbursement of HOPE 3 grant funds is managed through HUD's Cash and Management Information (C/MI) System for the HOPE... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Cash and Management Information (C...

  19. 40 CFR 230.61 - Chemical, biological, and physical evaluation and testing.

    Science.gov (United States)

    2010-07-01

    ... FILL MATERIAL Evaluation and Testing § 230.61 Chemical, biological, and physical evaluation and testing...-biological interactive effects. Dredged or fill material may be excluded from the evaluation procedures... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Chemical, biological, and physical...

  20. 49 CFR 230.61 - Arch tubes, water bar tubes, circulators and thermic siphons.

    Science.gov (United States)

    2010-10-01

    ... (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Washing Boilers § 230.61 Arch tubes, water bar tubes, circulators and thermic siphons. (a) Frequency of cleaning. Each time the boiler is washed, arch tubes and...

  1. Toxicology and biodistribution study of CIGB-230, a DNA vaccine against hepatitis C virus.

    Science.gov (United States)

    Bacardí, Dania; Amador-Cañizares, Yalena; Cosme, Karelia; Urquiza, Dioslaida; Suárez, José; Marante, Jeny; Viña, Ariel; Vázquez, Ariel; Concepción, Joel; Pupo, Maylín; Aldana, Lizet; Soria, Yordanka; Romero, Juan; Madrigal, Roberto; Martínez, Leticia; Hernández, Lourdes; González, Idania; Dueñas-Carrera, Santiago

    2009-08-01

    CIGB-230, a mixture of a DNA plasmid expressing hepatitis C virus (HCV) structural antigens and a HCV recombinant capsid protein, has demonstrated to elicit strong immune responses in animals. The present study evaluated the plasmid biodistribution after the administration of CIGB-230 in mice, as well as toxicity of this vaccine candidate in rats. In the biodistribution study, mice received single or repeated intramuscular injections of CIGB-230, 50 microg of plasmid DNA mixed with 5 microg of Co.120 protein. Plasmid presence was assessed in ovaries, kidney, liver, pancreas, mesenteric ganglion, blood, and muscle of the injection site by a qualitative polymerase chain reaction. The toxicology evaluation included treatment groups receiving doses 5, 15, or 50 times higher, according to the body weight, than the expected therapeutic clinical dose. During the first hour after repeated inoculation, a promiscuous distribution was observed. However, 3 months later, plasmid could not be detected in any tissue. There was an absence of detectable adverse effects on key toxicology parameters and no damage evidenced in inspected organs and tissues. These results indicate that CIGB-230 is nontoxic at local and systemic levels and no concerns about persistence are observed, which support clinical testing of this vaccine candidate against HCV.

  2. Antimicrobial susceptibility testing of 230 Helicobacter pylori strains: importance of medium, inoculum, and incubation time

    DEFF Research Database (Denmark)

    Hartzen, S H; Andersen, L P; Bremmelgaard, A

    1997-01-01

    No standardized method of susceptibility testing for Helicobacter pylori is currently available, so before a large agar dilution study comprising 230 H. pylori strains belonging to more than 80 genetically different groups was initiated, we performed a relatively small preliminary study to determ...

  3. 16 CFR 1500.230 - Guidance for lead (Pb) in consumer products.

    Science.gov (United States)

    2010-01-01

    ... addition to an agreement to discontinue the use of lead in future production. The Commission believes that... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Guidance for lead (Pb) in consumer products... § 1500.230 Guidance for lead (Pb) in consumer products. (a) Summary. (1) The U.S. Consumer Product Safety...

  4. 49 CFR 173.230 - Fuel cell cartridges containing hazardous material.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Fuel cell cartridges containing hazardous material... Than Class 1 and Class 7 § 173.230 Fuel cell cartridges containing hazardous material. (a) Requirements for Fuel Cell Cartridges. Fuel cell cartridges, including when contained in or packed with equipment...

  5. 7 CFR 1220.230 - Promotion, research, consumer information, and industry information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Promotion, research, consumer information, and...), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Expenses and Assessments § 1220.230 Promotion, research, consumer information, and industry...

  6. 17 CFR 230.170 - Prohibition of use of certain financial statements.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.170 Prohibition of use of... underwriters are or will be committed to take and pay for all of the securities, if any are taken, prior to or... statement is based. The caption shall be in type at least as large as that used generally in the body of the...

  7. 17 CFR 230.482 - Advertising by an investment company as satisfying requirements of section 10.

    Science.gov (United States)

    2010-04-01

    ... measure of company performance (not subject to any prescribed method of computation) if such measurement... Investment Companies; Business Development Companies § 230.482 Advertising by an investment company as... Investment Company Act of 1940 (15 U.S.C. 80a-1 et seq.) (1940 Act), or a business development company, that...

  8. 43 CFR 2.30 - How do I file an appeal?

    Science.gov (United States)

    2010-10-01

    ... INFORMATION ACT FOIA Appeals § 2.30 How do I file an appeal? (a) You must submit your appeal in writing, i.e... discretion, that good cause exists to accept the defective appeal. The time limits for responding to your... detail as possible any reason(s) why you believe the bureau's response was in error. (d) Include your...

  9. 48 CFR 52.230-6 - Administration of Cost Accounting Standards.

    Science.gov (United States)

    2010-10-01

    ... Clauses 52.230-6 Administration of Cost Accounting Standards. As prescribed in 30.201-4(d)(1), insert the following clause: Administration of Cost Accounting Standards (JUN 2010) For the purpose of administering the Cost Accounting Standards (CAS) requirements under this contract, the Contractor shall take the...

  10. 48 CFR 52.230-7 - Proposal Disclosure-Cost Accounting Practice Changes.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 52.230-7 Proposal Disclosure—Cost Accounting Practice Changes. As prescribed in 30.201-3(c), insert the following provision: Proposal Disclosure—Cost Accounting Practice Changes (APR 2005... change in cost accounting practice, including unilateral changes requested to be desirable changes. YesNo...

  11. 48 CFR 52.230-5 - Cost Accounting Standards-Educational Institution.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Accounting Standards... Clauses 52.230-5 Cost Accounting Standards—Educational Institution. As prescribed in 30.201-4(e), insert the following clause: Cost Accounting Standards—Educational Institution (OCT 2010) (a) Unless the...

  12. 48 CFR 52.230-1 - Cost Accounting Standards Notices and Certification.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Accounting Standards... Provisions and Clauses 52.230-1 Cost Accounting Standards Notices and Certification. As prescribed in 30.201-3, insert the following provisions: Cost Accounting Standards Notices and Certification (OCT 2008...

  13. 28 CFR 2.30 - False information or new criminal conduct: Discovery after release.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false False information or new criminal conduct..., SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.30 False information or new criminal conduct: Discovery after release. If...

  14. 231Pa and 230Th in the ocean model of the Community Earth System Model (CESM1.3)

    Science.gov (United States)

    Gu, Sifan; Liu, Zhengyu

    2017-12-01

    The sediment 231Pa / 230Th activity ratio is emerging as an important proxy for deep ocean circulation in the past. In order to allow for a direct model-data comparison and to improve our understanding of the sediment 231Pa / 230Th activity ratio, we implement 231Pa and 230Th in the ocean component of the Community Earth System Model (CESM). In addition to the fully coupled implementation of the scavenging behavior of 231Pa and 230Th with the active marine ecosystem module (particle-coupled: hereafter p-coupled), another form of 231Pa and 230Th have also been implemented with prescribed particle flux fields of the present climate (particle-fixed: hereafter p-fixed). The comparison of the two forms of 231Pa and 230Th helps to isolate the influence of the particle fluxes from that of ocean circulation. Under present-day climate forcing, our model is able to simulate water column 231Pa and 230Th activity and the sediment 231Pa / 230Th activity ratio in good agreement with available observations. In addition, in response to freshwater forcing, the p-coupled and p-fixed sediment 231Pa / 230Th activity ratios behave similarly over large areas of low productivity on long timescales, but can differ substantially in some regions of high productivity and on short timescales, indicating the importance of biological productivity in addition to ocean transport. Therefore, our model provides a potentially powerful tool to help the interpretation of sediment 231Pa / 230Th reconstructions and to improve our understanding of past ocean circulation and climate changes.

  15. 230Thand 231Pa in Seawater Sinking Particles from the North Atlantic GEOTRACES Transect

    Science.gov (United States)

    LU, Y.; Edwards, R. L.; Cheng, H.; Anderson, R. F.; Hayes, C. T.; Fleisher, M. Q.; Lam, P. J.; Huang, K. F.; Robinson, L. F.; Wang, X.

    2016-12-01

    The biological carbon pump in the ocean plays a key role in regulating atmospheric CO2 level via oceanic particle dynamics. Radionuclides with proper half-lives, like 230Th and 231Pa, can provide quantitative estimates of particle cycling on the timescales up to hundred thousand years. However, our understanding of particle dynamics is hindered by the difficulty in precisely determining particulate 230Th and 231Pa, due to the trace amounts of Th and Pa in seawater, especially in large sinking particles. Here, we developed a technique to measure sinking particulate 230Th and 231Pa in a small sample size (tens to hundreds attograms of 231Pa, equivalent to 100 L water pumped through QMA filter), and achieved an average precision in percentage level. We firstly applied leaching processes to the particulate samples. The samples were soaked in 8N HNO3 + 0.5N HF mixed with proportionally determined 229Th and 233Pa spikes, and heated at 100°C for 10 hours. Th and Pa were then pre-concentrated by co-precipitation with Fe. After HNO3-HClO4-HNO3 digestion of the precipitates, Th and Pa were separated and purified using anion exchange chromatography (Spectra/Gel anion resin 1x8). Pa was measured on a MC-ICP-MS instrument (Neptune) right after the chemistry in order to minimize the 233Pa "bleeding effect". Replication tests show a good agreement in 231Pa/230Th within the measurement uncertainties. Applying our method to the profile samples collected from the North Atlantic GEOTRACES Transect, we found that the concentrations of 230Th and 231Pa in sinking particles (>51 μm size fraction; attograms/liter) are about 1/10 of those in suspended ones (1 - 51 μm size fraction). The scavenging of Th and Pa to large particles appears to be a function of particle composition (CaCO3, POM, lithogenic, opal and Fe/Mn oxides). In addition, ratios of the adsorbed 231Pa to 230Th are the same in both types of particles, although the particles have significantly different residence time in

  16. The AIRE -230Y Polymorphism Affects AIRE Transcriptional Activity: Potential Influence on AIRE Function in the Thymus.

    Science.gov (United States)

    Lovewell, Thomas R J; McDonagh, Andrew J; Messenger, Andrew G; Azzouz, Mimoun; Tazi-Ahnini, Rachid

    2015-01-01

    The autoimmune regulator (AIRE) is expressed in the thymus, particularly in thymic medullary epithelial cells (mTECs), and is required for the ectopic expression of a diverse range of peripheral tissue antigens by mTECs, facilitating their ability to perform negative selection of auto-reactive immature T-cells. The expression profile of peripheral tissue antigens is affected not only by AIRE deficiency but also with variation of AIRE activity in the thymus. Therefore we screened 591bp upstream of the AIRE transcription start site including AIRE minimal promoter for single nucleotide polymorphism (SNPs) and identified two SNPs -655R (rs117557896) and -230Y (rs751032) respectively. To study the effect of these variations on AIRE promoter activity we generated a Flp-In host cell line which was stably transfected with a single copy of the reporter vector. Relative promoter activity was estimated by comparing the luciferase specific activity for lysates of the different reporter AIRE promoter-reporter gene constructs including AIRE-655G AIRE-230C, AIRE-655G AIRE-230T and AIRE-655A AIRE-230C. The analysis showed that the commonest haplotype AIRE-655G AIRE-230C has the highest luciferase specific activity (pAIRE-655G AIRE-230T has a luciferase specific activity value that approaches null. Both AIRE promoter polymorphic sites have one allele that forms a CpG methylation site which we determined can be methylated in methylation assays using the M.SssI CpG methyltransferase. AIRE-230Y is in a conserved region of the promoter and is adjacent to a predicted WT1 transcription factor binding site, suggesting that AIRE-230Y affects AIRE expression by influencing the binding of biochemical factors to this region. Our findings show that AIRE-655GAIRE-230T haplotype could dramatically alter AIRE transcription and so have an effect on the process of negative selection and affect susceptibility to autoimmune conditions.

  17. Measurement of 230Pa and 186Re Production Cross Sections Induced by Deuterons at Arronax Facility

    Science.gov (United States)

    Duchemin, Charlotte; Guertin, Arnaud; Metivier, Vincent; Haddad, Ferid; Michel, Nathalie

    2014-02-01

    A dedicated program has been launched on production of innovative radionuclides for PET imaging and for β- and α targeted radiotherapy using proton or α particles at the ARRONAX cyclotron. Since the accelerator is also able to deliver deuteron beams up to 35 MeV, we have reconsidered the possibility of using them to produce medical isotopes. Two isotopes dedicated to targeted therapy have been considered: 226Th, a decay product of 230Pa, and 186Re. The production cross sections of 230Pa and 186Re, as well as those of the contaminants created during the irradiation, have been determined by the stacked-foil technique using deuteron beams. Experimental values have been quantified using a referenced cross section. The measured cross sections have been used to determine expected production yields and compared with the calculated values obtained using the Talys code with default parameters.

  18. Advanced power plant training simulator for VVER-440/V230 nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Shier, W.; Kennett, R. [Brookhaven National Lab., Upton, NY (United States); Vaclav, E.; Gieci, A. [Nuclear Power Research Inst. Trnava, Inc. (Slovakia)

    1996-11-01

    An advanced, workstation based, nuclear power plant simulator has been developed for use in training the operational staff of the Bohunice Nuclear Power Plant. This training simulator uses state-of- the-art computer hardware and software and provides the capability to simultaneously include six members of the power plant operating staff in the training sessions. A detailed reactor model has been developed, representing the Bohunice VVER-44O/V230 plants, for use with the RELAP5 simulation software. In addition, a comprehensive validation program has been completed that compares the simulation results of the advanced simulator with the results from a current VVER-44O/V230 simulator. A summary of the training features and capabilities of the simulator is also provided.

  19. Automatic Color Sorting Machine Using TCS230 Color Sensor And PIC Microcontroller

    Directory of Open Access Journals (Sweden)

    Kunhimohammed C K

    2015-12-01

    Full Text Available Sorting of products is a very difficult industrial process. Continuous manual sorting creates consistency issues. This paper describes a working prototype designed for automatic sorting of objects based on the color. TCS230 sensor was used to detect the color of the product and the PIC16F628A microcontroller was used to control the overall process. The identification of the color is based on the frequency analysis of the output of TCS230 sensor. Two conveyor belts were used, each controlled by separate DC motors. The first belt is for placing the product to be analyzed by the color sensor, and the second belt is for moving the container, having separated compartments, in order to separate the products. The experimental results promise that the prototype will fulfill the needs for higher production and precise quality in the field of automation.

  20. Descriptive study of the even-even actinide nuclei 230 - 234Th isotopes using IBM-1

    Science.gov (United States)

    Al-Dahan, N.

    2017-06-01

    The nuclear structure of the actinide even-even thorium isotopes from A=230-234 have been investigated within the framework of the Interacting Boson Model (IBM-1). Predictions are given for the excited state energies for the ground state, β and γ-bands, the transition probabilities between these states, the rotational moment of inertia, and the energy staggering in the γ-band energies. The results of these calculations are compared with the experimental data on these isotopes.

  1. {sup 10}Be/{sup 230}Th ratios as proxy for particle flux in the equatorial Pacific ocean

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, R.F.; Fleisher, M.Q. [LDEO of Columbia Univ. (United States); Kubik, P.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Suter, M. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

    1997-09-01

    Particulate {sup 10}Be/{sup 230}Th ratios collected by sediment traps in the central equatorial Pacific Ocean exhibit a positive correlation with particle flux, but little or no correlation with particle composition. (author) 1 fig., 4 refs.

  2. 40 CFR 230.12 - Findings of compliance or non-compliance with the restrictions on discharge.

    Science.gov (United States)

    2010-07-01

    ... and J) to minimize pollution or adverse effects to the affected aquatic ecosystems; or (3) Specified... required by § 230.11, and a brief explanation of any adaptation of these Guidelines to the activity under...

  3. The non-synonymous Arg230Cys variant (R230C) of the ATP-binding cassette transporter A1 is associated with low HDL cholesterol concentrations in Mexican adults: a population based nation wide study.

    Science.gov (United States)

    Aguilar-Salinas, Carlos A; Canizales-Quinteros, Samuel; Rojas-Martínez, Rosalba; Mehta, Roopa; Rodriguez-Guillén, Rosario; Ordoñez-Sanchez, María Luisa; Riba, Laura; Tusié-Luna, María Teresa

    2011-05-01

    To search for an association between the non-synonymous Arg230Cys variant (R230C) of the ATP-binding cassette transporter A1 and low HDL cholesterol levels in a Mexican, population-based nation wide survey. The 2000 National Health Survey is a cross sectional study that included individuals from 400 cities. All individuals who had a 9-12-h fasted blood sample and a DNA sample were selected (n = 1729). These cases were randomly distributed; no bias was detected for sex, education, region or socioeconomic status. The R230C variant was genotyped using TaqMan assays. In individuals with the R230C/C230C genotypes (39.03 mg/dl (36.63-41.43)) lower HDL-C levels (p cholesterol levels between alleles was 5.73 ± 1.4 mg/dl. The magnitude of the effect was significantly greater in males. The C230 allele of ABCA1 was associated with an increased risk for hypoalphalipoproteinemia (OR 1.66 (95%CI 1.08-2.54), p effect of waist circumference and gender, was 12.2% (95%CI 1.4-24.2%). The non-synonymous Arg230Cys variant of ABCA1 is associated with low levels of HDL cholesterol levels in Mexican adults. The HDL cholesterol lowering effect of the variant is greater in males. The size of the effect is greater compared to that reported for other ABCA1 variants. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  4. Development of an improved extruded dielectric cable rated 230 kV

    Energy Technology Data Exchange (ETDEWEB)

    Blais, L D; Traut, R T; Bolden, G N

    1977-05-01

    Work performed on developing an improved 230 kV extruded solid dielectric cable, the techniques of jointing such cables and the testing of terminations suitable for operation at that voltage level are described. Difficulties were encountered during manufacture in applying the semi-conducting extruded conductor shield. A new higher melt point compound solved the problem. A joint capable of operating at the 230 kV level was developed but showed a deficiency under voltage impulse testing while the conductor was at elevated temperature. A reduction in contract scope terminated this effort. Two terminals rated for 230 kV were found to be commercially available from domestic manufacturers. The limited testing performed showed them to be compatible with the cable cross-linked polyethylene insulation and electrically sound under 60 Hertz testing. No direct voltage or impulse voltage testing was performed on the terminations. A sample circuit, consisting of cable and joint, was subjected to impulse voltages at both room temperature and normal conductor operating temperature of 90/sup 0/C. While the cable only was able to withstand voltage impulses in excess of the Basic Impulse Level (BIL) at room temperature, it failed at BIL while conductor was heated to 90/sup 0/C. In like manner, a cable and joint circuit was assembled. Similar voltages were impressed at room temperature without incident. The joint failed at 90/sup 0/C conductor temperature. Cable, joint and termination were assembled in a simulated circuit and subjected to conductor loading to elevate temperature while 60 Hz voltages in excess of normal operating levels were continuously applied.

  5. Distribution of Th-230 and Th-228 in foods(II)

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Hee Dong; Kim, Wan; Lim, S. K.; Lee, S. A.; Choi, M. S.; Zheng, Y. C. [Kyungpook National Univ., Daegu (Korea, Republic of); Kim, Do Sung [Daegu Univ., Daegu (Korea, Republic of)

    2004-02-15

    Natural radioisotopes contained in foods can enter the human body by ingestion and contribute to internal doses to the population. It is necessary to measure the concentration of natural radioisotopes especially thorium in Korean foods and estimate the internal doses. In this study, we have established the thorium measuring process based on the thorium extraction chemical process and alpha spectroscopic method. The concentration of Th-228, Th-230 and Th-232 in Korean vegetables (potato, sweet potato, radish, cabbage, hot pepper, garlic, onion and pumpkin) and fruits(apple, persimmon, orange, pear, grape) are measured and their internal doses are estimated.

  6. New insights into cycling of 231Pa and 230Th in the Atlantic Ocean

    Science.gov (United States)

    Rempfer, Johannes; Stocker, Thomas F.; Joos, Fortunat; Lippold, Jörg; Jaccard, Samuel L.

    2017-06-01

    We use the Bern3D model of intermediate complexity to examine the marine cycle of isotopes 231Pa and 230Th and the relationship between the particle-bound ratio Pap /Thp and changes in the formation of the North Atlantic Deep Water (NADW). Model parameters describing reversible scavenging of isotopes by organic particles, opal, calcite and resuspended sediments were systematically varied and alternative sink parametrisations explored. It proves difficult to simultaneously achieve a good agreement with observations of dissolved and particle-associated concentrations of 231Pa and 230Th (Pad, Thd, Pap, Thp) as well as the particle-bound ratio Pap /Thp within the classical concept of reversible scavenging alone. Agreement between simulated and observed Pad, Thd and estimates of mean ocean residence times is improved by taking into account simplified representations of additional sinks at the sea floor (bottom scavenging) and at continental boundaries (boundary scavenging). We also find improved agreement between model and data by increasing lateral advection, in particular for Pad. These results point to the importance of sink processes that act in addition to reversible scavenging to shape the steady state distribution of 231Pa and, to a lesser degree, of 230Th. In transient experiments in which the strength of the Atlantic meridional overturning circulation (AMOC) is periodically turned on and off, we find a strong statistical relationship between variations in AMOC strength and Pap /Thp at great depths in the Northwest Atlantic region. These conclusions are robust across the range of sink parametrisations, that are consistent with estimates in the mean ocean residence time of 231Pa and 230Th. Our results indicate that the relationship between Pap /Thp and AMOC-strength may not be fundamentally affected by uncertainties in sink processes, at least on the large spatial and temporal scale considered here, and support the idea that changes in Pap /Thp in sediments of

  7. Sidney-North Yuma 230-kV Transmission Line Project, Colorado and Nebraska

    Energy Technology Data Exchange (ETDEWEB)

    1991-06-01

    This report describes the need for a 230-kV overhead transmission line to supply power from Sidney, Nebraska to eastern Colorado. The alternative scenario compared to construction of the line is No Action. Rejected alternatives include underground lines and different routing paths, with a possible extension to the Sterling area. Both scenarios are evaluated for environmental effects, cost, and consequences for the eastern Colorado region. The proposed route is determined to be the environmentally preferred choice. 120 refs., 6 figs., 13 tabs. (MHB)

  8. Carbohydrate intake modulates the effect of the ABCA1-R230C variant on HDL cholesterol concentrations in premenopausal women.

    Science.gov (United States)

    Romero-Hidalgo, Sandra; Villarreal-Molina, Teresa; González-Barrios, Juan A; Canizales-Quinteros, Samuel; Rodríguez-Arellano, Martha E; Yañez-Velazco, Lucia B; Bernal-Alcantara, Demetrio A; Villa, Antonio R; Antuna-Puente, Barbara; Acuña-Alonzo, Víctor; Merino-García, José L; Moreno-Sandoval, Hayde N; Carnevale, Alessandra

    2012-02-01

    The R230C variant of the ATP-binding cassette transporter A1 (ABCA1) gene has been consistently associated with decreased HDL-cholesterol (HDL-C) concentrations in several studies in the Mexican mestizo population. However, information on how diet composition modifies the effect of the ABCA1-R230C variant on HDL-C concentrations is very scarce. The aim of the present study was to analyze whether the effect of ABCA1-R230C on HDL-C concentrations is modulated by dietary factors in a nationwide population sample of 3591 adults from the National Health and Nutrition Survey conducted by the State's Employees' Social Security and Social Services Institute. All participants answered a validated questionnaire to assess health status and weekly food consumption. Fasting blood samples were drawn for biochemical analysis and DNA extraction, and the ABCA1-R230C variant was genotyped using TaqMan assays. Statistical analyses consisted of simple linear and multiple regression modeling adjusting for age, BMI, smoking, and alcohol consumption. The overall C risk allele frequency was 9.3% and the variant was significantly associated with low HDL-C concentrations in both sexes. A significant negative correlation between carbohydrate consumption and HDL-C concentrations was observed in women bearing the R230C variant (P = 0.021) and a significant gene-diet interaction was found only in premenopausal women (P = 0.037). In conclusion, the effect of the ABCA1-R230C gene variant on HDL-C concentrations is modulated by carbohydrate intake in premenopausal women. This finding may help design optimized dietary interventions according to sex and ABCA1-R230C genotype.

  9. Sediment redistribution and grainsize effects on 230Th-normalized mass accumulation rates and focusing factors in the Panama Basin

    Science.gov (United States)

    Loveley, Matthew R.; Marcantonio, Franco; Lyle, Mitchell; Ibrahim, Rami; Hertzberg, Jennifer E.; Schmidt, Matthew W.

    2017-12-01

    Here, we examine how redistribution of differing grain sizes by sediment focusing processes in Panama Basin sediments affects the use of 230Th as a constant-flux proxy. We study representative sediments of Holocene and Last Glacial Maximum (LGM) time slices from four sediment cores from two different localities close to the ridges that bound the Panama Basin. Each locality contains paired sites that are seismically interpreted to have undergone extremes in sediment redistribution, i.e., focused versus winnowed sites. Both Holocene and LGM samples from sites where winnowing has occurred contain significant amounts (up to 50%) of the 230Th within the >63 μm grain size fraction, which makes up 40-70% of the bulk sediment analyzed. For sites where focusing has occurred, Holocene and LGM samples contain the greatest amounts of 230Th (up to 49%) in the finest grain-sized fraction (sediment analyzed. There are slight underestimations of 230Th-derived mass accumulation rates (MARs) and overestimations of 230Th-derived focusing factors at focused sites, while the opposite is true for winnowed sites. Corrections made using a model by Kretschmer et al. (2010) suggest a maximum change of about 30% in 230Th-derived MARs and focusing factors at focused sites, except for our most focused site which requires an approximate 70% correction in one sample. Our 230Th-corrected 232Th flux results suggest that the boundary between hemipelagically- and pelagically-derived sediments falls between 350 and 600 km from the continental margin.

  10. Investigation of station blackout scenario in VVER440/v230 with RELAP5 computer code

    Energy Technology Data Exchange (ETDEWEB)

    Gencheva, Rositsa Veselinova, E-mail: roseh@mail.bg; Stefanova, Antoaneta Emilova, E-mail: antoanet@inrne.bas.bg; Groudev, Pavlin Petkov, E-mail: pavlinpg@inrne.bas.bg

    2015-12-15

    Highlights: • We have modeled SBO in VVER440. • RELAP5/MOD3 computer code has been used. • Base case calculation has been done. • Fail case calculation has been done. • Operator and alternative operator actions have been investigated. - Abstract: During the development of symptom-based emergency operating procedures (SB-EOPs) for VVER440/v230 units at Kozloduy Nuclear Power Plant (NPP) a number of analyses have been performed using the RELAP5/MOD3 (Carlson et al., 1990). Some of them investigate the response of VVER440/v230 during the station blackout (SBO). The main purpose of the analyses presented in this paper is to identify the behavior of important VVER440 parameters in case of total station blackout. The RELAP5/MOD3 has been used to simulate the SBO in VVER440 NPP model (Fletcher and Schultz, 1995). This model was developed at the Institute for Nuclear Research and Nuclear Energy, Bulgarian Academy of Sciences (INRNE-BAS), Sofia, for analyses of operational occurrences, abnormal events and design based scenarios. The model provides a significant analytical capability for specialists working in the field of NPP safety.

  11. Biaxial Thermal Creep of Alloy 617 and Alloy 230 for VHTR Applications

    Energy Technology Data Exchange (ETDEWEB)

    Mo, Kun; Lv, Wei; Tung, Hsiao-Ming; Yun, Di; Miao, Yinbin; Lan, Kuan-Che; Stubbins, James F.

    2016-05-18

    In this study, we employed pressurized creep tubes to investigate the biaxial thermal creep behavior of Inconel 617 (alloy 617) and Haynes 230 (alloy 230). Both alloys are considered to he the primary candidate structural materials for very high-temperature reactors (VITITRs) due to their exceptional high-temperature mechanical properties. The current creep experiments were conducted at 900 degrees C for the effective stress range of 15-35 MPa. For both alloys, complete creep strain development with primary, secondary, and tertiary regimes was observed in all the studied conditions. Tertiary creep was found to he dominant over the entire creep lives of both alloys. With increasing applied creep stress, the fraction of the secondary creep regime decreases. The nucleation, diffusion, and coarsening of creep voids and carbides on grain boundaries were found to be the main reasons for the limited secondary regime and were also found to be the major causes of creep fracture. The creep curves computed using the adjusted creep equation of the form epsilon= cosh 1(1 rt) + P-sigma ntm agree well with the experimental results for both alloys at die temperatures of 850-950 degrees C.

  12. Protein Helical Structure Determination Using CD Spectroscopy for Solutions with Strong Background Absorbance from 190-230 nm

    Science.gov (United States)

    Wei, Yang; Thyparambil, Aby A.; Latour, Robert A.

    2014-01-01

    Conventional empirical methods for the quantification of the helical content of proteins in solution using circular dichroism (CD) primarily rely on spectral data acquired between wavelengths of 190 to 230 nm. The presence of chemical species in a protein solution with strong absorbance within this range can interfere with the ability to use these methods for the determination of the protein’s helical structure. The objective of this research was to overcome this problem by developing a method for CD spectral analysis that relies on spectral features above this wavelength range. In this study, we determined that the slopes of CD spectra acquired over the 230 to 240 nm region strongly correlate with the helix contents including α-helix and 310-helix of protein as determined using conventional CD algorithms that rely on wavelengths between 190-230 nm. This approach (i.e., the 230-240 nm slope method) is proposed as an effective method to determine the helix content within proteins in the presence of additives such as detergents or denaturants with high absorbance of wavelengths up to 230 nm. PMID:25308773

  13. Protein helical structure determination using CD spectroscopy for solutions with strong background absorbance from 190 to 230nm.

    Science.gov (United States)

    Wei, Yang; Thyparambil, Aby A; Latour, Robert A

    2014-12-01

    Conventional empirical methods for the quantification of the helical content of proteins in solution using circular dichroism (CD) primarily rely on spectral data acquired between wavelengths of 190 and 230nm. The presence of chemical species in a protein solution with strong absorbance within this range can interfere with the ability to use these methods for the determination of the protein's helical structure. The objective of this research was to overcome this problem by developing a method for CD spectral analysis that relies on spectral features above this wavelength range. In this study, we determined that the slopes of CD spectra acquired over the 230 to 240nm region strongly correlate with the helix contents including α-helix and 310-helix of protein as determined using conventional CD algorithms that rely on wavelengths between 190 and 230nm. This approach (i.e., the 230-240nm slope method) is proposed as an effective method to determine the helix content within proteins in the presence of additives such as detergents or denaturants with high absorbance of wavelengths up to 230nm. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Naturally acquired antibody responses to recombinant Pfs230 and Pfs48/45 transmission blocking vaccine candidates

    DEFF Research Database (Denmark)

    Jones, Sophie; Grignard, Lynn; Nebie, Issa

    2015-01-01

    for the future evaluation of vaccine immunogenicity and efficacy in populations naturally exposed to malaria. METHODS: We determined naturally acquired antibody responses to the recombinant proteins Pfs48/45-10C and Pfs230-230CMB in children from three malaria endemic settings in Ghana, Tanzania and Burkina Faso......OBJECTIVES: Pfs48/45 and Pfs230 are Plasmodium falciparum sexual stage proteins and promising malaria transmission-blocking vaccine candidates. Antibody responses against these proteins may be naturally acquired and target antigens may be under selective pressure. This has consequences....... CONCLUSIONS: We conclude there are naturally acquired antibody responses to both vaccine candidates which have functional relevance by reducing the transmissibility of infected individuals. We identified genetic polymorphisms, in pfs48/45 which exhibited geographical specificity....

  15. Controls on 231Pa/230Th in the Indian Ocean: Circulation or Productivity?

    Science.gov (United States)

    Thomas, A. L.; Henderson, G. M.; McCave, N.

    2004-12-01

    (231Paxs/230Thxs)0 ratios in marine sediments are a potential proxy of palaeoproductivity and/or past ocean circulation. Studies in the Atlantic have demonstrated the particular potential of this proxy to assess the rate of past circulation AƒAøAøâ_sA¬Aøâ,¬Å" an important environmental variable which is otherwise difficult to reconstruct {[1, 2]}. In this study, we present new water-column and sediment data from the western Indian Ocean to improve understanding of the controls on (231Paxs/230Thxs)0 and test the use of this proxy. The Indian Ocean differs from the Atlantic because deep waters forming in the Southern Ocean and transported into the basin have high rather than low Pa and Th concentrations [3]. The ability to reconstruct past rates of flow into the Indian Ocean would be a powerful new use of Pa/Th, but no data presently exist to test this application. Water samples (10 litre), surface sediments, and a 5.5m Kasten core were collected on the Charles Darwin cruise CD154 from the area East of Madagascar. The down-core record, from10°S extends to 150 ka, and is coupled with a stable isotope stratigraphy and a sortable silt record. Water and sediment samples were analysed for isotopes of Pa, Th and U on a Nu Instruments MC-ICP-MS. The water-column dataset (26 samples) indicate that Pa concentrations are high in NADW transported into the Indian Ocean from the Atlantic, while opal scavenging has lowered Pa concentrations in deeper water masses. Sedimentary 230Th data indicate that there has been significant sediment focusing and that sediment mass fluxes are low. Preliminary sedimentary Pa/Th data show little relation to the sortable silt record. Ongoing Pa/Th and Ba data will complete this downcore record and allow comparison of a Pa/Th record with independent proxies of current speed and productivity in the same core. [1] E.F. Yu, et al, Nature 379, 689-694, 1996. [2] J.F. McManus, et al, Nature 428, 834-837, 2004. [3] M. M. Rutgers van der Loeff

  16. Comparison of joining processes for Haynes 230 nickel based super alloy

    Science.gov (United States)

    Williston, David Hugh

    Haynes 230 is a nickel based, solid-solution strengthened alloy that is used for high-temperature applications in the aero-engine and power generation industries. The alloy composition is balanced to avoid precipitation of undesirable topologically closed-packed (TCP) intermetallic phases, such as Sigma, Mu, or Laves-type, that are detrimental to mechanical and corrosion properties. This material is currently being used for the NASA's J2X upper stage rocket nozzle extension. Current fabrication procedures use fusion welding processes to join blanks that are subsequently formed. Cracks have been noted to occur in the fusion welded region during the forming operations. Use of solid state joining processes, such as friction stir welding are being proposed to eliminate the fusion weld cracks. Of interest is a modified friction stir welding process called thermal stir welding. Three welding process: Gas Metal Arc Welding (GMAW), Electron Beam Welding (EBW), and Thermal Stir Welding (TSWing) are compared in this study.

  17. Effects of age, sex, and disorder on voice range profile characteristics of 230 children.

    Science.gov (United States)

    Wuyts, Floris L; Heylen, Louis; Mertens, Fons; Du Caju, Marc; Rooman, Raoul; Van de Heyning, Paul H; De Bodt, Marc

    2003-06-01

    In this study, the effect of age, sex, and disorder on the vocal performance of 230 children 6 to 11 years of age was investigated by means of the voice range profile (VRP). Ninety-four control children and 136 children with disorders were studied. The VRPs were quantitatively described by frequency and intensity characteristics, as well as by morphological characteristics. Significant differences between healthy children and children with disorders were found. Age has a different effect in girls than in boys regarding vocal performance. Most of the characteristics for the healthy girls change gradually over the period from 6 to 11 years. For the healthy boys, however, two age groups can be identified: one below and one above 8 years of age. It is hypothesized that the androgen dehydroepiandrosterone (DHEA) and its sulfate may play a role in this phenomenon.

  18. Minimum speed limit for ocean ridge magmatism from 210Pb-226Ra-230Th disequilibria.

    Science.gov (United States)

    Rubin, K H; van der Zander, I; Smith, M C; Bergmanis, E C

    2005-09-22

    Although 70 per cent of global crustal magmatism occurs at mid-ocean ridges-where the heat budget controls crustal structure, hydrothermal activity and a vibrant biosphere-the tempo of magmatic inputs in these regions remains poorly understood. Such timescales can be assessed, however, with natural radioactive-decay-chain nuclides, because chemical disruption to secular equilibrium systems initiates parent-daughter disequilibria, which re-equilibrate by the shorter half-life in a pair. Here we use 210Pb-226Ra-230Th radioactive disequilibria and other geochemical attributes in oceanic basalts less than 20 years old to infer that melts of the Earth's mantle can be transported, accumulated and erupted in a few decades. This implies that magmatic conditions can fluctuate rapidly at ridge volcanoes. 210Pb deficits of up to 15 per cent relative to 226Ra occur in normal mid-ocean ridge basalts, with the largest deficits in the most magnesium-rich lavas. The 22-year half-life of 210Pb requires very recent fractionation of these two uranium-series nuclides. Relationships between 210Pb-deficits, (226Ra/230Th) activity ratios and compatible trace-element ratios preclude crustal-magma differentiation or daughter-isotope degassing as the main causes for the signal. A mantle-melting model can simulate observed disequilibria but preservation requires a subsequent mechanism to transport melt rapidly. The likelihood of magmatic disequilibria occurring before melt enters shallow crustal magma bodies also limits differentiation and heat replenishment timescales to decades at the localities studied.

  19. Epidemiological aspects of penile cancer in Rio de Janeiro: evaluation of 230 cases

    Directory of Open Access Journals (Sweden)

    Leandro Koifman

    2011-04-01

    Full Text Available PURPOSE: To determine epidemiological characteristics of penile cancer in Rio de Janeiro, its associated risk factors and clinical manifestations. PATIENTS AND METHODS: Between 2002 and 2008 we evaluated 230 patients at three public institutions, considering age, ethnicity, birthplace, marital status, educational level, religion, tobacco smoking, presence of phimosis and practice of circumcision. RESULTS: The ages ranged from 25 to 98 years, with an average of 58.35 years. Of the 230 patients, 167 (72.7% were from the southeast region of Brazil (which includes Rio de Janeiro and 45 (19.5% were from the northeast of the country. Most patients were white (67.3%, married (58.6%, smokers (56.5% and had not completed primary school (71.3%. The predominant religion was Catholic (74.8%. Of the 46 (20% circumcised patients, only 1 (2.2% had undergone neonatal circumcision. Grade I tumors were present in 87 (37.8% of the patients, grade II in 131 (56.9% and grade III in 12 (5.3%. Lymphovascular embolization was observed in 63 (27.3% and koilocytosis in 124 (53.9% patients. Of the total, 41.3% had corpora cavernosa or corpus spongiosum infiltration, and 40 (17.4% had urethral invasion. Prophylactic lymphadenectomy was performed on 56 (36.1%, therapeutic lymphadenectomy on 84 (54.2% and hygienic lymphadenectomy for advanced disease on 15 (9.7% patients. The median time between the lesion onset and clinical diagnosis was 13.2 months. The mean follow up was 28.8 months. CONCLUSION: Most of our patients were born in this state and had low socioeconomic status. Most of them were white men, married, smokers, uncircumcised, of the Catholic faith and in their sixties or older. Their disease was in most cases diagnosed only in the advanced stages.

  20. 20 CFR 410.230 - Written statement filed by or for a miner on behalf of a member of his family.

    Science.gov (United States)

    2010-04-01

    ... behalf of a member of his family. 410.230 Section 410.230 Employees' Benefits SOCIAL SECURITY... statement filed by or for a miner on behalf of a member of his family. Notwithstanding the provisions of... filed by or for a miner on behalf of a member of his family until such miner's death. At such time, the...

  1. 42 CFR 435.230 - Aged, blind, and disabled individuals in States that use more restrictive requirements for...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Aged, blind, and disabled individuals in States... Coverage of the Aged, Blind, and Disabled § 435.230 Aged, blind, and disabled individuals in States that... for aged, blind, and disabled SSI recipients using more restrictive requirements than those used under...

  2. 17 CFR 230.160 - Registered investment company exemption from Section 101(c)(1) of the Electronic Signatures in...

    Science.gov (United States)

    2010-04-01

    ... exemption from Section 101(c)(1) of the Electronic Signatures in Global and National Commerce Act. 230.160...(c)(1) of the Electronic Signatures in Global and National Commerce Act. A prospectus for an... 101(c)(1) of the Electronic Signatures in Global and National Commerce Act. ...

  3. 78 FR 24771 - Notice of Availability of the Final Environmental Impact Statement for the Gateway West 230/345...

    Science.gov (United States)

    2013-04-26

    ... Environmental Impact Statement for the Gateway West 230/345/500-kV Transmission Line Project in Idaho and... Forest Service (Forest Service) have prepared the Gateway West Transmission Line Project Final... public involvement activities for the Gateway West Transmission Line Project will be announced to the...

  4. 230Th/U dating of Last Interglacial brain corals from Bonaire (southern Caribbean) using bulk and theca wall material

    Science.gov (United States)

    Obert, J. Christina; Scholz, Denis; Felis, Thomas; Brocas, William M.; Jochum, Klaus P.; Andreae, Meinrat O.

    2016-04-01

    We compared the suitability of two skeletal materials of the Atlantic brain coral Diploria strigosa for 230Th/U-dating: the commonly used bulk material comprising all skeletal elements and the denser theca wall material. Eight fossil corals of presumably Last Interglacial age from Bonaire, southern Caribbean Sea, were investigated, and several sub-samples were dated from each coral. For four corals, both the ages and the activity ratios of the bulk material and theca wall agree within uncertainty. Three corals show significantly older ages for their bulk material than for their theca wall material as well as substantially elevated 232Th content and (230Th/238U) ratios. The bulk material samples of another coral show younger ages and lower (230Th/238U) ratios than the corresponding theca wall samples. This coral also contains a considerable amount of 232Th. The application of the available open-system models developed to account for post-depositional diagenetic effects in corals shows that none of the models can successfully be applied to the Bonaire corals. The most likely explanation for this observation is that the assumptions of the models are not fulfilled by our data set. Comparison of the theca wall and bulk material data enables us to obtain information about the open-system processes that affected the corals. The corals showing apparently older ages for their bulk material were probably affected by contamination with a secondary (detrital) phase. The most likely source of the detrital material is carbonate sand. The higher (230Th/232Th) ratio of this material implies that detrital contamination would have a much stronger impact on the ages than a contaminant with a bulk Earth (230Th/232Th) ratio and that the threshold for the commonly applied 232Th reliability criterion would be much lower than the generally used value of 1 ng g-1. The coral showing apparently younger ages for its bulk material was probably influenced by more than one diagenetic process. A

  5. 230Th-234U Age-Dating Uranium by Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Williams, R W; Gaffney, A M

    2012-04-18

    This is the standard operating procedure used by the Isotope Ratio Mass Spectrometry Group of the Chemical Sciences Division at LLNL for the preparation of a sample of uranium oxide or uranium metal for {sup 230}Th-{sup 234}U age-dating. The method described here includes the dissolution of a sample of uranium oxide or uranium metal, preparation of a secondary dilution, spiking of separate aliquots for uranium and thorium isotope dilution measurements, and purification of uranium and thorium aliquots for mass spectrometry. This SOP may be applied to uranium samples of unknown purity as in a nuclear forensic investigation, and also to well-characterized samples such as, for example, U{sub 3}O{sub 8} and U-metal certified reference materials. The sample of uranium is transferred to a quartz or PFA vial, concentrated nitric acid is added and the sample is heated on a hotplate at approximately 100 C for several hours until it dissolves. The sample solution is diluted with water to make the solution approximately 4 M HNO{sub 3} and hydrofluoric acid is added to make it 0.05 M HF. A secondary dilution of the primary uranium solution is prepared. Separate aliquots for uranium and thorium isotope dilution measurements are taken and spiked with {sup 233}U and {sup 229}Th, respectively. The spiked aliquot for uranium isotope dilution analysis is purified using EiChrom UTEVA resin. The spiked aliquot for thorium isotope dilution analysis is purified by, first, a 1.8 mL AG1x8 resin bed in 9 M HCl on which U adsorbs and Th passes through; second, adsorbing Th on a 1 mL AG1x8 resin bed in 8 M HNO{sub 3} and then eluting it with 9 M HCl followed by 0.1 M HCl + 0.005 M HF; and third, by passing the Th through a final 1.0 mL AG1x8 resin bed in 9 M HCl. The mass spectrometry is performed using the procedure 'Th and U Mass Spectrometry for {sup 230}Th-{sup 234}U Age Dating'.

  6. Childhood systemic lupus erythematosus in Latin America. The GLADEL experience in 230 children.

    Science.gov (United States)

    Ramírez Gómez, L A; Uribe Uribe, O; Osio Uribe, O; Grisales Romero, H; Cardiel, M H; Wojdyla, D; Pons-Estel, B A; Catoggio, Luis J; Soriano, Enrique R; Imamura, Patricia M; Manni, Jorge A; Grimaudo, Sebastián; Sarano, Judith; Maldonado-Cocco, José A; Arriola, Maria S; Gómez, Graciela; García, Mercedes A; Marcos, Ana Inés; Marcos, Juan Carlos; Scherbarth, Hugo R; Marino, Pilar C; Motta, Estela L; Drenkard, Cristina; Gamron, Susana; Buliubasich, Sandra; Onetti, Carlos M; Caeiro, Francisco; Alvarellos, Alejandro; Saurit, Verónica; Gentiletti, Silvana; Quagliatto, Norberto; Gentiletti, Alberto A; Machado, Daniel; Abdala, Marcelo; Palatnik, Simón; Berbotto, Guillermo A; Battagliotti, Carlos A; Sato, Emilia; Sella, Elaine M C; Souza, AlexandreW S; Costallat, Lilian T Lavras; Bertolo, Manoel Barros; Coimbra, Ibsen Bellini; Borba Neto, Eduardo Ferreira; Bonfá, Eloisa; Tavares, João Carlos; Brenol; Xavier, Ricardo; Mucenic, Tamara; Cavalcanti, Fernando de Souza; Duarte, Angela Luzia Branco; Marques, Cláudia Diniz Lopes; Da Silva, Nilzio Antonio; de O e Silva, Ana Carolina; Pacheco, Tatiana Ferracine; Molina-Restrepo, José Fernando; Molina-López, Javier; Iglesias-Gamarra, Antonio; Iglesias-Rodríguez, Antonio; Egea-Bermejo, Eduardo; Guzmán-Moreno, Renato A; Restrepo-Suárez, José F; Guibert-Toledano, Marlene; Reyes-Llerena, Gil Alberto; Massardo, Loreto; Gareca, Néstor; Jacobelli, Sergio; Neira, Oscar J; Guzmán, Leonardo R; Garcia-Kutzbach, Abraham; Castellanos, Claudia; Cajas, Erwin; Pascual-Ramos, Virginia; Barile-Fabris, Leonor A; Miranda-Limón, Juan Manuel; Amigo, Mary-Carmen; Silveira, Luis H; De La Torre, Ignacio García; Orozco-Barocio, Gerardo; Estrada-Contreras, Magali L; del Pozo, Maria Josefina Sauza; Aranda Baca, Laura E; Quezada, Adelfia Urenda; Huerta-Yáñez, Guillermo F; Acevedo-Vásquez, Eduardo M; Alfaro-Lozano, José Luis; Cucho-Venegas, Jorge M; Segami, Maria Inés; Chung, Cecilia P; Alva-Linares, Magaly; Abadi, Isaac; Chacón-Díaz, Rosa; Al Snih Al Snih, Soham; Esteva-Spinetti, Maria H; Vivas, Jorge

    2008-06-01

    To evaluate disease characteristics of childhood onset SLE in Latin America and to compare this information with an adult population in the same cohort of GLADEL. A protocol was designed as a multicenter, multinational, inception cohort of lupus patients to evaluate demographic, clinical, laboratory and serological variables, as well as classification criteria, disease activity, organ damage and mortality. Descriptive statistics, chi square, Fisher's exact test, Student's t test and multiple logistic regression were used to compare childhood and adult onset SLE. 230 patients were oral ulcers, thrombocytopenia and hemolytic anemia and some neurologic manifestations were more prevalent in children (p<0.05). On the other hand, myalgias, Sjögren's syndrome and cranial nerve involvement were more frequently seen in adults (p<0.05). Afro-Latin-American children had a higher prevalence of fever, thrombocytopenia and hemolytic anemia. White and mestizo children had a higher prevalence of malar rash. Mestizo children had a higher prevalence of cerebrovascular disease and cranial nerve involvement. Children met SLE ACR criteria earlier with higher mean values than adults (p: 0.001). They also had higher disease activity scores (p: 0.01), whereas adults had greater disease damage (p: 0.02). In Latin America, childhood onset SLE seems to be a more severe disease than adults. Some differences can be detected among ethnic groups.

  7. Statement about researches relative to the operation stability of the MPS P230 of Ariane 5; Point sur les recherches relatives a la stabilite de fonctionnement du MPS P230 d'Ariane 5

    Energy Technology Data Exchange (ETDEWEB)

    Vuillot, F.

    1998-07-01

    This paper makes a statement about the researches carried out in the framework of the ASSM (Aerodynamics of Segmented Solid Motors) research program on the operation stability of the MPS P230 solid propellant engine of the French Ariane 5 launcher. After a brief historical recall of the works performed on this topic during the last 10 years, the present day situation is detailed. The feasibility of a numerical capture of the instability phenomenon is now achieved and 3 scenarios leading to swirl flow instabilities could be identified. These scenarios were validated using numerical simulation, simulation in cold gases, and launcher tests. However, one scenario based on a strong instability mechanism, seems to better fit with the observations made on the P230 engine and will deeply influence the scientific strategy of the research program. (J.S.)

  8. Optimum design of a self-supported power transmission tower type 2M2 for 230 kW; Diseno optimo de una torre de transmision autosoportada tipo 2M2, para 230 kW

    Energy Technology Data Exchange (ETDEWEB)

    Espejel Valdez, Eduardo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Millan Monje, Alejandro; Honk Hernandez, Wenceslao [Comision Federal de Electricidad, (CFE), Mexico, D. F. (Mexico)

    1985-12-31

    A group of specialists from the Comision Federal de Electricidad (CFE) and of the Instituto de Investigaciones Electricas (IIE) analyzes the design of various types of power transmission towers in their application stage, in order to enhance them. In this article the structural characteristics of the self-supported tower type 2M2 for 230 kV of two circuits and of suspension, are presented. [Espanol] Un grupo de especialistas de la Comision Federal de Electricidad (CFE) y del Instituto de Investigaciones Electricas (IIE) analiza el diseno de diversos tipos de torres de transmision en su etapa de aplicacion, con el fin de mejorarlos. En este articulo se presentan las caracteristicas estructurales de la torre autosoportada tipo 2M2 para 230 kV, de dos circuitos y de suspension.

  9. Investigating the use of 232Th/230Th as a dust proxy using co-located seawater and sediment samples from the low-latitude North Atlantic

    Science.gov (United States)

    Rowland, George H.; Ng, Hong Chin; Robinson, Laura F.; McManus, Jerry F.; Mohamed, Kais J.; McGee, David

    2017-10-01

    The thorium isotope ratio 232Th/230Th can be measured in seawater and sediment samples, and has been used as a proxy to reconstruct lithogenic fluxes to the oceans for the modern day and the Pleistocene. There has not yet been a systematic study testing the proxy using the 232Th/230Th ratio in seawater and the ratio recorded in the underlying sediment. In this study we use co-located core-top sediments and seawater samples from five seamount sites spanning the tropical North Atlantic to investigate the link between seawater and sediment 232Th/230Th ratios across a range of water depths. Our results indicate that a broad correlation exists between seawater and sedimentary 232Th/230Th ratios. Both seawater and sedimentary 232Th/230Th ratios record a signal consistent with decreasing lithogenic input east to west, from Africa to South America. However, calculated 232Th fluxes for the core-top sediment samples indicate a strong dependence on depth, with up to a factor of ∼4 difference from shallow (2900 m). This depth dependence is likely caused by either a deficit of 230Th burial at depth compared to the production in the overlying water column, through addition of 232Th, or by a combination of the two. By comparing seawater and sedimentary 232Th/230Th ratios we derive an apparent fractional solubility of 232Th of 29 ± 3%, in reasonable agreement with the upper end of existing estimates.

  10. Sequence of decommissioning of the main equipment in a central type VVER 440 V-230; Secuencia de desmantelamiento de los equipos principales de una central Tipo VVer 440 V-230

    Energy Technology Data Exchange (ETDEWEB)

    Andres, E.; Garcia Ruiz, R.

    2014-10-01

    IBERDROLA Ingenieria y Construccion S.A.U., leader of consortium with Empresarios Agrupados and INDRA, has developed the Basic Engineering for the decommissioning of contaminated systems and building of a VVER 440 V-230 Nuclear Power Plant, establishing the sequence and methodology for the main equipment fragmentation. For that, it has been designed dry and wet cutting zones to be set up in the area where steam generators, main cooling pumps and pressurizer are located; these components will be dismantled previously. (Author)

  11. Potential and limitations of radiometric {sup 230}Th/U dating of tufa (travertine) in Stuttgart; Grenzen der radiometrischen {sup 230}TH/U-Altersbestimmung der Sauerwasserkalkvorkommen (Travertine) in Stuttgart

    Energy Technology Data Exchange (ETDEWEB)

    Geyh, M. [Niedersaechsisches Landesamt fuer Bodenforschung, Hannover (Germany); Reiff, W.; Frank, N. [Heidelberger Akademie der Wissenschaften, Heidelberg (Germany)

    1999-12-01

    The second largest springs in Europe discharge mineralized groundwater with a recent rate of 500 l/s within the region of Stuttgart since at least 500 000 years. Most of the precipitated travertine (Sauerwasserkalk) can be dated chronostratigraphically by artifacts, biostratigraphically by macrofossils and geologically by the elevation of the terraces of the River Neckar. All travertines were formed during warm periods. The deposition of huge travertine deposits from different geological periods, at the same place and from the same mineral water system has been a challenge for the absolute age determination in order to correlate the regional climatic chronology with the global one. Since the beginning of the eighties radiometric {sup 230}Th/U datings were carried out from various research groups. In the middle of the nineties {sup 230}Th/U dating by the modern thermion mass spectrometry (TIMS) opened a more precise and more reliable age determination of travertine. Hence, the comparison of the methodically differing results from the same samples offered the possibility to search for criteria to justify the reliability of the {sup 230}Th/U dates of such deposits as a whole and deliver a reliable absolute chronology. (orig.)

  12. Excitation Potentials and Shell Corrections for the Elements Z2=20 to Z2=30

    DEFF Research Database (Denmark)

    Andersen, H.H.; Sørensen, H.; Vadja, P.

    1969-01-01

    Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas-Fe...... are found by means of Bonderup's shell corrections. Within the Z2 interval treated here, it is found that I/Z2 increases with increasing Z2, contrary to the general trend through the periodic system of elements......Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas...

  13. 238U-230Th dating of chevkinite in high-silica rhyolites from La Primavera and Yellowstone calderas

    Science.gov (United States)

    Vazquez, Jorge A.; Velasco, Noel O.; Schmitt, Axel K.; Bleick, Heather A.; Stelten, Mark E.

    2014-01-01

    Application of 238U-230Th disequilibrium dating of accessory minerals with contrasting stabilities and compositions can provide a unique perspective on magmatic evolution by placing the thermochemical evolution of magma within the framework of absolute time. Chevkinite, a Th-rich accessory mineral that occurs in peralkaline and metaluminous rhyolites, may be particularly useful as a chronometer of crystallization and differentiation because its composition may reflect the chemical changes of its host melt. Ion microprobe 128U-230Th dating of single chevkinite microphenocrysts from pre- and post-caldera La Primavera, Mexico, rhyolites yields model crystallization ages that are within 10's of k.y. of their corresponding K-Ar ages of ca. 125 ka to 85 ka, while chevkinite microphenocrysts from a post-caldera Yellowstone, USA, rhyolite yield a range of ages from ca. 110 ka to 250 ka, which is indistinguishable from the age distribution of coexisting zircon. Internal chevkinite-zircon isochrons from La Primavera yield Pleistocene ages with ~5% precision due to the nearly two order difference in Th/U between both minerals. Coupling chevkinite 238U-230Th ages and compositional analyses reveals a secular trend of Th/U and rare earth elements recorded in Yellowstone rhyolite, likely reflecting progressive compositional evolution of host magma. The relatively short timescale between chevkinite-zircon crystallization and eruption suggests that crystal-poor rhyolites at La Primavera were erupted shortly after differentiation and/or reheating. These results indicate that 238U-230Th dating of chevkinite via ion microprobe analysis may be used to date crystallization and chemical evolution of silicic magmas.

  14. Constraining Circulation Changes Through the Last Deglaciation with Deep-sea Coral Radiocarbon and Sedimentary Pa231/Th230

    Science.gov (United States)

    2012-02-01

    thermohaline circulation inferred from radiochemical data, Nature, 379(6567), 689-694. 31 Chapter 2. Reconnaissance dating: A new radiocarbon method...Stocker, and F. Joos (2000), Ocean thermohaline circulation and sedimentary 231Pa/230Th ratio, Paleocea- nography , 15 , 625–641, doi :10.1029...2012-02 DOCTORAL DISSERTATION by Andrea Burke February 2012 Constraining Circulation Changes Through the Last Deglaciation with Deep-sea Coral

  15. Uso do fogo na BR 230 entre os municípios de Pombal e Cajazeira – PB, Brasil

    Directory of Open Access Journals (Sweden)

    Lauter Silva Souto

    2014-06-01

    Full Text Available O uso do fogo é uma prática comum no meio rural, por ser uma técnica eficiente sob o ponto de vista dos produtores, no entanto está pratica quando usada de forma inadequada pode trazer prejuízos a biodiversidade local, como também promover o desgaste das rodovias acarretando prejuízos também aos cofres públicos, além de promover acidentes ocasionados pela pouca visibilidade provocada pela sua fumaça. Diante do exposto, o objetivo desse trabalho foi diagnosticar o uso do fogo as margens da BR- 230, entre os municípios de Pombal e Cajazeiras, PB. Foi utilizado para o estudo das áreas queimadas as coordenadas obtidas por meio de equipamento de georeferenciamento (GPS - Global Positioning System, modelo – Garmin GPS Map 60 CS. Foram utilizados programas computacionais (Softwares para processamento dos dados obtidos. O mapa de localização das áreas queimadas foi obtido por meio de visitas a campo com o auxílio do GPS. Durante a pesquisa foram detectados 31 focos de incêndios na área em estudo, totalizando uma área de 675055 m2 (6,75 km2. Os trechos Pombal-Sousa e Sousa-Cajazeiras comportam 30,7% dos pontos ou focos de incêndio na faixa marginal de domínio da BR 230. Quase que a totalidade dos focos de queimadas ao no trecho da BR 230, entre os municípios de Pombal e Cajazeiras – PB, ocorrem entre os meses de setembro e janeiro. Não são verificadas politicas de conscientização sob esses problemas de incêndios ao longo do trecho da BR 230 aos agricultores.

  16. Measurements of /sup 234/U, /sup 238/U and /sup 230/Th in excreta of uranium-mill crushermen

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.; Jackson, P.O.; Brodacynski, G.G.; Scherpelz, R.I.

    1982-07-01

    Uranium and thorium levels in excreta of uranium mill crushermen who are routinely exposed to airborne uranium ore dust were measured. The purpose was to determine whether /sup 230/Th was preferentially retained over either /sup 234/U or /sup 238/U in the body. Urine and fecal samples were obtained from fourteen active crushermen with long histories of exposure to uranium ore dust, plus four retired crushermen and three control individuals for comparison. Radiochemical procedures were used to separate out the uranium and thorium fractions, which were then electroplated on stainless steel discs and assayed by alpha spectrometry. Significantly greater activity levels of /sup 234/U and /sup 238/U were measured in both urine and fecal samples obtained from uranium mill crushermen, indicating that uranium in the inhaled ore dust was cleared from the body with a shorter biological half-time than the daughter product /sup 230/Th. The measurements also indicated that uranium and thorium separate in vivo and have distinctly different metabolic pathways and transfer rates in the body. The appropriateness of current ICRP retention and clearance parameters for /sup 230/Th in ore dust is questioned.

  17. Trimming algorithm of frequency modulation for CIAE-230 MeV proton superconducting synchrocyclotron model cavity

    Energy Technology Data Exchange (ETDEWEB)

    Li, Pengzhan, E-mail: lipengzhan@ciae.ac.cn; Zhang, Tianjue; Ji, Bin; Hou, Shigang; Guo, Juanjuan; Yin, Meng; Xing, Jiansheng; Lv, Yinlong; Guan, Fengping; Lin, Jun

    2017-01-21

    A new project, the 230 MeV proton superconducting synchrocyclotron for cancer therapy, was proposed at CIAE in 2013. A model cavity is designed to verify the frequency modulation trimming algorithm featuring a half-wave structure and eight sets of rotating blades for 1 kHz frequency modulation. Based on the electromagnetic (EM) field distribution analysis of the model cavity, the variable capacitor works as a function of time and the frequency can be written in Maclaurin series. Curve fitting is applied for theoretical frequency and original simulation frequency. The second-order fitting excels at the approximation given its minimum variance. Constant equivalent inductance is considered as an important condition in the calculation. The equivalent parameters of theoretical frequency can be achieved through this conversion. Then the trimming formula for rotor blade outer radius is found by discretization in time domain. Simulation verification has been performed and the results show that the calculation radius with minus 0.012 m yields an acceptable result. The trimming amendment in the time range of 0.328–0.4 ms helps to reduce the frequency error to 0.69% in Simulation C with an increment of 0.075 mm/0.001 ms, which is half of the error in Simulation A (constant radius in 0.328–0.4 ms). The verification confirms the feasibility of the trimming algorithm for synchrocyclotron frequency modulation. - Highlights: • A model cavity is designed to verify the trimming algorithm of frequency modulation. • The RF frequency is expressed by fitting approximation and Maclaurin series. • The variable capacitor of the cavity works as a function of time. • The trimming formula for blade radius is found by discretization in time domain. • The amendment solution helps to reduce the frequency error.

  18. DC-Motor Drive Encompassing SiGe Asynchronous Control Electronics for Ultra-Wide (-230 0C to +130 0C) Environments Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This Small Business Innovation Research Phase I project seeks to investigate and prove the feasibility of developing ultra-wide temperature (-230

  19. DC-Motor Drive Encompassing SiGe Asynchronous Control Electronics for Ultra-Wide (-230 0C to +130 0C) Environments Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In Phase I, the research team formed by APEI, Inc. and University of Arkansas proved the feasibility of developing ultra-wide temperature (-230

  20. Tank 241-TX-104, cores 230 and 231 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Diaz, L.A.

    1998-07-07

    This document is the analytical laboratory report for tank 241-TX-104 push mode core segments collected between February 18, 1998 and February 23, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-104 Push Mode Core Sampling and Analysis Plan (TSAP) (McCain, 1997), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995) and the Safety Screening Data Quality Objective (DQO) (Dukelow, et.al., 1995). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report. Appearance and Sample Handling Attachment 1 is a cross reference to relate the tank farm identification numbers to the 222-S Laboratory LabCore/LIMS sample numbers. The subsamples generated in the laboratory for analyses are identified in these diagrams with their sources shown. Core 230: Three push mode core segments were removed from tank 241-TX-104 riser 9A on February 18, 1998. Segments were received by the 222-S Laboratory on February 19, 1998. Two segments were expected for this core. However, due to poor sample recovery, an additional segment was taken and identified as 2A. Core 231: Four push mode core segments were removed from tank 241-TX-104 riser 13A between February 19, 1998 and February 23, 1998. Segments were received by the 222-S Laboratory on February 24, 1998. Two segments were expected for this core. However, due to poor sample recovery, additional segments were taken and identified as 2A and 2B. The TSAP states the core samples should be transported to the laboratory within three

  1. The ABCA1 gene R230C variant is associated with decreased risk of premature coronary artery disease: the genetics of atherosclerotic disease (GEA study.

    Directory of Open Access Journals (Sweden)

    Teresa Villarreal-Molina

    Full Text Available BACKGROUND: ABCA1 genetic variation is known to play a role in HDL-C levels and various studies have also implicated ABCA1 variation in cardiovascular risk. The functional ABCA1/R230C variant is frequent in the Mexican population and has been consistently associated with low HDL-C concentrations. Although it has been associated with other cardiovascular risk factors such as obesity and type 2 diabetes mellitus, it is not known whether it is associated with coronary artery disease (CAD. AIM: The purpose of the study was to analyze whether the ABCA1/R230C variant is associated with premature CAD in a case-control association study (GEA or Genetics of Atherosclerotic Disease, and to explore whether BMI modulates the effect of the C230 allele on other metabolic traits using a population-based design. RESULTS: The C230 allele was significantly associated with both lower HDL-C levels and a lower risk of premature CAD as compared to controls (OR = 0.566; P(add = 1.499×10(-5. In addition, BMI modulated the effect of R230C on body fat distribution, as the correlation between BMI and visceral to subcutaneous adipose tissue (a metric of the propensity to store fat viscerally as compared to subcutaneously was negative in RR homozygous individuals, but positive in premenopausal women bearing the C230 allele, with a statistically significant interaction (P = 0.005. BMI-R230C interaction was also significant for triglyceride levels in women regardless of their menopausal status (P = 0.036. CONCLUSION: This is the first study assessing the effect of the R230C/ABCA1 variant in remature CAD. C230 was associated with both decreased HDL-C levels and a lower risk of premature CAD, and gender-specific BMI-R230C interactions were observed for different metabolic traits. These interactions may help explain inconsistencies in associations, and underscore the need to further analyze interactions of this functional and frequent variant with diet, exercise

  2. Laser ablation ICP-mass spectrometry determination of Th{sup 230} in soils at the Gunnison, Colorado UMTRA site

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, M.S.; Braymen, S.; McIntosh, R. [Ames Lab., IA (United States)] [and others

    1994-02-16

    This report describes an innovative technology, laser ablation-inductively couple plasma-mass spectrometry (LA-ICP-MS), operated in a mobile laboratory, to rapidly detect thorium 230 activity levels in soil samples. This technology was demonstrated on-site during November 1993 at the Gunnison, Colorado, UMTRA project site in support of their remediation effort. The LA-ICP-MS sampling and analysis technique was chosen because of the capability for rapid analysis, approximately three samples per hour, with minimal sample preparation.

  3. Performance-based specifications and control of concrete durability state-of-the-art report RILEM TC 230-PSC

    CERN Document Server

    Luco, Luis

    2016-01-01

    This work gives an overview of significant research from recent years concerning performance-based design and quality control for concrete durability and its implementation. In engineering practice, performance approaches are often still used in combination with prescriptive requirements. This is largely because, for most durability test methods, sufficient practical experience still has to be gained before engineers and owners are prepared to fully rely on them.   This book, compiled by RILEM TC 230-PSC, is intended to assist efforts to successfully build the foundation for the full implementation of performance-based approaches through the exchange of relevant knowledge and experience between researchers and practitioners worldwide.  .

  4. Systematic investigation of the suitability of two different skeletal materials of Diploria strigosa corals for 230Th/U-dating

    Science.gov (United States)

    Obert, J. C.; Scholz, D.; Felis, T.; Brocas, W.; Jochum, K. P.

    2014-12-01

    Fossil reef corals are widely used in palaeoclimate research which requires precise absolute dating. However, post-depositional open-system behaviour often causes apparently inaccurate 230Th/U-ages. We systematically tested the suitability of two different skeletal materials of eight Diploria strigosa corals from Bonaire, Netherlands Antilles, for 230Th/U-dating: (i) The commonly used bulk sample material comprised of all skeletal elements and (ii) the denser theca walls. The theca walls show less diagenetic alteration. The 230Th/U-ages range from 118.9 ± 2.0 to 130.6 ± 1.2 ka. In contrast, the ages determined on the bulk material range from 112.98 ± 0.80 to 174.0 ± 2.2 ka and, thus, show substantially older and younger ages than expected for the Last Interglacial. Furthermore, for all corals, at least one of the theca sub-samples has an initial (234U/238U) activity ratio similar to the modern seawater value. For the bulk material, only 50 % of the corals show this agreement. Thus, the bulk material is obviously more prone to open-system processes. Therefore, the extraction of the theca walls from the coral skeleton considerably improves the reliability of the 230Th/U-ages. Comparison of the bulk material with the more pristine theca walls shows that several different open-system processes affected the fossil corals. For 50 % of the corals, no significant differences in ages, activity ratios and concentrations between the two materials are observed. For three of the eight corals, the bulk samples contain considerable amounts of 232Th indicating detrital contamination, probably in combination with uranium loss. These samples also yield the oldest ages predating the beginning of the Last Interglacial by up to 35 ka. For one coral, the bulk material yields younger ages than the theca wall material. This sample also contains elevated 232Th, which again suggests detrital contamination. In addition, the coral was subject to secondary aragonite precipitation

  5. Observations on the oxidation of Mn-modified Ni-base Haynes 230 alloy under SOFC exposure conditions

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Z Gary; Xia, Gordon; Stevenson, Jeffry W.; Singh, Prabhakar

    2005-07-01

    The commercial Ni-base Haynes 230 alloy (Ni-Cr-Mo-W-Mn) was modified with two increased levels of Mn (1 and 2 wt per cent) and evaluated for its oxidation resistance under simulated SOFC interconnect exposure conditions. Oxidation rate, oxide morphology, oxide conductivity and thermal expansion were measured and compared with commercial Haynes 230. It was observed that additions of higher levels of Mn to the bulk alloy facilitated the formation of a bi-layered oxide scale that was comprised of an outer M3O4 (M=Mn, Cr, Ni) spinel-rich layer at the oxide – gas interface over a Cr2O3-rich sub-layer at the metal – oxide interface. The modified alloys showed higher oxidation rates and the formation of thicker oxide scales compared to the base alloy. The formation of a spinel-rich top layer improved the scale conductivity, especially during the early stages of the oxidation, but the higher scale growth rate resulted in an increase in the area-specific electrical resistance over time. Due to their face-centered cubic crystal structure, both commercial and modified alloys demonstrated a coefficient of thermal expansion that was higher than that of typical anode-supported and electrolyte-supported SOFCs.

  6. Spectroscopy of actinium-215 and (p,t) studies of the stable palladium isotopes

    Science.gov (United States)

    Winkler, Ryan

    2009-12-01

    The study of both the microscopic and macroscopic structural evolution of the atomic nucleus is presented in this work. The excited states of the N = 126 isotone 215Ac were investigated at WNSL using the gas-filled recoil separator SASSYER. Recoil-decay tagging of the gamma rays corresponding to the decay of 215Ac after production via a fusion-evaporation reaction was made possible by using the redesigned SASSYER focal plane apparatus, including the addition of a pair of DSSDs and the multi-wire avalanche counter MACY. A number of transitions feeding the 29/2+ isomeric state corresponding to the ( ph49/2 )⊗(pii13/2) configuration were observed and tentatively assigned as decays from the high-spin 35/2 +, 39/2+, and 41/2+ states. Additionally, the decay from the low-lying 13/2+ state, corresponding to a pii13/2 quasiparticle excitation, was observed at 859 keV. This excitation energy is consistent with the systematics of the lighter N = 126 isotones suggesting a decrease in the energy gap between the pih9/2 and pi i13/2 orbitals. High-resolution (p,t) spectroscopy of the stable, even-even Palladium isotopes was performed in the search for signatures of quantum phase transitional behavior. A total of 54 previously unidentified 0+, 2 +, and 4+ states below an excitation energy of 3.5 MeV were discovered in this experiment. No enhancement of the 0+ level density, a signature of first-order phase transitions in nuclei, was observed in the studied isotopes. A theoretical description of the population strengths of excited 0+ states in two-nucleon transfer reactions was investigated within the framework of the IBM. These studies reveal that an enhanced population strength is not exclusive to regions of shape-coexistence but rather is a measure of the magnitude of the "change of structure" from the initial to residual nucleus.

  7. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. Simultaneous Separation of Actinium and Radium Isotopes from a Proton Irradiated Thorium Matrix.

    Science.gov (United States)

    Mastren, Tara; Radchenko, Valery; Owens, Allison; Copping, Roy; Boll, Rose; Griswold, Justin R; Mirzadeh, Saed; Wyant, Lance E; Brugh, Mark; Engle, Jonathan W; Nortier, Francois M; Birnbaum, Eva R; John, Kevin D; Fassbender, Michael E

    2017-08-15

    A new method has been developed for the isolation of (223,224,225)Ra, in high yield and purity, from a proton irradiated (232)Th matrix. Herein we report an all-aqueous process using multiple solid-supported adsorption steps including a citrate chelation method developed to remove >99.9% of the barium contaminants by activity from the final radium product. A procedure involving the use of three columns in succession was developed, and the separation of (223,224,225)Ra from the thorium matrix was obtained with an overall recovery yield of 91 ± 3%, average radiochemical purity of 99.9%, and production yields that correspond to physical yields based on previously measured excitation functions.

  9. The release of dissolved actinium to the ocean: A global comparison of different end-members

    Science.gov (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.

    2008-01-01

    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry]. Another potential mechanism of producing deviations in 227Ac/228Ra and daughter isotope ratios from the expected production value of lithogenic material is observed at reducing environments, where enrichment in uranium may occur. The presented data here may serve as a reference for including 227Ac in circulation models, and the overview provides values for some end-members that contribute to the global Ac distribution. ?? 2007 Elsevier B.V. All rights reserved.

  10. Thorium-230 ages of corals and duration of the last interglacial sea-level high stand on Aohu, Hawaii

    Science.gov (United States)

    Szabo, B. J.; Ludwig, K. R.; Muhs, D.R.; Simmons, K.R.

    1994-01-01

    Thorium-230 ages of emergent marine deposits on Oahu, Hawaii, have a uniform distribution of ages from ~114,000 to ~131,000 years, indicating a duration for the last interglacial sea-level high stand of ~17,000 years, in contrast to a duration of ~8000 years inferred from the orbitally tuned marine oxygen isotope record. Sea level on Oahu rose to ??? 1 to 2 meters higher than present by 131,000 years ago or ~6000 years earlier than inferred from the marine record. Although the latter record suggests a shift back to glacial conditions beginning at ~119,000 years ago, the Oahu coral ages indicate a near present sea level until ~114,000 years ago.

  11. Experimental kinetic study of oxidation of uranium monocarbide powders under controlled oxygen partial pressures below 230 °C

    Science.gov (United States)

    Berthinier, C.; Rado, C.; Dugne, O.; Cabie, M.; Chatillon, C.; Boichot, R.; Blanquet, E.

    2013-01-01

    Uranium monocarbide (UC) powders are known to be easily oxidised by gas mixtures containing oxygen. In this study, the oxidation of UC micron powders was followed by isothermal thermogravimetry at temperatures ranging from 100 °C to 230 °C in two different gas mixtures: synthetic air and 97%N2 + 3%O2. X-ray diffraction tests conducted on powders after their oxidation showed that small crystallites of UO2 oxide are formed. Furthermore, an analysis of mass gain showed that the carbon initially linked with the uranium is not oxidised but retained in oxide layers. Additionally, this kinetic study revealed that the rate-limiting step mechanism governing the oxidation of UC powders is a diffusive process that follows the Arrhenius law regarding temperature. Finally, it was discovered that cracks occur in grains once a given fractional conversion has been reached, inducing a major increase in the volume of grains.

  12. Experimental kinetic study of oxidation of uranium monocarbide powders under controlled oxygen partial pressures below 230 Degree-Sign C

    Energy Technology Data Exchange (ETDEWEB)

    Berthinier, C., E-mail: clement.berthinier@hotmail.fr [CEA Marcoule, DEN/DTEC/SDTC/LTAP, Bat 57, BP 17171, 30207 Bagnols-sur-Ceze Cedex (France); Rado, C. [CEA Marcoule, DEN/DTEC/SDTC/LTAP, Bat 57, BP 17171, 30207 Bagnols-sur-Ceze Cedex (France); Dugne, O. [CEA Marcoule, DEN/DTEC/SGCS/LMAC, Bat 109, 30207 Bagnols-sur-Ceze Cedex (France); Cabie, M. [CP2M, Aix-Marseille University, Avenue Escadrille Normandie Niemen, 13397 Marseille Cedex 20 (France); Chatillon, C.; Boichot, R.; Blanquet, E. [SIMaP, Grenoble INP, UJF, CNRS, 1130 rue de la Piscine, 38402 Saint Martin D' Heres (France)

    2013-01-15

    Uranium monocarbide (UC) powders are known to be easily oxidised by gas mixtures containing oxygen. In this study, the oxidation of UC micron powders was followed by isothermal thermogravimetry at temperatures ranging from 100 Degree-Sign C to 230 Degree-Sign C in two different gas mixtures: synthetic air and 97%N{sub 2} + 3%O{sub 2}. X-ray diffraction tests conducted on powders after their oxidation showed that small crystallites of UO{sub 2} oxide are formed. Furthermore, an analysis of mass gain showed that the carbon initially linked with the uranium is not oxidised but retained in oxide layers. Additionally, this kinetic study revealed that the rate-limiting step mechanism governing the oxidation of UC powders is a diffusive process that follows the Arrhenius law regarding temperature. Finally, it was discovered that cracks occur in grains once a given fractional conversion has been reached, inducing a major increase in the volume of grains.

  13. Design, manufacture, test and delivery of a 230 kV extruded irradiated crosslinked polyethylene cable. Final report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1978-01-01

    A project was initiated to develop a 230 kV solid dielectric cable for use in underground transmission. The dielectric is to be polyethylene, crosslinked by electron bombardment. Compared to the more conventional chemically crosslinked polyethylene, the irradiated cable is expected to contain less sensitive defects and thus be more suitable for a 230 kV rating. A toroidally shaped diode was developed to provide a uniform radiation dose to a thick-walled coaxial cable. The diode is to receive an output wave form obtained by ringing a Marx generator into a peaking capacitor. Initial evaluation of the toroidal diode was performed on thin plaques and tapes of insulating and semi-conducting polyethylene polymers. Additionally, some miscellaneous ethylene plastics were briefly investigated. Using a 4.8 MV Van de Graaff pulse generator in conjunction with several diode configurations, 15 to 35 kV extruded HMW-PE cables were irradiated. Dose rate, temperature, and pressure effects were evaluated. It was found that with limited dose rate it was possible to produce excellent crosslink density and uniformity at room temperature and atmospheric pressure. A subsequent 60 Hz voltage endurance test on an irradiated cable sample indicated it had long term, high stress capability. An engineering study conducted to determine an acceptable irradiator system design is reported. It was estimated that a 7 MV peak voltage at a rate of 2 to 3 pulse/sec can be provided by a Marx generator/peaking capacitor and should be capable of crosslinking a polyethylene wall thickness of approximately 2.5 cm. Based on the accumulated test results and on the performance of the 7 MV irradiator predicted, it appears feasible to continue the work effort into the next scheduled phase.

  14. Rapid evolution of ritual architecture in central Polynesia indicated by precise 230Th/U coral dating.

    Science.gov (United States)

    Sharp, Warren D; Kahn, Jennifer G; Polito, Christina M; Kirch, Patrick V

    2010-07-27

    In Polynesia, the complex Society Islands chiefdoms constructed elaborate temples (marae), some of which reached monumental proportions and were associated with human sacrifice in the 'Oro cult. We investigated the development of temples on Mo'orea Island by 230Th/U dating of corals used as architectural elements (facing veneers, cut-and-dressed blocks, and offerings). The three largest coastal marae (associated with the highest-ranked chiefly lineages) and 19 marae in the inland 'Opunohu Valley containing coral architectural elements were dated. Fifteen corals from the coastal temples meet geochemical criteria for accurate 230Th/U dating, yield reproducible ages for each marae, and have a mean uncertainty of 9 y (2sigma). Of 41 corals from wetter inland sites, 12 show some diagenesis and may yield unreliable ages; however, the majority (32) of inland dates are considered accurate. We also obtained six 14C dates on charcoal from four marae. The dates indicate that temple architecture on Mo'orea Island developed rapidly over a period of approximately 140 y (ca. AD 1620-1760), with the largest coastal temples constructed immediately before initial European contact (AD 1767). The result of a seriation of architectural features corresponds closely with this chronology. Acropora coral veneers were superceded by cut-and-dressed Porites coral blocks on altar platforms, followed by development of multitier stepped altar platforms and use of pecked basalt stones associated with the late 'Oro cult. This example demonstrates that elaboration of ritual architecture in complex societies may be surprisingly rapid.

  15. Holmium laser enucleation of the prostate: initial report of the first 230 Egyptian cases performed in a single center.

    Science.gov (United States)

    Abdel-Hakim, Amr M; Habib, Enmar I; El-Feel, Ahmed S; Elbaz, Ahmed G; Fayad, Amr M; Abdel-Hakim, Mahmoud A; Meshref, Alaa W

    2010-08-01

    To report our experience with the first 230 cases of holmium laser enucleation of the prostate (HoLEP) performed in a single center. A total of 230 cases of HoLEP were performed between June 2007 and June 2008. Mean age of patients was 69.8 +/- 10.3 years, and 21.3% of patients were either on anticoagulant or antiplatelet treatment. There was no limit for prostate size, with a mean prostate size of 86.5 +/- 65.4 g (range: 20-350 g). Follow-up was performed regularly at 1, 3, 6, and 12 months, assessing the Q(max), PVR, and International Prostate Symptom Score. Weight of prostate chips retrieved after morcellation was 78.6 +/- 61.3 g (range: 10-350), with enucleation time 102.2 +/- 55.4 minutes and morcellation time 19.3 +/- 10.1 minutes, leading an estimated efficiency rate of 0.64 g/min. The rate of decrease in prostate volume and prostate-specific antigen was 90.8% and 82.5%, respectively. At 1 month, mean Q(max) increased from 7.7 +/- 2.3 to 25.8 +/- 10.1 mL/s (P Kegel exercises, respectively. Only 1 patient with pancytopenia required blood transfusion and there was no case for transurethral resection syndrome. HoLEP is a safe and an effective modern modality for the treatment of symptomatic BPH regardless of the gland size, with satisfactory clinical outcome. Copyright 2010 Elsevier Inc. All rights reserved.

  16. 17 CFR 230.151A - Certain contracts not “annuity contracts” or “optional annuity contracts” under section 3(a)(8).

    Science.gov (United States)

    2010-04-01

    ... the contract are calculated at or after the end of one or more specified crediting periods, in whole or in part, by reference to the performance during the crediting period or periods of a security... investment experience of a separate account. Effective Date Note: At 74 FR 3175, Jan. 16, 2009, § 230.151A...

  17. Transient-Liquid-Phase Bonding of H230 Ni-Based Alloy Using Ni-P Interlayer: Microstructure and Mechanical Properties

    Science.gov (United States)

    Kapoor, Monica; Doğan, Ömer N.; Carney, Casey S.; Saranam, Rajesh V.; McNeff, Patrick; Paul, Brian K.

    2017-07-01

    Transient-liquid-phase bonding using Ni-P as an interlayer has been developed for H230 Ni-Cr-W solid-solution-strengthened Ni-based alloy. Two process parameters—composition of the interlayer and bonding time—have been varied to optimize the mechanical properties. H230 has been bonded into two sets of stacks (set I and II) for 8 and 4 hours using Ni-12P and Ni-6P interlayer, respectively, (wt pct) at 1423 K (1150 °C) and 12.7 MPa. The microstructure of both the stacks has three distinct regions—the joint centerline which showed the presence of pores, an isothermally solidified zone (ISZ) which did not have any carbide precipitates and base H230. Transmission electron microscopy and atom probe tomography showed a uniform microstructure, and an absence of any deleterious phases at the joint and in ISZ. Set I and set II had a yield strength of 76 and 86 pct of that of the H230 sheet, tested at 1023 K (750 °C). The measured elongation at fracture was negligible, but the fracture surfaces revealed a ductile cup-and-cone-type fracture occurring through the ISZ/joint region. Examination of broken tensile samples revealed that the plastic strain was constrained to within one joint region through which fracture occurred.

  18. 78 FR 68467 - Notice of Availability of the Record of Decision for the Gateway West 230/345/500-kV Transmission...

    Science.gov (United States)

    2013-11-14

    ... Bureau of Land Management Notice of Availability of the Record of Decision for the Gateway West 230/345... construct, operate, maintain, and decommission electric transmission lines on public lands for the Gateway... electronically on the following Web site: http://www.wy.blm.gov/nepa/cfodocs/gateway_west/ . To request a copy...

  19. The prevalence of ABCB1:c.227_230delATAG mutation in affected dog breeds from European countries.

    Science.gov (United States)

    Firdova, Zuzana; Turnova, Evelina; Bielikova, Marcela; Turna, Jan; Dudas, Andrej

    2016-06-01

    Deletion of 4-base pairs in the canine ABCB1 (MDR1) gene, responsible for encoding P-glycoprotein, leads to nonsense frame-shift mutation, which causes hypersensitivity to macrocyclic lactones drugs (e.g. ivermectin). To date, at least 12 purebred dog breeds have been found to be affected by this mutation. The aim of this study was to update information about the prevalence of ABCB1 mutation (c.227_230delATAG) in predisposed breeds in multiple European countries. This large scale survey also includes countries which were not involved in previous studies. The samples were collected in the period from 2012 to 2014. The overview is based on genotyping data of 4729 individuals. The observed mutant allele frequencies were 58.5% (Smooth Collie), 48.3% (Rough Collie), 35% (Australian Shepherd), 30.3% (Shetland Sheepdog), 28.1% (Silken Windhound), 26.1% (Miniature Australian Shepherd), 24.3% (Longhaired Whippet), 16.2% (White Swiss Shepherd) and 0% (Border Collie). The possible presence of an ABCB1 mutant allele in Akita-Inu breed has been investigated with negative results. This information could be helpful for breeders in optimization of their breeding strategy and for veterinarians when prescribing drug therapy for dogs of predisposed breeds. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. A Retrospective Evaluation of Epidemiological, Clinical and Laboratory Features of Brucellosis in 230 Patients in Hamadan, Iran: A Brief Report

    Directory of Open Access Journals (Sweden)

    AR Mobaien

    2012-05-01

    Full Text Available Background: Brucellosis is one of the most common infectious diseases in Iran with very different clinical manifestations. Methods: In this retrospective descriptive study, all patients with brucellosis, who were admitted in Farshchian Hospital in Hamadan, Iran in 2005 to 2010, were enrolled in the study. The data were collected from the patients' medical records and were entered in forms for analysis. Results: A total of 230 patients with brucellosis, including 130 (56.5% male and 100 (43.5% female patients with a mean age of 40.84±20.29 years, who mostly (72.2% lived in rural areas were enrolled in the study. Outbreaks were most common in spring and summer and the main route of transmission was consumption of contaminated dairy products (60.3%. The most common symptoms were fever (77.4%, arthralgia (70%, sweating (47%, malaise and fatigue (46.5%. Arthritis and epididymo- orchitis were seen in 121 (52.9% and 48 (8.20% patients, respectively. CBC analysis showed leukocytosis in 20.8% of the participants. ESR rise was noted in 59.5% of the patients and 52.9% had positive CRP. Conclusion: Given to various clinical presentations, brucellosis should be considered in the differential diagnosis of individuals with chronic fever with or without other organ abnormalities.

  1. Evaluation of high specific-heat ceramic for regenerator use at temperatures between 2-30 K

    Science.gov (United States)

    Lawless, W. N.

    1979-01-01

    Specific heat, thermal conductivity (both in the range 2-30 K), and microhardness data were measured on the ceramics labelled LS-8, LS-8A, and LS-8A doped with CsI, SnCl2, and AgCl. A work hardened sample of LS-8A was also studied in an effort to determine the feasibility of using these types of LS-8 materials to replace Pb spheres in the regenerator of the JPL cryocooler. The LS-8A materials are all more than an order of magnitude harder than Pb, and the dopants do not significantly improve the hardness. However, the SnCl2 dopant has a remarkable effect in improving the specific heat and thermal conductivity of LS-8A. The SnCl2 doping level which maximized the regenerator enthalpy change in going from an unloaded to a loaded condition was found to be 0.2 percent SnCl2 in LS-8A. It was also found that the enthalpy change for a regenerator employing the LS-8A material is more than three times larger than for the Pb spheres case. The use of rods, rather than spheres, of optimally doped LS-8A in regenerators is discussed.

  2. The effect of glass composition on the experimental hydration of obsidian between 110 and 230{degree}C

    Energy Technology Data Exchange (ETDEWEB)

    Mazer, J.J.; Bates, J.K. [Argonne National Lab., IL (United States); Stevenson, C.M. [Archeological Service Consultants, Columbus, OH (United States); Bradley, J.P. [McCrone Associates, Inc., Westmont, IL (United States)

    1991-12-01

    Chemically characterized high-silica natural glasses were reacted in water vapor atmospheres at 100% relative humidity at temperatures between 110 and 230{degrees}C for up to 400 days. Birefringent hydration layers formed on the glass surfaces and increased in thickness as a function of the square root of time for all glasses, under all experimental conditions, a dependence consistent with a molecular water diffusion reaction mechanism. AEM, SIMS, FTIR and optical microscopy analyses of the birefringent hydration layers further support a molecular water diffusion reaction mechanism. The rate of hydration and its temperature dependence can be quantitatively related to the logarithm of the intrinsic water content of the unreacted glass. This quantification of the process permits estimates of water diffusion coefficients in rhyolitic glasses as a function of temperature and is statistically more precise than previously proposed indices for predicting water diffusion in obsidian. These results may allow obsidian hydration dating to gain more widespread acceptance as an absolute dating technique.

  3. ATR-FT-IR spectroscopy in the region of 550-230 cm -1 for identification of inorganic pigments

    Science.gov (United States)

    Vahur, Signe; Teearu, Anu; Leito, Ivo

    2010-03-01

    A comprehensive study of ATR-FT-IR spectra of 40 inorganic pigments of different colours widely used in historical paintings has been carried out in the low wave number spectral range (550-230 cm -1). The infrared spectra were recorded from mixtures of pigment and linseed oil. It is demonstrated that this spectral range - essentially devoid of absorption peaks of the common binder materials - can be well used for identification of inorganic pigments in paint samples thereby markedly extending the possibilities of pigment identification/confirmation by ATR-IR spectroscopy into the realm of pigments having no absorptions in the mid-IR region. In some cases the method can be used alone for pigment identification and in many cases it provides useful additional evidence for pigment identification using other instrumental techniques (electron microprobe analysis, XRF, optical microscopy). Together with earlier work this study provides a comprehensive overview of the pigment identification possibilities using ATR-FT-IR as well as a collection of reference spectra and is expected to be a useful reference for conservation practitioners.

  4. Studies on a microbial exopolysaccharide produced by Brevibacterium viscogenes 74-230 as a drilling mud additive

    Energy Technology Data Exchange (ETDEWEB)

    Wang, X.; (Inst. of Microbiology, Beijing, China); Cui, W.; Liu, X.; Zhang, K.; Liu, Y.; Li, L.

    1982-10-01

    A new drilling mud additive produced as a microbial exopolysaccharide by Brevibacterium viscogenes 74-230 from a heavy liquid paraffin is discussed. Addition of the surfactants of Tweens or Span-80 to the medium can promote polysaccharide biosynthesis, but penicillin G and potassium ion has no advantageous effects on it. Corn steep liquor can be used as a substitute of yeast extract, but with poorer results. After removal of cells by centrifugation, over 12g/l of polysaccharide can be obtained by ethanol precipitation, at a conversion rate based on liquid paraffin in excess of 40%. Its rheological property, shear thinning effect, water loss, sensitivity to salts as well to as temperature, etc. are determined and compared with xanthan, partially hydrolysis polyacrylamide and carboxylmethylcellulose. The results indicate that the properties of this polysaccharide as a drilling mud additive are almost comparable with those of xanthan, and far better than those of the other two. It is noteworthy that this polysaccharide is produced from crude oil or its product, while xanthan is from carbohydrate. Field experiments are still going on.

  5. An approach to the development of interstitial lung disease in dermatomyositis: a study of 230 cases in China.

    Science.gov (United States)

    Wu, Hao; Geng, Daoying; Xu, Jinhua

    2013-04-01

    : To study the clinical features of interstitial lung disease (ILD) in patients with dermatomyositis and factors related to its development. : Clinical records for patients with dermatomyositis were reviewed retrospectively. : Records were analysed for 230 patients (mean follow-up period, 18 months). The prevalence of ILD was 49.6%. The presence of ILD correlated positively with the presence of arthralgia, myoasthenia and cough, but negatively with the presence of Gottron's papules. Patients with ILD had poorer pulmonary function and more frequent positivity for anti-Jo1 antibodies than those without ILD. Patients with ILD characteristically showed linear, patchy, ground-glass opacities and reticular computed tomography (CT) patterns, usually at the bottom or apex of the lung. : Dermatomyositis patients presenting with heliotrope rash, arthralgia, myoasthenia, cough, dysphagia, anti-Jo1 positivity or abnormal lung function were more likely, whereas those presenting with Gottron's papules were less likely, to develop ILD. Characteristic CT patterns in dermatomyositis patients with ILD were lines, patches, ground-glass opacities and reticulation.

  6. Indirect Determination of the 230Th(n,f) and 231Th(n,f) Cross Sections for Thorium-Based Nuclear Energy Systems

    Energy Technology Data Exchange (ETDEWEB)

    Stroberg, S.R.; Allmond, J.M.; Angell, C.; Bernstein, L.A.; Bleuel, D.L.; Burke, J.T.; Gibelin, J.; Phair, L.; Scielzo, N.D.; Swanberg, E.; Wiedeking, M.; Norman, E.B.; Goldblum, Bethany

    2009-09-11

    The Surrogate Ratio Method (SRM) was employed in the first experimental determination of the 231Th(n,f) cross section, relative to the 235U(n,f) cross section, over an equivalent neutron energy range of 360 keV to 10 MeV. The 230Th(n,f) cross section was also deduced using the SRM, relative to the 234U(n,f) cross section, over an equivalent neutron energy range of 220 keV to 25 MeV. The desired compound nuclei were populated using (3He,3He) and (3He) reactions on targets of 232Th and 236U and relative fission decay probabilities were measured. The surrogate 230,231Th(n,f) cross sections were compared to cross section evaluations and directly-measured experimental data, where available.

  7. Esercizio dell’attività di impresa in forma societaria e disciplina di cui all’art. 230-bis c.c.: sull’asserita incompatibilità

    Directory of Open Access Journals (Sweden)

    Luigi Balestra

    2015-01-01

    Full Text Available Le Sezioni Unite (Cass., sez un., 6 novembre 2014, n. 23676 Rel. Bernabai già segnalata in questa Rivista hanno risolto il conflitto, profilatosi innanzi alla Sezione lavoro agli inizi del nuovo millennio, in ordine alla portata applicativa dell’art. 230-bis c.c., essendo state chiamate a stabilire se la fattispecie compendiata dalla norma in questione presupponga necessariamente un imprenditore persona fisica – elemento per vero non enunciato esplicitamente dalla disposizione, ma ricavabile dal comma 3 dell’art. 230-bis c.c. ove v’è il riferimento a un vincolo (di coniugio, parentela o affinità configurabile solo tra persone fisiche – o se, invece, sia prospettabile anche quando l’attività di impresa venga svolta in forma societaria.

  8. Finding of No Significant Impact: Repair and Renovate Airborne Warning and Control System Maintenance Group Complex, Building 230 Tinker Air Force Base Oklahoma City, Oklahoma

    Science.gov (United States)

    2012-02-01

    personnel, of which 1,800 work in maintenance operations. The majority of maintenance operations for the E-3 Sentry , an AWACS aircraft, is conducted in B230...which publishes regulations for air quality and permitting for all counties in Oklahoma, has jurisdiction over and regulates air emissions...sites, 3 sites are within the jurisdiction of EPA Region 6 and managed under CERCLA, and 13 sites are under the jurisdiction of the DEQ and managed

  9. A New Approach to Suppress the Effect of Machining Error for Waveguide Septum Circular Polarizer at 230 GHz Band in Radio Astronomy

    Science.gov (United States)

    Hasegawa, Yutaka; Harada, Ryohei; Tokuda, Kazuki; Kimura, Kimihiro; Ogawa, Hideo; Onishi, Toshikazu; Nishimura, Atsushi; Han, Johnson; Inoue, Makoto

    2017-05-01

    A new stepped septum-type waveguide circular polarizer (SST-CP) was developed to operate in the 230 GHz band for radio astronomy, especially submillimeter-band VLBI observations. For previously reported SST-CP models, the 230 GHz band is too high to achieve the design characteristics in manufactured devices because of unexpected machining errors. To realize a functional SST-CP that can operate in the submillimeter band, a new method was developed, in which the division surface is shifted from the top step of the septum to the second step from the top, and we simulated the expected machining error. The SST-CP using this method can compensate for specified machining errors and suppress serious deterioration. To verify the proposed method, several test pieces were manufactured, and their characteristics were measured using a VNA. These results indicated that the insertion losses were approximately 0.75 dB, and the input return losses and the crosstalk of the left- and right-hand circular polarization were greater than 20 dB at 220-245 GHz on 300 K. Moreover, a 230 GHz SST-CP was developed by the proposed method and installed in a 1.85-m radio telescope receiver systems, and then had used for scientific observations during one observation season without any problems. These achievements demonstrate the successful development of a 230 GHz SST-CP for radio astronomical observations. Furthermore, the proposed method can be applicable for observations in higher frequency bands, such as 345 GHz.

  10. A Large Drop in Atmospheric 14C/12C and Reduced Melting in the Younger Dryas, Documented with 230Th Ages of Corals.

    Science.gov (United States)

    Edwards, R L; Beck, J W; Burr, G S; Donahue, D J; Chappell, J M; Bloom, A L; Druffel, E R; Taylor, F W

    1993-05-14

    Paired carbon-14 ((14)C) and thorium-230((230)Th) ages were determined on fossil corals from the Huon Peninsula, Papua New Guinea. The ages were used to calibrate part of the (14)C time scale and to estimate rates of sea-level rise during the last deglaciation. An abrupt offset between the (14)C and (230)Th ages suggests that the atmospheric (14)C/(12)C ratio dropped by 15 percent during the latter part of and after the Younger Dryas (YD). This prominent drop coincides with greatly reduced rates of sea-level rise. Reduction of melting because of cooler conditions during the YD may have caused an increase in the rate of ocean ventilation, which caused the atmospheric (14)C/(12)C ratio to fall. The record of sea-level rise also shows that globally averaged rates of melting were relatively high at the beginning of the YD. Thus, these measurements satisfy one of the conditions required by the hypothesis that the diversion of meltwater from the Mississippi to the St. Lawrence River triggered the YD event.

  11. Long-Term Slip Rate on the Southern San Andreas Fault Determined by Th-230/U Dating of Pedogenic Carbonate.

    Science.gov (United States)

    Fletcher, K. E.; Johnson, G.; Kendrick, K. J.; Hudnut, K. W.; Sharp, W. D.

    2006-12-01

    Determinations of long-term slip rates are limited, in part, by our ability to accurately estimate the age of offset landforms. U-series dating on pedogenic carbonate provides a relatively novel way of dating landforms, with strengths that complement more widely applied cosmogenic (CRN) techniques. We present new Th-230/U dates for pedogenic carbonate coatings on pebbles of the Biskra Palms fan, near Indio, California, which is offset by the southern San Andreas fault. Small, carefully chosen samples of dense pedogenic carbonate analyzed by mass spectrometry, have 3-10 ppm uranium and low common thorium (Th-232), making them highly favorable for U-series dating. Only minor corrections for initial Th-230 are necessary, and are made using Th-232 as an index isotope with propagation of uncertainties. Samples of early-formed carbonate collected from depths of about 2 m in fan soils typically consist of dense coatings 200-500 microns thick. Such coatings from 6 pebbles from 3 different locations within the fan yield apparent ages between 30 ± 2 ka and 46 ± 2 ka (all errors 2 sigma), with a median age of 38.4 ka (n= 11). Each age averages over the sampled interval of coating growth, hence the spread of ages reflects clast-to-clast variation in coating accumulation rates. All ages are therefore minimum ages for the stabilization of the fan because the time lag between stabilization and carbonate pedogenesis at Biskra Palms is, as yet, unknown. Sub-samples of individual clast-coatings yield ages in good agreement-- e.g., 45.0 ± 0.8 ka, 46.0 ± 1.8 ka, 44.8 ± 1.0 ka, 45.7 ± 0.9 ka (MSWD = 0.88), demonstrating closed U-Th systems. Van der Woerd et al (2006) reported an average CRN age of 35.5 ± 2.5 ka for the fan surface and an offset of 565 ± 80 m, for a slip rate of 15.9 ± 3.4 mm/a. Using their offset, and our oldest mean age of 45.3 ± 0.5 Ma (n=4, ages above) as the minimum landform age, we estimate a maximum slip rate of 12.5 ± 1.8 mm/a. This maximum average

  12. Observational demonstration of a high image rejection SIS mixer receiver using a new waveguide filter at 230 GHz

    Science.gov (United States)

    Hasegawa, Yutaka; Asayama, Shinichiro; Harada, Ryohei; Tokuda, Kazuki; Kimura, Kimihiro; Ogawa, Hideo; Onishi, Toshikazu

    2017-12-01

    A new sideband separation method was developed for use in millimeter-/submillimeter-band radio receivers using a novel waveguide frequency separation filter (FSF), which consists of two branch line hybrid couplers and two waveguide high-pass filters. The FSF was designed to allow the radio frequency (RF) signal to pass through to an output port when the frequency is higher than a certain value (225 GHz), and to reflect the RF signal back to another output port when the frequency is lower. The FSF is connected to two double sideband superconductor-insulator-superconductor (SIS) mixers, and an image rejection ratio (IRR) is determined by the FSF characteristics. With this new sideband separation method, we can achieve good and stable IRR without the balancing two SIS mixers such as is necessary for conventional sideband-separating SIS mixers. To demonstrate the applicability of this method, we designed and developed an FSF for simultaneous observations of the J = 2-1 rotational transition lines of three CO isotopes (12CO, 13CO, and C18O): the 12CO line is in the upper sideband and the others are in the lower sideband with an intermediate-frequency range of 4-8 GHz at the radio frequency of 220/230 GHz. This FSF was then installed in the receiver system of the 1.85 m radio telescope of Osaka Prefecture University, and was used during the 2014 observation season. The observation results indicate that the IRR of the proposed receiver is 25 dB or higher for the 12CO line, and no significant fluctuation larger than 1 dB in the IRR was observed throughout the season. These results demonstrate the practical utility of the FSF receiver for observations like extensive molecular cloud surveys in specified lines with a fixed frequency setting.

  13. Energy balance, macronutrient intake, and hydration status during a 1,230 km ultra-endurance bike marathon.

    Science.gov (United States)

    Geesmann, Bjoern; Mester, Joachim; Koehler, Karsten

    2014-10-01

    Athletes competing in ultra-endurance events are advised to meet energy requirements, to supply appropriate amounts of carbohydrates (CHO), and to be adequately hydrated before and during exercise. In practice, these recommendations may not be followed because of satiety, gastrointestinal discomfort, and fatigue. The purpose of the study was to assess energy balance, macronutrient intake and hydration status before and during a 1,230-km bike marathon. A group of 14 well-trained participants (VO2max: 63.2 ± 3.3 ml/kg/min) completed the marathon after 42:47 hr. Ad libitum food and fluid intake were monitored throughout the event. Energy expenditure (EE) was derived from power output and urine and blood markers were collected before the start, after 310, 618, and 921 km, after the finish, and 12 hr after the finish. Energy intake (EI; 19,749 ± 4,502 kcal) was lower than EE (25,303 ± 2,436 kcal) in 12 of 14 athletes. EI and CHO intake (average: 57.1 ± 17.7 g/hr) decreased significantly after km 618 (p Hydration appeared suboptimal before the start (urine specific gravity: 1.022 ± 0.010 g/ml) but did not change significantly throughout the event. The results show that participants failed to maintain in energy balance and that CHO and fluid intake dropped below recommended values during the second half of the bike marathon. Individual strategies to overcome satiety and fatigue may be necessary to improve eating and drinking behavior during prolonged ultra-endurance exercise.

  14. ORIGINAL ARTICLE 230

    African Journals Online (AJOL)

    boaz

    plasmodium cause malaria infection in humans. These are Plasmodium falciparume, P. vivax, P malariae and P. ovale. P. falciparum (4)andis responsible for most deaths and most of the severe complications (5), including cerebral malaria, anemia and renal failure (6). Malaria disease generally has severe devastating.

  15. Influence of soil texture on the distribution and availability of {sup 238}U, {sup 230}Th, and {sup 226}Ra in soils

    Energy Technology Data Exchange (ETDEWEB)

    Blanco Rodriguez, P. [Departamento de Fisica, Facultad de Ciencias, Universidad de Extremadura, Avd. Elvas s/n, 06071 Badajoz (Spain); Vera Tome, F. [Departamento de Fisica Aplicada, Facultad de Ciencias, Universidad de Extremadura, Avd. Elvas s/n, 06071 Badajoz (Spain)], E-mail: fvt@unex.es; Lozano, J.C. [Laboratorio de Radiactividad Ambiental, Facultad de Ciencias, Universidad de Salamanca, 37008 Salamanca (Spain); Perez-Fernandez, M.A. [Area de Ecologia, Universidad Pablo Olavide, Carretera de Utrera km. 1, 41013 Sevilla (Spain)

    2008-08-15

    The influence of soil texture on the distribution and availability of {sup 238}U, {sup 230}Th, and {sup 226}Ra in soils was studied in soil samples collected at a rehabilitated uranium mine located in the Extremadura region in south-west Spain. The activity concentration (Bq kg{sup -1}) in the soils ranged from 60 to 750 for {sup 238}U, from 60 to 260 for {sup 230}Th, and from 70 to 330 for {sup 226}Ra. The radionuclide distribution was determined in three soil fractions: coarse sand (0.5-2 mm), medium-fine sand (0.067-0.5 mm), and silt and clay (<0.067 mm). The relative mobility of the natural radionuclides in the different fractions was studied by comparison of the activity ratios between radionuclides belonging to the same radioactive series. The lability of these radionuclides in each fraction was also studied through selective extraction from the soils using a one-step sequential extraction scheme. Significant correlations were found for {sup 238}U, {sup 230}Th, and {sup 226}Ra between the activity concentration per fraction and the total activity concentration in the bulk soil. Thus, from the determination of the activity concentration in the bulk soil, one could estimate the activity concentration in each fraction. Correlations were also found for {sup 238}U and {sup 226}Ra between the labile activity concentration in each fraction and the total activity concentration in bulk soil. Assuming that there is some particle-size fraction that predominates in the process of soil-to-plant transfer, the parameters obtained in this study should be used as correction factors for the transfer factors determined from the bulk soil in previous studies.

  16. The metrological activity determination of {sup 238} U and {sup 230} Th by gamma spectrometry to industrial fuel-cycle application

    Energy Technology Data Exchange (ETDEWEB)

    Almeida M, M.C. de; Delgado, J.U.; Poledna, R. [Instituto de Radioprotecao e Dosimetria- IRD/SEMRA, CNEN, Av. Salvador Allende s/n, Recreio, CEP 22780-160, Rio de Janeiro (Brazil)]. e-mail: marcandida@yahoo.com.br

    2006-07-01

    This work describes the difficulty for determining the activity of {sup 238} U and {sup 230} Th using gamma spectrometry due to the low gamma-ray emission probabilities of 92 and 67 keV, and, mainly, the associated high uncertainties about 13 and 11%, respectively. {sup 230} Th is a {sup 238} U daughter and it is product from uranium mills and refineries. {sup 230} Th decays to {sup 226} Ra and this decay has to be measured because these radionuclides are not in secular equilibrium with their daughter products, besides the gamma-energies have high uncertainties in the emission probabilities. These radionuclides, mostly {sup 238} U, are important in the nuclear fuel-cycle, since the mining of uranium ore, where the nominal isotopic content of natural uranium is 99.27% of {sup 238} U, until the irradiated fuel reprocessing, where this isotope, a fertile material, is recovered to be used again. The uranium and thorium are considered safeguarded nuclear materials and the metrology tries to calibrate and standardize these materials to improve the activity determination techniques applied in different fuel-cycle scopes. The essential characteristics of the safeguarded materials are low gamma energies (less than 100 keV) and emission probabilities but with high uncertainties. In this way, the metrology can contribute to homeland security defense against illicit nuclear trafficking with the identification and quantification of the safeguarded radionuclides such as uranium and thorium, using specific gamma window energy and high resolution planar or coaxial germanium detector. The efficiency curve is obtained from the reference source spectrum considering the photopeak areas corresponding the standard activities. This curve depends on radiation energy, sample geometry, photon attenuation (sample absorption and material absorption between sample-detector), dead time and sample-detector position. The metrological activity determinations of {sup 238} U solid sources, and of

  17. Rate constants of nine C6-C9 alkanes with OH from 230 to 379 K: chemical tracers for [OH].

    Science.gov (United States)

    Sprengnether, Michele M; Demerjian, Kenneth L; Dransfield, Timothy J; Clarke, James S; Anderson, James G; Donahue, Neil M

    2009-04-30

    We report absolute rate-constant measurements for the reactions of nine C(6)-C(9) alkanes with OH in 8-10 torr of nitrogen from 230 to 379 K in the Harvard University High-Pressure Flow System. Hydroxyl concentrations were measured using laser-induced fluorescence, and alkane concentrations were measured using Fourier transform infrared Spectroscopy. Ethane's reactivity was simultaneously measured as a test of experimental performance. Results were fit to a modified Arrhenius equation based on transition state theory (ignoring tunneling), k(T) = Be(-E(a)/T)/(T(1 - e(- 1.44nu(1)/T))(2)(1 - e(- 1.44nu(2)/T)), with nu(1) and nu(2) bending frequencies, set to 280 and 500 cm(-1). Results were as follows for B (10(-9) K cm(3) s(-1)), E(a) (K), and k(298) (10(-12) cm(3) s(-1)): cyclohexane, 3.24 +/- 0.14, 332 +/- 12, 7.13; cyclo-octane, 3.47 +/- 0.30, 149 +/- 26, 14.1; 2-methylhexane, 1.45 +/- 0.08, 110 +/- 15, 6.72; 3-methylhexane, 1.50 +/- 0.08, 128 +/- 16, 6.54; methylcyclopentane, 1.65 +/- 0.07, 109 +/- 13, 7.65; methylcyclohexane, 1.86 +/- 0.09, 83 +/- 14, 9.43; methylcycloheptane, 3.45 +/- 0.45, 142 +/- 36, 14.4; n-propylcyclohexane, 2.83 +/- 0.14, 112 +/- 15, 13.0; isopropylcyclohexane, 1.79 +/- 0.11, -44 +/- 34, 13.9. Uncertainties are one sigma results from linear regression fits and are likely underestimated. Room temperature rate coefficients of reaction are accurate to within 10% at two sigma. A comprehensive fit to 17 separate studies including the present work for cyclohexane gives good agreement with the present results: terms as above, 3.09 +/- 0.12, 326 +/- 12, 6.96. Five of these compounds are routinely measured in urban air within a suite of atmospheric nonmethane hydrocarbons and reach parts per billion levels. The remaining four are C8-C9 cycloalkanes with low anthropogenic emissions. Because of their high, specific reactivity with OH, their concentration decays may be used as an indirect measurement of [OH] in the atmosphere or laboratory. This data

  18. Closure Report for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    D. S. Tobiason

    2001-07-01

    This Closure Report (CR) describes the remediation activities performed and the results of verification sampling conducted at Corrective Action Unit (CAU) 230, Area 22 Sewage Lagoons and CAU 320, Area 22 Desert Rock Airport Strainer Box. The CAU is currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO, 1996). The CAU is located in Area 22 of the Nevada Test Site (NTS) (Figure 1) and consists of the following Corrective Action Sites (CASs): 22-03-01- Sewage Lagoon (CAU 230); and 22-99-01- Strainer Box (CAU 320). Included with CAS 22-99-01 is a buried Imhoff tank and a sludge bed. These CAUs will be collectively referred to in this plan as the Area 22 Sewage Lagoons site. Site characterization activities were done during September 1999. Characterization of the manholes associated with the septic system leading to the Imhoff tank was done during March 2000. The results of the characterization presented in the Corrective Action Decision Document (CADD) indicated that only the sludge bed (CAS 22-99-01) contained constituents of concern (COC) above action levels and required remediation (U.S. Department of Energy, Nevada Operations Office [DOE/NV], 2000a).

  19. Corrosion behavior of Haynes {sup registered} 230 {sup registered} nickel-based super-alloys for integrated coal gasification combined cycle syngas plants. A plant exposure study

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Sungkyu; Lee, Jieun; Kang, Suk-Hwan; Lee, Seung-Jong; Yun, Yongseung [Institute for Advanced Engineering (IAE), Gyeonggi-do (Korea, Republic of). Plant Engineering Center; Kim, Min Jung [Sungkyunkwan Univ, Gyeonggi-do (Korea, Republic of). Advanced Materials Technology Research Center

    2015-07-01

    The corrosion behavior of commercially available Haynes {sup registered} 230 {sup registered} nickel-based alloy samples was investigated by exposure to coal-gasifying integrated coal gasification combined cycle pilot plant facilities affiliated with the Institute for Advanced Engineering (2.005 MPa and 160-300 C). The morphological and microstructural analyses of the exposed samples were conducted using scanning electron microscopy and energy-dispersive X-ray spectroscopy analysis on the external surface of the recovered corrosion test samples to obtain information of the corrosion scale. These analyses based on the pre- and post-exposure corrosion test samples combined with thermodynamic Ellingham-Pourbaix stability diagrams provided preliminary insight into the mechanism of the observed corrosion behavior prevailing in the piping materials that connected the particulate removal unit and water scrubber of the integrated coal gasification combined cycle pilot plant. Uniform material wastage was observed after 46 hours of operation, and a preliminary corrosion mechanism was suggested: the observed material waste and corrosion behavior of the Haynes {sup registered} 230 {sup registered} nickel-based alloy samples cut off from the coal syngas integrated coal gasification combined cycle plant were explained by the formation of discontinuous (complex) oxide phases and subsequent chlorine-induced active oxidation under the predominantly reducing environment encountered. This contribution continues the already published studies of the Fe-Ni-Cr-Co alloy Haynes {sup registered} 556 {sup registered}.

  20. Transfer of {sup 238}U, {sup 230}Th, {sup 226}Ra, and {sup 210}Pb from soils to tree and shrub species in a Mediterranean area

    Energy Technology Data Exchange (ETDEWEB)

    Blanco Rodriguez, P. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain); Vera Tome, F. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain)], E-mail: fvt@unex.es; Lozano, J.C. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain); Laboratorio de Radiaciones Ionizantes, Facultad de Ciencias, Universidad de Salamanca, 37008 Salamanca (Spain); Perez Fernandez, M.A. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain); Area de Ecologia, Universidad Pablo Olavide, Carretera de Utrera km. 1, 41013 Sevilla (Spain)

    2010-06-15

    The soil-to-plant transfer factors of natural uranium isotopes ({sup 238}U and {sup 234}U), {sup 230}Th, {sup 226}Ra, and {sup 210}Pb were studied in a disused uranium mine located in the Extremadura region in the south-west of Spain. The plant samples included trees (Quercus ilex, Quercus suber, and Eucalyptus cameldulensis) and one shrub (Cytisus multiflorus). All of them are characteristic of Mediterranean environments. The activity concentrations in leaves and fruit were determined for the tree species at different stages of growth. For the shrub, the total above-ground fraction was considered in three seasons. For old leaves and fruit, the highest activity concentrations were found in Eucalyptus cameldulensis for all the radionuclides studied, except in the case of {sup 230}Th that presented similar activity concentrations in all of the tree species studied. In every case, the transfer to fruit was less than the transfer to leaves. In the shrub, the results depended on the season of sampling, with the highest value obtained in spring and the lowest in autumn. Important correlations were obtained for {sup 238}U and {sup 226}Ra between the activity ratio in soils with that in leaves or fruit.

  1. Micromachining and validation of the scanning acoustic microscope spatial resolution and sensitivity calibration block for 20-230 MHz frequency range.

    Science.gov (United States)

    Tamulevičius, Tomas; Šimatonis, Linas; Ulčinas, Orestas; Tamulevičius, Sigitas; Žukauskas, Egidijus; Rekuvienė, Regina; Mažeika, Liudas

    2016-10-01

    Scanning acoustic microscopy (SAM) is used as a routine non-destructive test tool for different diagnostic examinations: detection of defects such as microcracks, delamination, disbonding, inclusions, subsurface features in materials such as pores and cracks. SAM can be operated in a wide frequency range from Megahertz to Gigahertz. SAM measurement spatial resolution is diffraction limited by the wavelength of the acoustic wave in particular medium and also depends on individual transducers geometry. Actual SAM spatial resolution can be determined by measuring calibrated lithographically formed microstructures in high acoustic impedance materials. Numerical acoustic signal simulation method, based on the diffraction approach, was employed for the selection of the calibration block pattern geometry and linear dimensions of the elements. Universal calibration block for SAM operating in a 20-230 MHz frequency range was micromachined in high acoustic impedance ceramic substrates. Differently spaced (from 18 to 185 µm) lines of the same width and different widths (from 17 to 113 µm) but similar spacing lines were imposed in alumina ceramics employing one step lithography process, i.e. femtosecond laser ablation. Proposed SAM calibration pattern linear dimensions were characterized employing optical and scanning electron microscopy. Finally the samples were measured with SAM employing different frequency transducers and results were compared with the numerical simulations. It was obtained that resolution of SAM operating with 230 MHz transducer is not worse than 40 µm. © The Author (2016). Published by Oxford University Press on behalf of Journal of Molecular Cell Biology, IBCB, SIBS, CAS. All rights reserved.

  2. A New Chronology of Late Quaternary Sequences From the Central Arctic Ocean Based on "Extinction Ages" of Their Excesses in 231Pa and 230Th

    Science.gov (United States)

    Hillaire-Marcel, C.; Ghaleb, B.; de Vernal, A.; Maccali, J.; Cuny, K.; Jacobel, A.; Le Duc, C.; McManus, J.

    2017-12-01

    Merging the late Quaternary Arctic paleoceanography into the Earth's global climate history remains challenging due to the lack of robust marine chronostratigraphies. Over ridges notably, low and variable sedimentation rates, scarce biogenic remains ensuing from low productivity and/or poor preservation, and oxygen isotope and paleomagnetic records differing from global stacks represent major impediments. However, as illustrate here based on consistent records from Mendeleev-Alpha and Lomonosov Ridges, disequilibria between U-series isotopes can provide benchmark ages. In such settings, fluxes of the particle-reactive U-daughter isotopes 230Th and 231Pa from the water column, are not unequivocally linked to sedimentation rates, but rather to sea-ice rafting and brine production histories, thus to the development of sea-ice factories over shelves during intervals of high relative sea level. The excesses in 230Th and 231Pa over fractions supported by their parent U-isotopes, collapse down sedimentary sequences, due to radioactive decay, and provide radiometric benchmark ages of approximately 300 and 140 ka, respectively. These "extinction ages" point to mean sedimentation rates of ˜4.3 and ˜1.7 mm/ka, respectively, over the Lomonosov and Mendeleev Ridges, which are significantly lower than assumed in most recent studies, thus highlighting the need for revisiting current interpretations of Arctic lithostratigraphies in relation to the global-scale late Quaternary climatostratigraphy.

  3. Transfer of 238U, 230Th, 226Ra, and 210Pb from soils to tree and shrub species in a Mediterranean area.

    Science.gov (United States)

    Blanco Rodríguez, P; Vera Tomé, F; Lozano, J C; Pérez Fernández, M A

    2010-06-01

    The soil-to-plant transfer factors of natural uranium isotopes ((238)U and (234)U), (230)Th, (226)Ra, and (210)Pb were studied in a disused uranium mine located in the Extremadura region in the south-west of Spain. The plant samples included trees (Quercus ilex, Quercus suber, and Eucalyptus cameldulensis) and one shrub (Cytisus multiflorus). All of them are characteristic of Mediterranean environments. The activity concentrations in leaves and fruit were determined for the tree species at different stages of growth. For the shrub, the total above-ground fraction was considered in three seasons. For old leaves and fruit, the highest activity concentrations were found in Eucalyptus cameldulensis for all the radionuclides studied, except in the case of (230)Th that presented similar activity concentrations in all of the tree species studied. In every case, the transfer to fruit was less than the transfer to leaves. In the shrub, the results depended on the season of sampling, with the highest value obtained in spring and the lowest in autumn. Important correlations were obtained for (238)U and (226)Ra between the activity ratio in soils with that in leaves or fruit. Copyright 2010 Elsevier Ltd. All rights reserved.

  4. Novel association of the R230C variant of the ABCA1 gene with high triglyceride levels and low high-density lipoprotein cholesterol levels in Mexican school-age children with high prevalence of obesity.

    Science.gov (United States)

    Gamboa-Meléndez, Marco Alberto; Galindo-Gómez, Carlos; Juárez-Martínez, Liliana; Gómez, F Enrique; Diaz-Diaz, Eulises; Ávila-Arcos, Marco Antonio; Ávila-Curiel, Abelardo

    2015-08-01

    Metabolic syndrome (MetS) is a disorder that includes a cluster of several risk factors for the development of type 2 diabetes and cardiovascular disease. The R230C variant of the ABCA1 gene has been associated with low HDL-cholesterol in several studies, but its association with MetS in children remains to be determined. The aim of this study was to analyze the association of the R230C variant with MetS and other metabolic traits in school-aged Mexican children. The study was performed in seven urban primary schools in the State of Mexico. Four hundred thirty-two Mexican school-age children 6-13 years old were recruited. MetS was identified using the International Diabetes Federation definition. The R230C variant of the ABCA1 gene was genotyped to seek associations with MetS and other metabolic traits. The prevalence of MetS was 29% in children aged 10-13 years. The R230C variant was not associated with MetS (OR = 1.65; p = 0.139). Furthermore, in the whole population, the R230C variant was associated with low HDL-cholesterol levels (β coefficient = -3.28, p children. Copyright © 2015 IMSS. Published by Elsevier Inc. All rights reserved.

  5. Measurement of the Magnetic Fields from High-Voltage (230 kV Substations in Tehran and Assessment of Their Effects

    Directory of Open Access Journals (Sweden)

    Mahdieh Sharifi Fard

    2010-06-01

    Full Text Available Introduction: Recent industrial developments in human societies have caused rapid advancements in technologies of production and distribution of electricity, which in turn result in enhancement of power networks and utilization of high voltages. These networks and the high voltages in transfer lines cause the exposure to electric and magnetic fields. In this study, the situation regarding the magnetic fields from high-voltage (230 kV substations in Tehran was investigated. Material and Methods: In this study, 8 high-voltage (230 kV substations were selected (Shous, Shahid Firouzi, Ozgol, Kan, Tehranpars, Azadegan, Ghorkhane and Besat substations. The premises of each substation was divided into some stations and measurements were done in each one. Measurements were done according to the IEEE std 644-1994 Standard in a way that the device, specifically its probe, was kept at a height of 1 meter above the ground surface. Then, we tried to examine the probable effects of exposure to magnetic fields through the Essex questionnaire, with Cronbach coefficient of 94%, completed by the employees of the substations. These questionnaires were completed by substation operators as an exposed group (36 persons and the employees of the office section of the Tehran regional electric company as a witness group (32 persons. Results: The measured density in none of the stations exceeded the standard limits of the International Commission on Non-Ionizing Radiation Protection. With regard to the questionnaire results about mental and neurological, cardiac and respiratory, and gastrointestinal and auditory disorders, we observed significant differences between witness and exposed groups, however, regarding skin allergies, there was no significant difference. Conclusion: Among all control rooms, the highest measured magnetic field was 6.9 mG in the Ozgol Substation Control Room and the lowest was 2 mG in the post of Shahid Firouzi. The control room of Ozgol

  6. Antibody responses to two new Lactococcus lactis-produced recombinant Pfs48/45 and Pfs230 proteins increase with age in malaria patients living in the Central Region of Ghana

    DEFF Research Database (Denmark)

    Acquah, Festus K.; Obboh, Evans K.; Asare, Kwame

    2017-01-01

    the seroreactivity of 95 malaria patients living in the Central Region of Ghana. Results Pfs48/45.6C and Pfs230.C0 were successfully produced in L. lactis in the absence of a fusion partner using a simplified purification scheme. Seroprevalence for L. lactis-produced Pfs48/45.6C and Pfs230.C0 in the study population...... was 74.7 and 72.8%, respectively. Conclusions A significant age-dependent increase in antibody titers was observed, which suggests a vaccine targeting these antigens could be boosted during a natural infection in the field....

  7. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  8. Environmental Assessment and Finding of No Significant Impact: Curecanti-Lost Canyon 230-kV Transmission Line Reroute Project, Montrose County, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2000-03-20

    The Department of Energy (DOE), Western Area Power Administration (Western) is proposing to reroute a section of the Curecanti-Lost Canyon 230-kilovolt (kV) transmission line, in Montrose County, Colorado. A portion of the transmission line, situated 11 miles southeast of Montrose, Colorado, crosses Waterdog Peak, an area of significant geologic surface activity, which is causing the transmission line's lattice steel towers to shift. This increases stress to structure hardware and conductors, and poses a threat to the integrity of the transmission system. Western proposes to relocate the lattice steel towers and line to a more geologically stable area. The existing section of transmission line and the proposed relocation route cross Bureau of Land Management and private land holdings.

  9. Marked disequilibrium between {sup 234}Th and {sup 230}Th of the {sup 238}U natural radioactive decay chain in IAEA reference materials n. 312, 313 and 314

    Energy Technology Data Exchange (ETDEWEB)

    Colaianni, A. [Dipartimento di Geologia e Geofisica dell' Universita di Bari, Via Orabona, 4 - 70125 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); D' Erasmo, G. [Dipartimento Interateneo di Fisica dell' Universita di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); Pantaleo, A., E-mail: pantaleo@ba.infn.i [I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); Schiavulli, L. [Dipartimento Interateneo di Fisica dell' Universita di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy)

    2011-02-15

    A new laboratory for the spectroscopy of natural radioactivity with a good energy resolution is presented. It consists of two distinct parts equipped, respectively, the first one with a HpGe {gamma}-ray detector, whose setup has been already completed, and the second one with large area Silicon {alpha}-ray detectors and a radiochemical section for thin {alpha}-samples preparation, whose setup is yet in progress and will be the argument of a separate work. The {gamma}-ray spectrometer was calibrated by means of IAEA Reference Materials n. 312, 313, 314 and 375. A large difference from the predictions of secular equilibrium emerged between the activities of {sup 234}Th and {sup 230}Th in Materials n. 312, 313 and 314.

  10. Aerodynamic characteristics of some modified conical bodies with low lift-drag ratios at Mach numbers of 2.30 and 4.63

    Science.gov (United States)

    Davenport, E. E.

    1972-01-01

    A wind-tunnel investigation was conducted at Mach numbers of 2.30 and 4.63 to determine the static aerodynamic characteristics of three 60 deg half-angle cone models. Configuration 1 was obtained by raking off a symmetrical cone at a base angle of 6.15 deg, and configuration 2 and 3 were obtained by adding flaps to a symmetrical cone. The models were tested at angles of attack from about -5 deg to about 20 deg at roll angles of 0 deg to -180 deg and at a freestream Reynolds number of 1.09 x one million, based on body diameter. The results showed that all three configurations produced finite values of lift-drag ratio useful for lifting planetary entry. All three configurations exhibited increases in yawing moment and side force with roll angle; thus, the capability for lateral trajectory control is provided.

  11. Origin of the {sup 238}U-{sup 230}Th disequilibrium in magmas from subduction zones: the Arenal example; Origine du desequilibre {sup 238}U-{sup 230}TH dans les magmas des zones de subduction: exemple de l`Arenal

    Energy Technology Data Exchange (ETDEWEB)

    Villemant, B. [Paris-6 Univ., 75 (France)

    1996-12-31

    The existence in some volcanic products of strong excess of {sup 238}U with respect to {sup 230}Th is one of the characteristics of volcanic arc magmas. These excesses are generally attributed to fluid additions inside mantellic sources before magma segregation, differentiation and eruption. These fluids should be linked to the dehydration of the subducted rocks. These hypotheses are essentially based on correlations between {sup 10}Be, {sup 87}Sr anomalies, Ba/La ratios and on the distribution of volcanic centers with respect to the subduction zone. Recent studies suggest an evolution of the composition of volcanic sources in Central America from a depleted mantle type (MORB) in the North (Nicaragua) to a less transformed enriched type (OIB) in the South (Costa Rica). The Arenal volcano belongs to a transition zone between these two types. The preliminary study of trace elements and {sup 238}U-{sup 230}Th disequilibria in recent volcanic products (1968-1993) indicates a more complex situation. At least two different mantle sources were successively involved characterized by different Th/La and La/Yb ratios and very different to the OIB type. Also most lavas are in equilibrium with {sup 238}U/{sup 232}Th ratios of about 1.2 to 1.3. However, in eruptive cycle, some lavas are characterized by a strong {sup 238}U excess with respect to {sup 230}Th with cannot be linked to the sources, even when modified by fluids in depth. These results are interpreted in terms of heterogeneities of mantle sources and low depths late interactions with hydrothermal fluids during eruptions. Abstract only. (J.S.). 2 refs.

  12. Determination {sup 230}Th by ICP-MS for the control of activities of restoration of an area of land contaminated with uranium mining sterile; Determinacion de {sup 230}Th mediante ICP-MS durante el control de las actividades de restauracion de un area de terreno contaminada con esteriles de mineria de uranio

    Energy Technology Data Exchange (ETDEWEB)

    Yague, L.; Conde, E.; Navarro, N.; Fernandez, M.; Ortiz, M. I.; Noguerales, C.; Gasco, C.

    2013-07-01

    In 2012, within the activities for the Project PIMIC (CIEMAT) took out the first stage of restoration of a contaminated area. This is an area which had a residual contamination due to burial tailings uranium mining. The activities have been: elimination of the arboreal mass, excavation of the ground and earthmoving. The methodology applied is described in this work and is based on the combination of gamma spectrometry technique and development of a method of analysis {sup 230}Th by ICP-MS. (Author)

  13. Distinguishing lower and upper crustal processes in magmas erupted during the buildup to the 7.7 ka climactic eruption of Mount Mazama, Crater Lake, Oregon, using 238U-230Th disequilibria

    Science.gov (United States)

    Ankney, Meagan E.; Johnson, Clark M.; Bacon, Charles R.; Beard, Brian L.; Jicha, Brian R.

    2013-08-01

    Uranium-series isotope ratios determined for 35 volcanic rocks and 4 glass separates erupted from ~36 to 4.8 ka at Mt. Mazama, Crater Lake, Oregon, identify both 230Th-excess and 238U-excess components. U-Th isotope compositions cover a wide range, exceeding those previously measured for the Cascade arc. Age-corrected (230Th/232Th) and (238U/232Th) activity ratios range from 1.113 to 1.464 and from 0.878 to 1.572 (44.4 % 230Th-excess to 8.8 % 238U-excess), respectively. The most distinctive aspect of the data set is the contrast in U-Th isotope ratios between low and high Sr (LSr, HSr) components that have been previously identified in products of the 7.7 ka caldera-forming climactic eruption and preclimactic rhyodacite lavas. The LSr component exclusively contains 238U-excess, but the HSr component, as well as more primitive lavas, are marked by 230Th-excess. 230Th-excesses such as those recorded at Mt. Mazama are commonly observed in the Cascades. Melting models suggest that high 230Th-excesses observed in the more primitive lavas evolved through mixing of a mantle melt with a partial melt of a mafic lower crustal composition that contained garnet in the residuum that was produced through dehydration melting of amphibolite that was initially garnet free. Dehydration melting in the lower crust offers a solution to the "hot-slab paradox" of the Cascades, where low volatile contents are predicted due to high slab temperatures, yet higher water contents than expected have been documented in erupted lavas. The 238U-excess observed at Mt. Mazama is rare in Cascade lavas, but occurs in more than half of the samples analyzed in this study. Traditionally, 238U-excess in arc magmas is interpreted to reflect slab fluid fluxing. Indeed, 238U-excess in arcs is common and likely masks 230Th-excess resulting from lower crustal interaction. Isotopic and trace element data, however, suggest a relatively minor role for slab fluid fluxing in the Cascades. We propose that 238U

  14. 238U–230Th–226Ra–210Pb–210Po disequilibria constraints on magma generation, ascent, and degassing during the ongoing eruption of Kīlauea

    Science.gov (United States)

    Girard, Guillaume; Reagan, Mark K.; Sims, Kenneth W. W.; Thornber, Carl; Waters, Christopher L.; Phillips, Erin H.

    2017-01-01

    The timescales of magma genesis, ascent, storage and degassing at Kīlauea volcano, Hawai‘i are addressed by measuring 238U-series radionuclide abundances in lava and tephra erupted between 1982 and 2008. Most analyzed samples represent lavas erupted by steady effusion from Pu‘u ‘Ō‘ō and Kūpahianaha from 1983 to 2008. Also included are samples erupted at the summit in April 1982 and March 2008, along the East Rift Zone at the onset of the ongoing eruption in January 1983, and during vent shifting episodes 54 and 56, at Nāpau crater in January 1997, and Kane Nui O Hamo in June 2007. In general, samples have small (∼4%) excesses of (230Th) over (238U) and ∼3 to ∼17% excesses of (226Ra) over (230Th), consistent with melting of a garnet peridotite source at melting rates between 1 × 10–3 and 5 × 10–3 kg m–3 a–1, and melting region porosity between ∼2 and ∼10%, in agreement with previous studies of the ongoing eruption and historical eruptions. A small subset of samples has near-equilibrium (230Th/238U) values, and thus were generated at higher melting rates. Based on U–Th–Ra disequilibria and Th isotopic data from this and earlier studies, melting processes and sources have been relatively stable over at least the past two centuries or more, including during the ongoing unusually long (>30 years) and voluminous (4 km3) eruption. Lavas recently erupted from the East Rift Zone have average initial (210Pb/226Ra) values of 0·80 ± 0·11 (1σ), which we interpret to be the result of partitioning of 222Rn into a persistently generated CO2-rich gas phase over a minimum of 8 years. This (210Pb) deficit implies an average magma ascent rate of ≤3·7 km a–1 from ∼30 km depth to the surface. Spatter and lava associated with vent-opening episodes erupt with variable (210Pb) deficits ranging from 0·7 to near-equilibrium values in some samples. The samples with near-equilibrium (210Pb/226Ra) are typically more

  15. Tensile properties of HA 230 and HA 188 after 400 and 2500 hour exposures to LiF-22CaF2 and vacuum at 1093 K

    Science.gov (United States)

    Whittenberger, J. Daniel

    1990-01-01

    The solid-to-liquid phase transformation of the nominal LiF-20CaF2 eutectic at 1043 K is considered to be an ideal candidate thermal energy storage mechanism for a space based low temperature Brayton cycle solar dynamic system. Although Co, Fe, and Ni superalloys are thought to be suitable containment materials for LiF based salts, long term containment is of concern because molten fluorides are usually corrosive and Cr can be lost into space through evaporation. Two examples of commercially available superalloys in sheet form, the Ni-base material HA 230 and the Co-base material Ha 88, have been exposed to molten LiF-22CaF2, its vapor, and vacuum, at 1093 K, for 400 and 2500 hr. Triplicate tensile testing of specimens subjected to all three environments have been undertaken between 77 to 1200 K. Comparison of the weight gain data, microstructure, and tensile properties indicate that little, if any, difference in behavior can be ascribed to the exposure environment.

  16. Standardization of U(X{sub 1}+X{sub 2}): The {sup 234}Th+{sup 234m}Pa+{sup 230}Th mixture

    Energy Technology Data Exchange (ETDEWEB)

    Grau Carles, A. [Direccion de Tecnologia, CIEMAT, Madrid (Spain); Grau Malonda, A. [Instituto de Investigacion Basica, CIEMAT, Madrid (Spain); Gomez Gil, V. [Instituto de Medio Ambiente, CIEMAT, Madrid (Spain)

    1996-02-01

    The not very well known intensities of the diverse beta-decay branches of both {sup 234}Th and {sup 234m}Pa make the calibration of the genetic mixture {sup 234}Th+{sup 234m}Pa difficult. We apply a new standardization method based on Cherenkov counting, which permits a verification of the primary and secondary intensities for {sup 234m}Pa. We obtain 80% intensity for the primary branch, which contradicts the very weak gamma transition intensities observed for {sup 234m}Pa. This disagreement between experimental and theoretical Cherenkov counting efficiencies can only be avoided by considering the {sup 234m}Pa primary beta transition to be first forbidden non-unique. We also study the low-activity mixture {sup 234}Th+{sup 234m}Pa+{sup 230}Th, which has practical interest in sediment studies. We separate this mixture by two different liquid scintillation methods, by alpha/beta discrimination and by pulse-height spectrum unfolding, which we compare experimentally. (orig.).

  17. High-resolution tephrochronology of the Wilson Creek Formation (Mono Lake, California) and Laschamp event using 238U-230Th SIMS dating of accessory mineral rims

    Science.gov (United States)

    Vazquez, Jorge A.; Lidzbarski, Marsha I.

    2012-01-01

    Sediments of the Wilson Creek Formation surrounding Mono Lake preserve a high-resolution archive of glacial and pluvial responses along the eastern Sierra Nevada due to late Pleistocene climate change. An absolute chronology for the Wilson Creek stratigraphy is critical for correlating the paleoclimate record to other archives in the western U.S. and the North Atlantic region. However, multiple attempts to date the Wilson Creek stratigraphy using carbonates and tephras yield discordant results due to open-system effects and radiocarbon reservoir uncertainties as well as abundant xenocrysts. New ion microprobe 238U-230Th dating of the final increments of crystallization recorded by allanite and zircon autocrysts from juvenile pyroclasts yield ages that effectively date eruption of key tephra beds and delimit the timing of basal Wilson Creek sedimentation to the interval between 26.8±2.1 and 61.7±1.9 ka. Tephra (Ash 15) erupted during the geomagnetic excursion originally designated the Mono Lake excursion yields an age of 40.8±1.9 ka, indicating that the event is instead the Laschamp excursion. The new ages support a depositional chronology from magnetostratigraphy that indicates quasi-synchronous glacial and hydrologic responses in the Sierra Nevada and Mono Basin to regional climate change, with intervals of lake filling and glacial-snowpack melting that are in phase with peaks in spring insolation.

  18. Facility Location Evaluation for Shelton-Kitsap 230-kV Line, Study Area 75-4. Draft supplement to the Environmental Statement Fiscal Year 1976 Proposed Program.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1974-10-22

    This report discusses alternative route locations for the proposed construction of a 31.6-mile, 230-kV transmission line from Shelton, Washington, to Kitsap Substation near Port Orchard, Washington. The new line would replace an existing 115-kV wood-pole line for 28.8 miles and has the potential to replace or parallel for 2.8 miles. Approximately 22.6 miles of commercial Christmas trees growing on the existing right-of-way will be removed during the construction of this facility. Depending on the alternative chosen, for the last 2.8 miles, increased right-of-way width could require from 9 to 24 acres of additional tree cover, primarily Douglas-fir. Alternatives considered are: (1) nonconstruction, and (2) replacement of existing 115-kV wood-pole line with replacement and parallel alternatives for the last 2.8 miles. Generation alternatives to all transmission construction, including alternative methods of electrical transmission and generation, transmission construction, disposal of slash and limiting the consumption of electricity, are discussed in BPA's General Construction and Maintenance Program Statement and the Annual Proposed Program Environmental Statement.

  19. Structure and optical function of amorphous photonic nanostructures from avian feather barbs: a comparative small angle X-ray scattering (SAXS) analysis of 230 bird species.

    Science.gov (United States)

    Saranathan, Vinodkumar; Forster, Jason D; Noh, Heeso; Liew, Seng-Fatt; Mochrie, Simon G J; Cao, Hui; Dufresne, Eric R; Prum, Richard O

    2012-10-07

    Non-iridescent structural colours of feathers are a diverse and an important part of the phenotype of many birds. These colours are generally produced by three-dimensional, amorphous (or quasi-ordered) spongy β-keratin and air nanostructures found in the medullary cells of feather barbs. Two main classes of three-dimensional barb nanostructures are known, characterized by a tortuous network of air channels or a close packing of spheroidal air cavities. Using synchrotron small angle X-ray scattering (SAXS) and optical spectrophotometry, we characterized the nanostructure and optical function of 297 distinctly coloured feathers from 230 species belonging to 163 genera in 51 avian families. The SAXS data provided quantitative diagnoses of the channel- and sphere-type nanostructures, and confirmed the presence of a predominant, isotropic length scale of variation in refractive index that produces strong reinforcement of a narrow band of scattered wavelengths. The SAXS structural data identified a new class of rudimentary or weakly nanostructured feathers responsible for slate-grey, and blue-grey structural colours. SAXS structural data provided good predictions of the single-scattering peak of the optical reflectance of the feathers. The SAXS structural measurements of channel- and sphere-type nanostructures are also similar to experimental scattering data from synthetic soft matter systems that self-assemble by phase separation. These results further support the hypothesis that colour-producing protein and air nanostructures in feather barbs are probably self-assembled by arrested phase separation of polymerizing β-keratin from the cytoplasm of medullary cells. Such avian amorphous photonic nanostructures with isotropic optical properties may provide biomimetic inspiration for photonic technology.

  20. Lung volume quantified by MRI reflects extracellular-matrix deposition and altered pulmonary function in bleomycin models of fibrosis: effects of SOM230.

    Science.gov (United States)

    Egger, Christine; Gérard, Christelle; Vidotto, Nella; Accart, Nathalie; Cannet, Catherine; Dunbar, Andrew; Tigani, Bruno; Piaia, Alessandro; Jarai, Gabor; Jarman, Elizabeth; Schmid, Herbert A; Beckmann, Nicolau

    2014-06-15

    Idiopathic pulmonary fibrosis is a progressive and lethal disease, characterized by loss of lung elasticity and alveolar surface area, secondary to alveolar epithelial cell injury, reactive inflammation, proliferation of fibroblasts, and deposition of extracellular matrix. The effects of oropharyngeal aspiration of bleomycin in Sprague-Dawley rats and C57BL/6 mice, as well as of intratracheal administration of ovalbumin to actively sensitized Brown Norway rats on total lung volume as assessed noninvasively by magnetic resonance imaging (MRI) were investigated here. Lung injury and volume were quantified by using nongated or respiratory-gated MRI acquisitions [ultrashort echo time (UTE) or gradient-echo techniques]. Lung function of bleomycin-challenged rats was examined additionally using a flexiVent system. Postmortem analyses included histology of collagen and hydroxyproline assays. Bleomycin induced an increase of MRI-assessed total lung volume, lung dry and wet weights, and hydroxyproline content as well as collagen amount. In bleomycin-treated rats, gated MRI showed an increased volume of the lung in the inspiratory and expiratory phases of the respiratory cycle and a temporary decrease of tidal volume. Decreased dynamic lung compliance was found in bleomycin-challenged rats. Bleomycin-induced increase of MRI-detected lung volume was consistent with tissue deposition during fibrotic processes resulting in decreased lung elasticity, whereas influences by edema or emphysema could be excluded. In ovalbumin-challenged rats, total lung volume quantified by MRI remained unchanged. The somatostatin analog, SOM230, was shown to have therapeutic effects on established bleomycin-induced fibrosis in rats. This work suggests MRI-detected total lung volume as readout for tissue-deposition in small rodent bleomycin models of pulmonary fibrosis. Copyright © 2014 the American Physiological Society.

  1. Hydrography, HydroLabels-The data set is a text feature containing labels of all hydro features. It consists of more than 230 text nodes of the hydro_line and hydro_poly features for display purposes., Published in 2005, Davis County Government.

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Hydrography dataset current as of 2005. HydroLabels-The data set is a text feature containing labels of all hydro features. It consists of more than 230 text nodes...

  2. 40_ _230 - 233__Hassan _Structural

    African Journals Online (AJOL)

    User

    Kimura, 2005). Pure quartz (SiO2) has three common polymorphs: cristobolite, tridymite (high-temperature), and quartz. (low-temperature). The silica structure is the basic structure for glasses and many ceramics. The structure of a material may be divided into four levels: atomic structure, atomic arrangement, microstructure,.

  3. A first-in-man study to evaluate the safety, tolerability, and pharmacokinetics of pasireotide (SOM230, a multireceptor-targeted somatostatin analog, in healthy volunteers

    Directory of Open Access Journals (Sweden)

    Golor G

    2012-04-01

    Full Text Available Georg Golor1, Ke Hu2, Matthieu Ruffin3, Alexandra Buchelt3, Emmanuel Bouillaud3, Yanfeng Wang2, Mario Maldonado31Parexel International GmbH, Berlin, Germany; 2Novartis Pharmaceuticals, East Hanover, NJ, USA; 3Novartis Pharma AG, Basel, SwitzerlandAbstract: Pasireotide (SOM230 is a multireceptor-targeted somatostatin analog with high binding affinity for four of the five somatostatin receptor subtypes (sst1,2,3 and sst5, and potential clinical activity in several neuroendocrine and oncologic conditions, including acromegaly, Cushing’s disease, and neuroendocrine tumors (NET. This manuscript reports the first-in-man dose-escalation study of pasireotide, evaluating its safety, tolerability, and pharmacokinetics (PK in healthy male volunteers. A single dose of pasireotide 1–1200 µg was administered subcutaneously in four to eight subjects per dose level, with two additional subjects per cohort administered placebo. PK and safety evaluations were carried out over 7 days post-dose. Growth hormone (GH suppression was evaluated using a GH-releasing hormone stimulation test on Day –1 and Day 1 at 3–5 hours post-injection. Seventy-two subjects completed the study. Pasireotide was well tolerated with no serious adverse events observed at any dose. Transient elevations in blood glucose levels were observed 2–6 hours after administration of pasireotide at doses between 200 µg and 1200 µg, but this resolved without intervention by 23 hours post-dosing. The maximum tolerable dose was not established within the tested range. Pasireotide demonstrated a favorable PK profile with fast absorption (tmax: 0.25–0.5 hours, low clearance (CL/F: 8–13 L/hour, long effective elimination half-life (mean t½,ß: 7–11 hours, and a proportional dose-exposure relationship. GH suppression of 79%–96% was observed at single pasireotide doses between 200 µg and 1200 µg. In conclusion, pasireotide demonstrated favorable safety, tolerability, and PK profiles

  4. Crystallisation ages in coeval silicic magma bodies: 238U-230Th disequilibrium evidence from the Rotoiti and earthquake flat eruption deposits, Taupo volcanic zone, New Zealand

    Science.gov (United States)

    Charlier, B.L.A.; Peate, D.W.; Wilson, C.J.N.; Lowenstern, J. B.; Storey, M.; Brown, S.J.A.

    2003-01-01

    The timescales over which moderate to large bodies of silicic magma are generated and stored are addressed here by studies of two geographically adjacent, successive eruption deposits in the Taupo Volcanic Zone, New Zealand. The earlier, caldera-forming Rotoiti eruption (>100 km3 magma) at Okataina volcano was followed, within months at most, by the Earthquake Flat eruption (??? 10 km3 magma) from nearby Kapenga volcano; both generated nonwelded ignimbrite and coeval widespread fall deposits. The Rotoiti and Earthquake Flat deposits are both crystal-rich high-silica rhyolites, with sparse glass-bearing granitoid fragments also occurring in Rotoiti lag breccias generated during caldera collapse. Here we report 238U-230Th disequilibrium data on whole rocks and mineral separates from representative Rotoiti and Earthquake Flat pumices and the co-eruptive Rotoiti granitoid fragments using TIMS and in situ zircon analyses by SIMS. Multiple-grain zircon-controlled crystallisation ages measured by TIMS from the Rotoiti pumice range from 69??3 ka ( 350 ka, with a pronounced peak at 70-90 ka. The weighted mean of isochrons is 83??14 ka, in accord with the TIMS data. One glass-bearing Rotoiti granitoid clast yielded an age of 57??8 ka by TIMS (controlled by Th-rich phases that, however, are not apparently present in the juvenile pumices). Another glass-bearing Rotoiti granitoid yielded SIMS zircon model ages peaking at 60-90 ka, having a similar age distribution to the pumice. Age data from pumices are consistent with a published 64??4 ka eruptive age (now modified to 62??2 ka), but chemical and/or mineralogical data imply that the granitoid lithics are not largely crystalline Rotoiti rhyolite, but instead represent contemporaneous partly molten intrusions reflecting different sources in their chemistries and mineralogies. Similarly, although the Earthquake Flat eruption immediately followed (and probably was triggered by) the Rotoiti event, age data from juvenile material

  5. Eruption and magma crystallization ages of Las Tres Vírgenes (Baja California) constrained by combined 230Th/ 238U and (U-Th)/He dating of zircon

    Science.gov (United States)

    Schmitt, Axel K.; Stockli, Daniel F.; Hausback, Brian P.

    2006-11-01

    Las Tres Vírgenes volcano is a calc-alkaline composite cone located near the main Gulf of California escarpment on the E coast of the Baja California peninsula. High-sensitivity ion microprobe U-series ( 230Th/ 238U) ages for zircon from La Vírgen tephra average 121 - 10 + 12 ka (1σ; MSWD = 2.7), with discrete age peaks at ˜ 100 and 160 ka. The noble gas mass spectrometric (U-Th)/He zircon age, corrected for disequilibrium and pre-eruptive storage, is 36 ± 3 ka. This result for the eruption age of La Vírgen tephra is significantly older than previously postulated historic or Holocene ages that were based on an 18th century map reference and 14C dating of accidental charcoal, respectively. The new (U-Th)/He zircon age is consistent with a > 26 ± 4 ka age derived from cosmogenic He exposure dating of an overlying basaltic lava flow [Hausback, B.P. and Abrams, M.J., 1996. Plinian eruption of La Virgen Tephra, Volcán Las Tres Virgenes, Baja California Sur, Mexico. Eos, Transactions, American Geophysical Union, 77(46, Suppl.): 813-814.]. U-Pb zircon analysis of ignimbrites erupted from the adjacent Early Pleistocene La Reforma and El Aguajito calderas yielded ages of 1.38 ± 0.03 Ma ( n = 12; MSWD = 1.0) and 1.17 ± 0.07 Ma ( n = 23; MSWD = 1.3), respectively. No evidence for these ages is found among La Vírgen zircons, whereas pre-Quaternary zircon xenocrysts are common. The La Vírgen magma, therefore, evolved unrelated to Early Pleistocene magmatism in adjacent calderas, but assimilated local basement rocks. A gap between average Th-U and (U-Th)/He zircon ages suggests that zircon crystallization was discontinuous in the La Vírgen magma chamber. In addition, partial resorption of zircon suggests episodic thermal rejuvenation, most likely by basaltic recharge. Based on the zircon record, the > 100 ka lifetime of the thermal anomaly that sustained repeated intrusive pulses significantly exceeds the age of the last eruption. This strengthens the view that Tres

  6. ESR dating of tooth enamel: comparison with {230Th }/{234U } speleothem dates at La Chaise-de-Vouthon (Charente), France

    Science.gov (United States)

    Blackwell, Bonnie; Porat, N.; Schwarcz, H. P.; Debénath, A.

    One way to assess a new dating method's reliability is by comparing its results with those from well established, independent techniques. A controlled test of the electron spin resonance (ESR) dating method as it is currently being applied to teeth was attempted for the time range 100-250 ka, beyond that of 14C, at the archaeological site of La Chaise-de-Vouthon (Charente, France). Although absent in modern enamel, a single ESR signal with g = 2.0018 in fossil tooth enamel hydroxyapatite increases in amplitude with increasing irradiation doses. ESR ages are derived from the ratio of the AD, the radiation dose needed to produce the observed ESR signal, relative to the natural, environmental dose rate (ED) experienced by the tooth after deposition. Since the age depends on the uranium (U) uptake history assumed, three ages are calculated assuming: (1) early U uptake (EU); (2) continuous (linear) uptake (LU); (3) recent uptake (RU). Generally, the LU age agrees best with known ages determined by other methods, although the RU model is better for some teeth. ESR dating assumes that the fossil has not suffered recrystallization or significant diagenetic alteration. In the preliminary test, three teeth were dated. In Bourgeois-Delaunay, a bovid molar associated with Palaeolithic artefacts was collected from layers dated at 101 ± 12 to 114 ± 7 ka by {230Th }/{234U } dating of the over- and underlying stalagmitic floors. From Suard, two Equus teeth were collected from beneath a stalagmitic floor dating 112 ± 12 ka. ESR dating teeth significantly underestimated the true age for the teeth: the mean ESR ages range from 37 to 94 ka with standard errors of 2-6 ka, and good replicability. Although more teeth at La Chaise need to be tested to ascertain that the underestimation does not result from random variation commonly seen among teeth within one unit, the consistent underestimation suggests a fault in one of the assumptions underlying the dating method. The most obvious

  7. On the reason for the kink in the rigidity spectra of cosmic-ray protons and helium nuclei near 230 GV

    Energy Technology Data Exchange (ETDEWEB)

    Loznikov, V. M., E-mail: loznikov@yandex.ru; Erokhin, N. S.; Zol’nikova, N. N.; Mikhailovskaya, L. A. [Russian Academy of Sciences, Space Research Institute (Russian Federation)

    2016-07-15

    A three-component phenomenological model describing the specific features of the spectrum of cosmic-ray protons and helium nuclei in the rigidity range of 30–2×10{sup 5} GV is proposed. The first component corresponds to the constant background; the second, to the variable “soft” (30–500 GV) heliospheric source; and the third, to the variable “hard” (0.5–200 TV) source located inside a local bubble. The existence and variability of both sources are provided by the corresponding “surfatron accelerators,” whose operation requires the presence of an extended region with an almost uniform (in both magnitude and direction) magnetic field, orthogonally (or obliquely) to which electromagnetic waves propagate. The maximum energy to which cosmic rays can be accelerated is determined by the source size. The soft source with a size of ∼100 AU is located at the periphery of the heliosphere, behind the front of the solar wind shock wave. The hard source with a size of >0.1 pc is located near the boundary of an interstellar cloud at a distance of ∼0.01 pc from the Sun. The presence of a kink in the rigidity spectra of p and He near 230 GV is related to the variability of the physical conditions in the acceleration region and depends on the relation between the amplitudes and power-law exponents in the dependences of the background, soft heliospheric source, and hard near galactic source. The ultrarelativistic acceleration of p and He by an electromagnetic wave propagating in space plasma across the external magnetic field is numerically analyzed. Conditions for particle trapping by the wave and the dynamics of the particle velocity and momentum components are considered. The calculations show that, in contrast to electrons and positrons (e{sup +}), the trapped protons relatively rapidly escape from the effective potential well and cease to accelerate. Due to this effect, the p and He spectra are softer than that of e{sup +}. The possibility that the

  8. A microsatellite-based consensus linkage map for species of Eucalyptus and a novel set of 230 microsatellite markers for the genus

    Directory of Open Access Journals (Sweden)

    Williams Emlyn R

    2006-09-01

    Full Text Available Abstract Background Eucalypts are the most widely planted hardwood trees in the world occupying globally more than 18 million hectares as an important source of carbon neutral renewable energy and raw material for pulp, paper and solid wood. Quantitative Trait Loci (QTLs in Eucalyptus have been localized on pedigree-specific RAPD or AFLP maps seriously limiting the value of such QTL mapping efforts for molecular breeding. The availability of a genus-wide genetic map with transferable microsatellite markers has become a must for the effective advancement of genomic undertakings. This report describes the development of a novel set of 230 EMBRA microsatellites, the construction of the first comprehensive microsatellite-based consensus linkage map for Eucalyptus and the consolidation of existing linkage information for other microsatellites and candidate genes mapped in other species of the genus. Results The consensus map covers ~90% of the recombining genome of Eucalyptus, involves 234 mapped EMBRA loci on 11 linkage groups, an observed length of 1,568 cM and a mean distance between markers of 8.4 cM. A compilation of all microsatellite linkage information published in Eucalyptus allowed us to establish the homology among linkage groups between this consensus map and other maps published for E. globulus. Comparative mapping analyses also resulted in the linkage group assignment of other 41 microsatellites derived from other Eucalyptus species as well as candidate genes and QTLs for wood and flowering traits published in the literature. This report significantly increases the availability of microsatellite markers and mapping information for species of Eucalyptus and corroborates the high conservation of microsatellite flanking sequences and locus ordering between species of the genus. Conclusion This work represents an important step forward for Eucalyptus comparative genomics, opening stimulating perspectives for evolutionary studies and

  9. Corrective Action Investigation Plan for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    US DOE/Nevada Operations Office

    1999-06-10

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, Nevada Operation Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 230/320 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 230 consists of Corrective Action Site (CAS) 22-03-01, Sewage Lagoon; while CAU 320 consists of CAS 22-99-01, Strainer Box. These CAUs are referred to as CAU 230/320 or the Sewage Lagoons Site. The Sewage Lagoons Site also includes an Imhoff tank, sludge bed, and associated buried sewer piping. Located in Area 22, the site was used between 1951 to 1958 for disposal of sanitary sewage effluent from the historic Camp Desert Rock Facility at the Nevada Test Site in Nevada. Based on site history, the contaminants of potential concern include volatile organic compounds (VOCs), semivolatile organic compounds, total petroleum hydrocarbons (TPH), and radionuclides. Vertical migration is estimated to be less than 12 feet below ground surface, and lateral migration is limited to the soil immediately adjacent to or within areas of concern. The proposed investigation will involve a combination of field screening for VOCs and TPH using the direct-push method and excavation using a backhoe to gather soil samples for analysis. Gamma spectroscopy will also be conducted for waste management purposes. Sampling locations will be biased to suspected worst-case areas including the nearby sludge bed, sewage lagoon inlet(s) and outlet(s), disturbed soil surrounding the lagoons, surface drainage channel south of the lagoons, and the area near the Imhoff tank. The results of this field investigation will support a defensible evaluation of corrective action alternatives in the corrective action decision document.

  10. Corrective Action Investigation Plan for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Air port Strainer Box, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Nevada Operations Office

    1999-06-10

    This Corrective Action Investigation Plan contains the US Department of Energy, Nevada Operation Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 230/320 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 230 consists of Corrective Action Site (CAS) 22-03-01, Sewage Lagoon; while CAU 320 consists of CAS 22-99-01, Strainer Box. These CAUs are referred to as CAU 230/320 or the Sewage Lagoons Site. The Sewage Lagoons Site also includes an Imhoff tank, sludge bed, and associated buried sewer piping. Located in Area 22, the site was used between 1951 to 1958 for disposal of sanitary sewage effluent from the historic Camp Desert Rock Facility at the Nevada Test Site in Nevada. Based on site history, the contaminants of potential concern include volatile organic compounds (VOCs), semivolatile organic compounds, total petroleum hydrocarbons (TPH), and radionuclides. Vertical migration is estimated to be less than 12 feet below ground surface, and lateral migration is limited to the soil immediately adjacent to or within areas of concern. The proposed investigation will involve a combination of field screening for VOCs and TPH using the direct-push method and excavation using a backhoe to gather soil samples for analysis. Gamma spectroscopy will also be conducted for waste management purposes. Sampling locations will be biased to suspected worst-case areas including the nearby sludge bed, sewage lagoon inlet(s) and outlet(s), disturbed soil surrounding the lagoons, surface drainage channel south of the lagoons, and the area near the Imhoff tank. The results of this field investigation will support a defensible evaluation of corrective action alternatives in the corrective action decision document.

  11. Corrective Action Decision Document for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box, Nevada Test Site, Nevada, Rev. 0

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Nevada Operations Office

    2000-04-20

    This Corrective Action Decision Document identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 230, Area 22 Sewage Lagoons, and CAU 320, Area 22 Desert Rock Airport Strainer Box, under the Federal Facility Agreement and Consent Order. Referred to as CAU 230/320, both CAUs are located at the Nevada Test Site (NTS) and comprise two Corrective Action Sites (CASs), 22-03-01 (Sewage Lagoons) and 22-99-01 (Strainer Box). The Area 22 Sewage Lagoons site also includes a buried Imhoff Tank, sludge bed, and associated sewer piping. A September 1999 corrective action investigation identified the only contaminant of concern above preliminary action levels at this CAU (i.e., total petroleum hydrocarbons as diesel-range organics). During this same investigation, three Corrective Action Objectives (CAOs) were identified to prevent or mitigate exposure to subsurface debris and contaminated soil. Based on these CAOs, a review of existing data, future use, and current operations in Area 22 of the NTS, three CAAs were developed for consideration: Alternative 1 - No Further Action, Alternative 2 - Closure in Place with Administrative Controls, and Alternative 3 - Excavation and Removal. These alternatives were evaluated based on four general corrective action standards and five remedy selection decision factors. Alternative 3 was chosen on technical merit as the preferred alternative for CAU 230/320. This alternative was judged to meet all applicable state and federal regulations for closure of the site and will eliminate potential future exposure pathways to the buried debris and contaminated soils at both of the CASs within Area 22.

  12. High time resolution observations of the polar stratosphere and mesosphere using a ground-based 230-250 GHz microwave radiometer

    Science.gov (United States)

    Newnham, D. A.; Espy, P. J.; Clilverd, M. A.; Maxfield, D. J.; Hartogh, P.; Holmén, K.; Blindheim, S.; Horne, R. B.

    2012-04-01

    Microwave radiometry is used to measure thermal emission by the Doppler- and pressure-broadened molecular rotational lines of atmospheric gases, from which vertical abundance profiles can be determined. Since solar radiation is not required for the measurement, the technique has the advantage that continuous observations are possible including throughout the polar winter. We describe the development of a passive microwave radiometer [Espy, P. J., P. Hartogh, and K. Holmen (2006), Proc. SPIE, 6362, 63620P, doi:10.1117/12.688953] for ground-based remote sensing of the polar middle atmosphere. The instrument measures nitric oxide (NO), ozone (O3), and carbon monoxide (CO) vertical profiles over the altitude range 35-90 km with time resolution as high as 15 minutes, allowing the diurnal variability of trace chemical species to be investigated. Heterodyne detection of atmospheric emission at 230 GHz and 250 GHz (wavelength ~1.25 mm) with a receiver noise temperature of 300 K is achieved using a superconductor-insulator-superconductor (SIS) mixer cooled to 4 K. The down-converted signals at 1.35 GHz and 2.10 GHz are analysed using both a moderate-resolution (28 kHz, 220 MHz bandwidth) and a high-resolution (14 kHz, 40 MHz bandwidth) chirp-transform spectrometer (CTS). The instrument was operated semi-autonomously at Troll station (72° 01'S 02° 32'E, 1270 m above sea level), Antarctica during 2008-10 and at the Arctic LIDAR Observatory for Middle Atmosphere Research (ALOMAR, 69° 16'N, 16° 00'E, 380 m above sea level), northern Norway during 2011-12. NO volume mixing ratio (VMR) profiles have been inverted from calibrated brightness temperature spectra of the NO line centred at 250.796 GHz, observed above Troll station, using the Microwave Observation Line Estimation and Retrieval (MOLIERE) version 5 code. A priori pressure, temperature, ozone, water vapour, and NO profiles above 30 km were calculated using the Sodankylä Ion and Neutral Chemistry (SIC, version 6

  13. Porosity of the melting zone and variations in the solid mantle upwelling rate beneath Hawaii: Inferences from {sup 238}U-{sup 230}Th-{sup 226}Ra and {sup 235}U-{sup 231}Pa disequilibria

    Energy Technology Data Exchange (ETDEWEB)

    Sims, K.W.W.; DePaolo, D.J.; Murrell, M.T.; Baldridge, W.S.; Goldstein, S.; Clague, D.; Jull, M.

    1999-12-01

    Measurements of {sup 238}U-{sup 230}Th-{sup 226}Ra and {sup 235}U-{sup 231}Pa disequilibria in a suite of tholeiitic-to-basanitic lavas provide estimates of porosity, solid mantle upwelling rate and melt transport times beneath Hawaii. The observation that ({sup 230}Th/{sup 238}U) {gt} 1 indicates that garnet is required as a residual phase in the magma sources for all of the lavas. Both chromatographic porous flow and dynamic melting of a garnet peridotite source can adequately explain the combined U-Th-Ra and U-Pa data for these Hawaiian basalts. For chromatographic porous flow, the calculated maximum porosity in the melting zone ranges from 0.3--3% for tholeiites and 0.1--1% for alkali basalts and basanites, and solid mantle upwelling rates range from 40 to 100 cm/yr for tholeiites and from 1 to 3 cm/yr for basanites. For dynamic melting, the escape or threshold porosity is 0.5--2% for tholeiites and 0.1--0.8% for alkali basalts and basanites, and solid mantle upwelling rates range from 10 to 30 cm/yr for tholeiites and from 0.1 to 1 cm/yr for basanites. Assuming a constant melt productivity, calculated total melt fractions range from 15% for the tholeiitic basalts to 3% for alkali basalts and basanites.

  14. Temperature dependence of the photodissociation of CO2 from high vibrational levels: 205-230 nm imaging studies of CO(X1Σ+) and O(3P, 1D) products

    Science.gov (United States)

    Sutradhar, S.; Samanta, B. R.; Samanta, A. K.; Reisler, H.

    2017-07-01

    The 205-230 nm photodissociation of vibrationally excited CO2 at temperatures up to 1800 K was studied using Resonance Enhanced Multiphoton Ionization (REMPI) and time-sliced Velocity Map Imaging (VMI). CO2 molecules seeded in He were heated in an SiC tube attached to a pulsed valve and supersonically expanded to create a molecular beam of rotationally cooled but vibrationally hot CO2. Photodissociation was observed from vibrationally excited CO2 with internal energies up to about 20 000 cm-1, and CO(X1Σ+), O(3P), and O(1D) products were detected by REMPI. The large enhancement in the absorption cross section with increasing CO2 vibrational excitation made this investigation feasible. The internal energies of heated CO2 molecules that absorbed 230 nm radiation were estimated from the kinetic energy release (KER) distributions of CO(X1Σ+) products in v″ = 0. At 230 nm, CO2 needs to have at least 4000 cm-1 of rovibrational energy to absorb the UV radiation and produce CO(X1Σ+) + O(3P). CO2 internal energies in excess of 16 000 cm-1 were confirmed by observing O(1D) products. It is likely that initial absorption from levels with high bending excitation accesses both the A1B2 and B1A2 states, explaining the nearly isotropic angular distributions of the products. CO(X1Σ+) product internal energies were estimated from REMPI spectroscopy, and the KER distributions of the CO(X1Σ+), O(3P), and O(1D) products were obtained by VMI. The CO product internal energy distributions change with increasing CO2 temperature, suggesting that more than one dynamical pathway is involved when the internal energy of CO2 (and the corresponding available energy) increases. The KER distributions of O(1D) and O(3P) show broad internal energy distributions in the CO(X1Σ+) cofragment, extending up to the maximum allowed by energy but peaking at low KER values. Although not all the observations can be explained at this time, with the aid of available theoretical studies of CO2 VUV

  15. Farmacocinética do cloridrato de tramadol administrado por via oral em cães com a mutação nt230(del4) no gene MDR1

    OpenAIRE

    Karine Gehlen Baja

    2013-01-01

    A P-glicoproteína (P-gp) é uma transportadora transmembrana de múltiplos fármacos, produto do gene MDR1 (ABCB1). A P-gp contribui para a função de barreira de vários tecidos e órgãos, funcionando como uma bomba de efluxo para muitos substratos. Diminuição na expressão desta proteína é associada à sensibilidade a fármacos. Cães da linhagem dos Collies possuem uma alta incidência de uma mutação no gene MDR1, denominada nt230(del4). Animais homozigotos para a mutação apresentam a supressão total...

  16. Current achievements and challenges of a multiple dating approach (14C, 230Th/U and 36Cl) to infer tsunami transport age(s) of reef-top boulders on Bonaire (Leeward Antilles)

    Science.gov (United States)

    Rixhon, Gilles; May, Simon Matthias; Engel, Max; Mechernich, Silke; Schroeder-Ritzrau, Andrea; Frank, Norbert; Fohlmeister, Jens; Boulvain, Frédéric; Dunai, Tibor; Brückner, Helmut

    2017-04-01

    The deposition of supratidal coarse-clast deposits is difficult to date, limiting their value for inferring frequency-magnitude patterns of high-energy wave events. On Bonaire (Leeward Antilles, Caribbean), these deposits form prominent landforms, and transport by one or several Holocene tsunamis is assumed at least for the largest clasts. Although a large dataset of 14C and electron spin resonance (ESR) ages is available for major coral rubble ridges and ramparts, it is still debated whether these data reflect the timing of major events, and how these datasets are biased by the reworking of coral fragments. As an attempt to overcome the current challenges for dating the dislocation of singular boulders, three distinct dating methods are implemented and compared: (i) 14C dating of boring bivalves attached to the boulders; (ii) 230Th/U dating of post-depositional, secondary calcite flowstone and subaerial microbialites at the underside of the boulders; and (iii) surface exposure dating of overturned boulders via 36Cl concentration measurements in corals. Approaches (ii) and (iii) have never been applied to coastal boulder deposits so far. The three 14C age estimates are older than 37 ka, i.e. most probably beyond the applicability of the method, which is attributed to post-depositional diagenetic processes, shedding doubt on the usefulness of this method in the local context. The remarkably convergent 230Th/U ages, all pointing to the Late Holocene period (1.0-1.6 ka), are minimum ages for the transport event(s). The microbialite sample yields an age of 1.23±0.23 ka and both flowstone samples are in stratigraphic order: the older (onset of carbonate precipitation) and younger flowstone layers yield ages of 1.59±0.03 and 1.23±0.03 ka, respectively. Four coral samples collected from the topside of overturned boulders yielded similar 36Cl concentration measurements. However, the computed ages are affected by large uncertainties, mostly due to the high natural

  17. KAJIAN TEKNIS PENGGUNAAN METODE FULL OUTFITTING BLOCK SYSTEM (FOBS PADA PRODUKSI PEMBANGUNAN KAPAL BOX SHAPE BLOCK CARRIER (BSBC M 229/230 KAPASITAS 50.000 DWT DI PT. PAL INDONESIA

    Directory of Open Access Journals (Sweden)

    Sukanto Jatmiko

    2012-03-01

    Full Text Available PT. PAL Indonesia used Full Outfitting Block System (FOBS methods to abridge ship construction time. But, production accomplishment still frequent to late, so, implementation of those methods at PT. PAL Indonesia in the production of Box Shape Bulk Carrier (BSBC M 229/230 ship construction or known as STAR 50 need to investigated. The data interpretations were done by doing observation, gather planning data, and monthly production report of Box Shape Bulk Carrier ship between Februarys 2007- April 2008 periods. Then, calculating percentage of FOBS implementation at PT. PAL Indonesia with constrains factor from the data’s. The conclusions based on the analysis and discussions from this research are percentage of FOBS implementation method at PT. PAL Indonesia is 71,633 %, constrain factors of FOBS implementation method at PT. PAL Indonesia are material overdue (6,122%, human resources (4,246%, design (3,954%, production facility (2.820%, and experience (1,244%

  18. Proposal to amend existing operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, Routt, Jackson and Larimer Counties, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-08-01

    The Western Area Power Administration, Rocky Mountain Region, is proposing to amend an existing US Forest Service operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, which are located in Routt, jackson, and Larimer counties, Colorado. These transmission lines cross portions of the Roosevelt and Routt National Forests. The long-term use authorization Western is requesting from the Forest Service would be for the life of the Ault-Craig and Hayden-Archer transmission lines. This environmental assessment addresses those access road and right-of-way maintenance activities identified by Western that would be performed on Forest Service managed lands during the next approximately five years.

  19. InP-based type-I quantum well lasers up to 2.9 μm at 230 K in pulsed mode on a metamorphic buffer

    Energy Technology Data Exchange (ETDEWEB)

    Gu, Y.; Zhang, Y. G., E-mail: ygzhang@mail.sim.ac.cn; Ma, Y. J.; Zhou, L.; Chen, X. Y.; Xi, S. P.; Du, B. [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China)

    2015-03-23

    This work reports on up to 2.9 μm lasing at 230 K of InP-based type-I quantum well lasers. This record long wavelength lasing is achieved by applying InP-based Sb-free structures with eight periods of strain-compensated InAs quantum wells grown on metamorphic In{sub 0.8}Al{sub 0.2}As template layers. The continuous-wave threshold current density is 797 A/cm{sup 2} and the idealized extrapolated threshold current density for infinite cavity length is as low as 58 A/cm{sup 2} per quantum well at 120 K. This scheme is a promising pathway for extending the wavelength range of type-I quantum well lasers on InP substrates.

  20. Ingestion of U(nat), {sup 226}Ra, {sup 230}Th and {sup 210}Po in vegetables by adult inhabitants of Bagjata uranium mining area, Jharkhand, India; Ingestion d'U (naturel), de {sup 226}Ra, de {sup 230}Th et de {sup 210}Po dans les legumes par les habitants adultes de la region miniere d'uranium de Bagjata, Jharkhand, Inde

    Energy Technology Data Exchange (ETDEWEB)

    Giri, S.; Singh, G. [Indian School of Mines, Dept. of Environmental Science and Engineering, Dhanbad (India); Jha, V.N.; Tripathi, R.M. [Bhabha Atomic Research Centre, Environmental Assessment Division, Mumbai (India)

    2010-04-15

    Ingestion of radionuclides through food intake accounts for a substantial part of radiation doses and vegetables constitute essential components of the diet, by contributing protein, vitamins, iron, calcium and other nutrients. Radionuclides can be apprehended in the ecosystem of the East Singhbhum region which is known for its viable grades of uranium. In the present study, vegetables were collected from the villages around the proposed Bagjata mining area and analysed for U(nat), {sup 226}Ra, {sup 230}Th and {sup 210}Po. The geometric mean concentration of U(nat), {sup 226}Ra, {sup 230}Th, and {sup 210}Po were 0.05, 0.09, 0.17 and 1.12 Bq kg-1 fresh weight, respectively. The intake of the radionuclides from vegetables was found to be 49.58 Bq y-1 while the ingestion dose was calculated to be 11.51muSv y-1, respectively. The estimated doses are reflecting the natural background dose via the route of ingestion, which is much below the 1 mSv limit set in the new I.C.R.P. recommendations. It is lower than the global average annual radiation dose of 2 400 muSv to man from the natural radiation sources as proposed by UNSCEAR. The total cancer risk due to the consumption of vegetables was calculated to be 6.65 * 10-9 which is negligible and much lower than the threshold risk value of 10-6. The study also reveals that water is more conducive for high radioactivity occurrence in vegetables compared to soil systems. (authors)

  1. Britain's delegation to CERN, the European Centre for Nuclear Research near Geneva, voted in favour of a project which take seven years to build, involve a 27 kilometre long tunnel, and cost 230 million pounds. Now LEP receives the go-ahead later this month

    CERN Multimedia

    Llewellyn Smith, Christopher Hubert

    1981-01-01

    Britain's delegation to CERN, the European Centre for Nuclear Research near Geneva, voted in favour of a project which take seven years to build, involve a 27 kilometre long tunnel, and cost 230 million pounds. Now LEP receives the go-ahead later this month

  2. In Silico Molecular Modeling and Docking Studies on Novel Mutants (E229V, H225P and D230C) of the Nucleotide-Binding Domain of Homo sapiens Hsp70.

    Science.gov (United States)

    Elengoe, Asita; Hamdan, Salehhuddin

    2017-12-01

    In this study, we explored the possibility of determining the synergistic interactions between nucleotide-binding domain (NBD) of Homo sapiens heat-shock 70 kDa protein (Hsp70) and E1A 32 kDa of adenovirus serotype 5 motif (PNLVP) in the efficiency of killing of tumor cells in cancer treatment. At present, the protein interaction between NBD and PNLVP motif is still unknown, but believed to enhance the rate of virus replication in tumor cells. Three mutant models (E229V, H225P and D230C) were built and simulated, and their interactions with PNLVP motif were studied. The PNLVP motif showed the binding energy and intermolecular energy values with the novel E229V mutant at -7.32 and -11.2 kcal/mol. The E229V mutant had the highest number of hydrogen bonds (7). Based on the root mean square deviation, root mean square fluctuation, hydrogen bonds, salt bridge, secondary structure, surface-accessible solvent area, potential energy and distance matrices analyses, it was proved that the E229V had the strongest and most stable interaction with the PNLVP motif among all the four protein-ligand complex structures. The knowledge of this protein-ligand complex model would help in designing Hsp70 structure-based drug for cancer therapy.

  3. Earliest direct evidence of monument building at the archaeological site of Nan Madol (Pohnpei, Micronesia) identified using 230Th/U coral dating and geochemical sourcing of megalithic architectural stone

    Science.gov (United States)

    McCoy, Mark D.; Alderson, Helen A.; Hemi, Richard; Cheng, Hai; Edwards, R. Lawrence

    2016-11-01

    Archaeologists commonly use the onset of the construction of large burial monuments as a material indicator of a fundamental shift in authority in prehistoric human societies during the Holocene. High- quality direct evidence of this transition is rare. We report new interdisciplinary research at the archaeological site of Nan Madol that allows us to specify where and when people began to construct monumental architecture in the remote islands of the Pacific. Nan Madol is an ancient administrative and mortuary center and the former capital of the island of Pohnpei. It was constructed over 83 ha of lagoon with artificial islets and other architecture built using columnar basalt and coral. We employed geochemical sourcing of basalt used as architectural stone and high-precision uranium-thorium series dates (230Th/U) on coral from the tomb of the first chief of the entire island to identify the beginning of monument building at Nan Madol in AD 1180-1200. Over the next several centuries (AD 1300-1600) monument building began on other islands across Oceania. Future research should be aimed at resolving the causes of these social transformations through higher quality data on monument building.

  4. Magma mixing and the generation of isotopically juvenile silicic magma at Yellowstone caldera inferred from coupling 238U–230Th ages with trace elements and Hf and O isotopes in zircon and Pb isotopes in sanidine

    Science.gov (United States)

    Stelten, Mark E.; Cooper, Kari M.; Vazquez, Jorge A.; Reid, Mary R.; Barfod, Gry H.; Wimpenny, Josh; Yin, Qing-Zhu

    2013-01-01

    The nature of compositional heterogeneity within large silicic magma bodies has important implications for how silicic reservoirs are assembled and evolve through time. We examine compositional heterogeneity in the youngest (~170 to 70 ka) post-caldera volcanism at Yellowstone caldera, the Central Plateau Member (CPM) rhyolites, as a case study. We compare 238U–230Th age, trace-element, and Hf isotopic data from zircons, and major-element, Ba, and Pb isotopic data from sanidines hosted in two CPM rhyolites (Hayden Valley and Solfatara Plateau flows) and one extracaldera rhyolite (Gibbon River flow), all of which erupted near the caldera margin ca. 100 ka. The Hayden Valley flow hosts two zircon populations and one sanidine population that are consistent with residence in the CPM reservoir. The Gibbon River flow hosts one zircon population that is compositionally distinct from Hayden Valley flow zircons. The Solfatara Plateau flow contains multiple sanidine populations and all three zircon populations found in the Hayden Valley and Gibbon River flows, demonstrating that the Solfatara Plateau flow formed by mixing extracaldera magma with the margin of the CPM reservoir. This process highlights the dynamic nature of magmatic interactions at the margins of large silicic reservoirs. More generally, Hf isotopic data from the CPM zircons provide the first direct evidence for isotopically juvenile magmas contributing mass to the youngest post-caldera magmatic system and demonstrate that the sources contributing magma to the CPM reservoir were heterogeneous in 176Hf/177Hf at ca. 100 ka. Thus, the limited compositional variability of CPM glasses reflects homogenization occurring within the CPM reservoir, not a homogeneous source.

  5. 40 CFR 230.41 - Wetlands.

    Science.gov (United States)

    2010-07-01

    ... environment, particularly where emergent vegetation merges with submerged vegetation over a broad area in such... environment when vegetation from the two regions merges over a broad area. (3) Wetland vegetation consists of...

  6. 36 CFR 1211.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... estimates of the number of students, by sex, expected to apply for, be admitted to, and enter each class... RULES NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL... a single transition plan applicable to all such units, or a separate transition plan applicable to...

  7. 45 CFR 618.230 - Transition plans.

    Science.gov (United States)

    2010-10-01

    ... number of students, by sex, expected to apply for, be admitted to, and enter each class during the period... ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE... that is composed of more than one administratively separate unit may submit either a single transition...

  8. 10 CFR 5.230 - Transition plans.

    Science.gov (United States)

    2010-01-01

    ... estimates of the number of students, by sex, expected to apply for, be admitted to, and enter each class... REGULATORY COMMISSION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING... either a single transition plan applicable to all such units, or a separate transition plan applicable to...

  9. 45 CFR 2555.230 - Transition plans.

    Science.gov (United States)

    2010-10-01

    ... number of students, by sex, expected to apply for, be admitted to, and enter each class during the period... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE... and that is composed of more than one administratively separate unit may submit either a single...

  10. 13 CFR 113.230 - Transition plans.

    Science.gov (United States)

    2010-01-01

    ... number of students, by sex, expected to apply for, be admitted to, and enter each class during the period... Nondiscrimination on the Basis of Sex in Education Programs or Activities Receiving Federal Financial Assistance... that is composed of more than one administratively separate unit may submit either a single transition...

  11. 29 CFR 36.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... estimates of the number of students, by sex, expected to apply for, be admitted to, and enter each class... Secretary of Labor NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING... submit either a single transition plan applicable to all such units, or a separate transition plan...

  12. 32 CFR 196.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... estimates of the number of students, by sex, expected to apply for, be admitted to, and enter each class...) MISCELLANEOUS NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL... a single transition plan applicable to all such units, or a separate transition plan applicable to...

  13. 44 CFR 19.230 - Transition plans.

    Science.gov (United States)

    2010-10-01

    ... estimates of the number of students, by sex, expected to apply for, be admitted to, and enter each class... HOMELAND SECURITY GENERAL NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES... submit either a single transition plan applicable to all such units, or a separate transition plan...

  14. 38 CFR 23.230 - Transition plans.

    Science.gov (United States)

    2010-07-01

    ... number of students, by sex, expected to apply for, be admitted to, and enter each class during the period...) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE... that is composed of more than one administratively separate unit may submit either a single transition...

  15. 18 CFR 1317.230 - Transition plans.

    Science.gov (United States)

    2010-04-01

    ... number of students, by sex, expected to apply for, be admitted to, and enter each class during the period... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE... and that is composed of more than one administratively separate unit may submit either a single...

  16. 24 CFR 3.230 - Transition plans.

    Science.gov (United States)

    2010-04-01

    ... number of students, by sex, expected to apply for, be admitted to, and enter each class during the period... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE... that is composed of more than one administratively separate unit may submit either a single transition...

  17. 40 CFR 230.96 - Monitoring.

    Science.gov (United States)

    2010-07-01

    ... mitigation project type. The mitigation plan must address the monitoring requirements for the compensatory... project site is necessary to determine if the project is meeting its performance standards, and to determine if measures are necessary to ensure that the compensatory mitigation project is accomplishing its...

  18. 40 CFR 230.32 - Other wildlife.

    Science.gov (United States)

    2010-07-01

    ... cover, travel corridors, and preferred food sources for resident and transient wildlife species... favor the introduction of undesirable plant and animal species at the expense of resident species and... are resident and transient mammals, birds, reptiles, and amphibians. (b) Possible loss of values: The...

  19. 40 CFR 230.43 - Vegetated shallows.

    Science.gov (United States)

    2010-07-01

    ... and eelgrass in estuarine or marine systems as well as a number of freshwater species in rivers and...) releasing chemicals that adversely affect plants and animals; (4) increasing turbidity levels, thereby...

  20. 49 CFR 230.109 - Tender trucks.

    Science.gov (United States)

    2010-10-01

    ... five leaves in the entire spring pack broken; (2) A broken coil spring or saddle; (3) A coil spring... maximum clearance shall be 3/8 inch on each side for rear trucks and 3/4 inch on each side for front...

  1. 22 CFR 230.02 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... issue price (excluding any transaction costs) thereof; and (2) In the case of any Eligible Note issued..., corporation, partnership, joint venture, association, joint stock company, trust, unincorporated organization... to the Fiscal Agent. (t) Fiscal Agent means the bank or trust company or its duly appointed successor...

  2. 40 CFR 1042.230 - Engine families.

    Science.gov (United States)

    2010-07-01

    ... family. Your engine family is limited to a single model year. (b) For Category 1 engines, group engines... (i.e., mechanical or electronic). (9) Application (commercial or recreational). (10) Numerical level... piston rings on the piston. (11) The intake manifold induction port size and configuration. (12) The...

  3. Publications | Page 230 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... an environmental perturbation (open access). In environments with limiting resources, such as space or food, Salmonids such as rainbow trout form social hierarchies, consisting of dominant and subordinate individuals. There were two main objectives for this thesis: to investigate the physiological consequences of being ...

  4. 49 CFR 25.230 - Transition plans.

    Science.gov (United States)

    2010-10-01

    ... Transportation Office of the Secretary of Transportation NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... administratively separate unit may submit either a single transition plan applicable to all such units, or a... Secretary of Education, a transition plan shall: (1) State the name, address, and Federal Interagency...

  5. 22 CFR 146.230 - Transition plans.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations DEPARTMENT OF STATE CIVIL RIGHTS NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... administratively separate unit may submit either a single transition plan applicable to all such units, or a... Secretary of Education, a transition plan shall: (1) State the name, address, and Federal Interagency...

  6. 22 CFR 229.230 - Transition plans.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... administratively separate unit may submit either a single transition plan applicable to all such units, or a... Secretary of Education, a transition plan shall: (1) State the name, address, and Federal Interagency...

  7. 10 CFR 1042.230 - Transition plans.

    Science.gov (United States)

    2010-01-01

    ... DEPARTMENT OF ENERGY (GENERAL PROVISIONS) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR... separate unit may submit either a single transition plan applicable to all such units, or a separate... of Education, a transition plan shall: (1) State the name, address, and Federal Interagency Committee...

  8. 40 CFR 230.92 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... an upland, wetland, and/or riparian area that protects and/or enhances aquatic resource functions... areas are lands adjacent to streams, rivers, lakes, and estuarine-marine shorelines. Riparian areas... development time. Watershed means a land area that drains to a common waterway, such as a stream, lake...

  9. 40 CFR 35.230 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... program regulations are at 40 CFR parts 150 through 189 and 19 CFR part 12. ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE STATE AND LOCAL... Agreements to States (as defined in section 2 of Federal Insecticide, Fungicide, and Rodenticide Act) under...

  10. 23 CFR 230.407 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... discriminatory practices and their effects on the conditions and privileges of employment. These measures include... Labor to increase minority and female utilization in crafts of the construction industry in a specified... functions incidental to construction shall include preliminary engineering work in project development or...

  11. 36 CFR 230.7 - Program practices.

    Science.gov (United States)

    2010-07-01

    ... productivity, vigor, and health, and the value and quality of wood products. (4) Windbreak and Hedgerow... of windbreaks and hedgerows to conserve energy, protect farmsteads, livestock, and crops, and reduce...

  12. Aristarchus of Samos (310-230 BC)

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Greek philosopher, born on the island of Samos. According to ARCHIMEDES, Aristarchus hypothesized that the fixed stars are stationary, and that the Earth orbits the Sun, which is at the center of the universe. Since the stars did not show motions that reflected the motion of the Earth, the stars must be at great distances. The Babylonian astronomer SELEUCUS was the only astronomer who took up thi...

  13. 9 CFR 2.30 - Registration.

    Science.gov (United States)

    2010-01-01

    ... intends to use live animals for research, tests, experiments, or teaching, the university or college... register with the Secretary. An official who has the legal authority to bind the parent organization shall... being in an inactive status. (3) A research facility which goes out of business or which ceases to...

  14. 22 CFR 230.15 - Notice.

    Science.gov (United States)

    2010-04-01

    ... the Israel Loan Guarantee Number inscribed on the Eligible Note and shall be complete on the day it shall be actually received by USAID at the Office of Development Credit, Bureau for Economic Growth... AGENCY FOR INTERNATIONAL DEVELOPMENT ISRAEL LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME...

  15. 33 CFR 230.19 - Comments.

    Science.gov (United States)

    2010-07-01

    ... make. (a) Time extensions. District commanders will consider and act on requests for time extensions to review and comment on an EIS based on timeliness of distribution of the document, prior agency... of decision will be submitted through channels to the appropriate decision authority. In the case of...

  16. 2 CFR 230.15 - Policy.

    Science.gov (United States)

    2010-01-01

    ... Government bear its fair share of costs except where restricted or prohibited by law. The principles do not attempt to prescribe the extent of cost sharing or matching on grants, contracts, or other agreements... individual cost elements by Federal agencies. ...

  17. 17 CFR 230.602 - Securities exempted.

    Science.gov (United States)

    2010-04-01

    ... just and equitable principles of trade; or (5) Is subject to a U.S. Post Office fraud order. (d) No... which is the subject of any proceeding or examination under section 8 of the Act, or is the subject of... Investment Company Act of 1940; or (7) Is subject to a U.S. Post Office fraud order. (c) No exemption under...

  18. 17 CFR 230.902 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Exchange; the London Stock Exchange; the Bourse de Luxembourg; the Mexico Stock Exchange; the Borsa Valori..., respectively, in the jurisdiction where located; and (vi) The International Monetary Fund, the International... Bank, the African Development Bank, the United Nations, and their agencies, affiliates and pension...

  19. 40 CFR 230.6 - Adaptability.

    Science.gov (United States)

    2010-07-01

    ... entirety to any one activity, no matter how complex. It is anticipated that substantial numbers of permit... essential component of guideline application. These Guidelines allow evaluation and documentation for a variety of activities, ranging from those with large, complex impacts on the aquatic environment to those...

  20. 17 CFR 230.494 - Newspaper prospectuses.

    Science.gov (United States)

    2010-04-01

    ... RULES AND REGULATIONS, SECURITIES ACT OF 1933 Registration by Foreign Governments Or Political... proposed newspaper prospectus, in the size and form in which it is intended to be published shall be filed... additional copies shall be filed in the exact form in which it was published and shall be accompanied by a...

  1. 23 CFR 230.413 - Review reports.

    Science.gov (United States)

    2010-04-01

    ... assistance to FHWA regional and division offices and SHA's; (ii) Gathering a sufficient data base for program... documentary evidence to support the determination of a contractor's or subcontractor's compliance status. (3... documentary evidence. (4) The compliance review report shall contain at least the following information. 1...

  2. 23 CFR 230.305 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... other Spanish culture or origin, regardless of race. (4) The category Asian or Pacific Islanders: All..., minority group persons in the U.S. are identified as Blacks (not of Hispanic origin), Hispanics, Asian or...

  3. Publications | Page 230 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    AR5) will be the culmination of over two decades of evolution for the IPCC since the first assessment report was released in 1990. While it is too late to alter the structure of AR5, there are opportunities to... Managing waste and water improves ...

  4. 36 CFR 230.31 - Definitions.

    Science.gov (United States)

    2010-07-01

    .... Concurrence. Review, verification, and confirmation by the Responsible Official that the State priority plan... traded or owners principally engaged in the primary processing of raw wood products are excluded. Management plan. A written plan prepared by a service representative and approved by a State Forester...

  5. 21 CFR 1271.230 - Process validation.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) REGULATIONS UNDER CERTAIN OTHER ACTS ADMINISTERED BY THE FOOD AND DRUG ADMINISTRATION HUMAN CELLS, TISSUES..., a representation of sterility or pathogen inactivation of an HCT/P, must be based on a fully...

  6. 23 CFR 230.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... by representatives of affected groups (usually labor unions, minority organizations, and contractors... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Equal Employment.... Normally the Equal Opportunity Officer will be a full-time civil rights specialist serving as staff...

  7. BMI and all cause mortality: systematic review and non-linear dose-response meta-analysis of 230 cohort studies with 3.74 million deaths among 30.3 million participants.

    Science.gov (United States)

    Aune, Dagfinn; Sen, Abhijit; Prasad, Manya; Norat, Teresa; Janszky, Imre; Tonstad, Serena; Romundstad, Pål; Vatten, Lars J

    2016-05-04

    To conduct a systematic review and meta-analysis of cohort studies of body mass index (BMI) and the risk of all cause mortality, and to clarify the shape and the nadir of the dose-response curve, and the influence on the results of confounding from smoking, weight loss associated with disease, and preclinical disease. PubMed and Embase databases searched up to 23 September 2015. Cohort studies that reported adjusted risk estimates for at least three categories of BMI in relation to all cause mortality. Summary relative risks were calculated with random effects models. Non-linear associations were explored with fractional polynomial models. 230 cohort studies (207 publications) were included. The analysis of never smokers included 53 cohort studies (44 risk estimates) with >738 144 deaths and >9 976 077 participants. The analysis of all participants included 228 cohort studies (198 risk estimates) with >3 744 722 deaths among 30 233 329 participants. The summary relative risk for a 5 unit increment in BMI was 1.18 (95% confidence interval 1.15 to 1.21; I(2)=95%, n=44) among never smokers, 1.21 (1.18 to 1.25; I(2)=93%, n=25) among healthy never smokers, 1.27 (1.21 to 1.33; I(2)=89%, n=11) among healthy never smokers with exclusion of early follow-up, and 1.05 (1.04 to 1.07; I(2)=97%, n=198) among all participants. There was a J shaped dose-response relation in never smokers (Pnon-linearity studies of never smokers with ≥20 years' follow-up. In contrast there was a U shaped association between BMI and mortality in analyses with a greater potential for bias including all participants, current, former, or ever smokers, and in studies with a short duration of follow-up (<5 years or <10 years), or with moderate study quality scores. Overweight and obesity is associated with increased risk of all cause mortality and the nadir of the curve was observed at BMI 23-24 among never smokers, 22-23 among healthy never smokers, and 20-22 with longer durations of

  8. 50 CFR 648.230 - Catch quotas and other restrictions.

    Science.gov (United States)

    2010-10-01

    ... estimates of recruitment; virtual population analysis results; levels of noncompliance by fishermen or... rejected by both Councils. After such review, NMFS shall publish a proposed rule in the Federal Register... fishing years. After considering public comments, NMFS shall publish a final rule in the Federal Register...

  9. 17 CFR 230.503 - Filing of notice of sales.

    Science.gov (United States)

    2010-04-01

    ...) An issuer's revenues or aggregate net asset value; (C) The minimum investment amount, if the change... number of non-accredited investors who have invested in the offering, as long as the change does not increase the number to more than 35; (H) The total number of investors who have invested in the offering...

  10. 12 CFR 230.9 - Enforcement and record retention.

    Science.gov (United States)

    2010-01-01

    ... listed in that section. (b) Civil liability. Section 271 of the Act contains the provisions relating to civil liability for failure to comply with the requirements of the act and this part; Section 271 is...

  11. 2 CFR Appendix A to Part 230 - General Principles

    Science.gov (United States)

    2010-01-01

    ... buildings, equipment and capital improvement, interest on debt associated with certain buildings, equipment and capital improvements, and operations and maintenance expenses. “Administration” is defined as general administration and general expenses such as the director's office, accounting, personnel, library...

  12. 17 CFR 230.421 - Presentation of information in prospectuses.

    Science.gov (United States)

    2010-04-01

    ... that increases the size of the document but does not enhance the quality of the information. (c) All... in condensed or summarized form. In lieu of repeating information in the form of notes to financial... manner. Any presentation must be consistent with the financial statements and non-financial information...

  13. 40 CFR 1065.230 - Raw exhaust flow meter.

    Science.gov (United States)

    2010-07-01

    ... flow meter. (a) Application. You may use measured raw exhaust flow, as follows: (1) Use the actual... value: (i) For feedback control of a proportional sampling system, such as a partial-flow dilution... averaging Pitot tube, a hot-wire anemometer, or other measurement principle. This would generally not...

  14. 40 CFR 230.21 - Suspended particulates/turbidity.

    Science.gov (United States)

    2010-07-01

    ... time. These new levels may reduce light penetration and lower the rate of photosynthesis and the... suspended particulates persist. The biological and the chemical content of the suspended material may react with the dissolved oxygen in the water, which can result in oxygen depletion. Toxic metals and organics...

  15. 12 CFR Supplement I to Part 230 - Official Staff Interpretations

    Science.gov (United States)

    2010-01-01

    ... opened as a condition of obtaining a credit card iii. Accounts denominated in a foreign currency iv... agreements, interest rate swaps, and bankers acceptances (b) Advertisement 1. Covered messages...

  16. 230-IJBCS-Article-Dr P N Ndoutoumou

    African Journals Online (AJOL)

    RHUMSIKI

    by a decline of tissues, and the abscission of pods. Table 1 indicates the number of self- pollinations and crosses .... A restricted zone links the suspensor and hypertrophied cells of the hybrid embryo to the embryo proper .... Olsen OA, Linnestad C, Nichols SE. 1999. Developmental biology of the cereal endosperm. Elsevier ...

  17. 49 CFR 230.72 - Testing main reservoirs.

    Science.gov (United States)

    2010-10-01

    ... longitudinal lap seams, an appropriate NDE method that can measure the wall thickness of the reservoir may be... or riveted longitudinal lap seam main reservoirs, an appropriate NDE method that can measure wall... following formula: t=(PR/(0.5S−0.6P)) Where: t = Minimum value for wall thickness; P = Certified working...

  18. 17 CFR 230.172 - Delivery of prospectuses.

    Science.gov (United States)

    2010-04-01

    ... requirements of section 10(a) of the Act or the issuer will make a good faith and reasonable effort to file... shall not apply to any: (1) Offering of any investment company registered under the Investment Company Act of 1940 (15 U.S.C. 80a-1 et seq.); (2) Offering of any business development company as defined in...

  19. 40 CFR 230.10 - Restrictions on discharge.

    Science.gov (United States)

    2010-07-01

    ... after taking into consideration cost, existing technology, and logistics in light of overall project..., the analysis of alternatives required for NEPA environmental documents, including supplemental Corps...

  20. 40 CFR 230.91 - Purpose and general considerations.

    Science.gov (United States)

    2010-07-01

    ... done after taking into consideration cost, existing technology, and logistics in light of overall... complies with the Section 404(b)(1) Guidelines. During the 404(b)(1) Guidelines compliance analysis, the...

  1. 36 CFR 230.32 - National program administration.

    Science.gov (United States)

    2010-07-01

    ... learning, and a broad range of private sector interests. (b) In collaboration with State Foresters, the... Territory participating in FLEP. Data must be measurable, inclusive of all States, objective, and reliable...

  2. 49 CFR 230.29 - Inspection and repair.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances... operator shall inspect and repair all steam locomotive boilers and appurtenances under their control. They shall immediately remove from service any boiler that has developed cracks in the barrel. The steam...

  3. 49 CFR 230.34 - Riveted repairs and alterations.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and... portions of the boiler. Prior to making riveted alterations on unstayed portions of the boiler, the steam... standard for boiler repairs. The steam locomotive owner and/or operator shall satisfy reporting...

  4. 49 CFR 230.57 - Injectors and feedwater pumps.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and... delivery systems required. Each steam locomotive must be equipped with at least two means of delivering water to the boiler, at least one of which is a live steam injector. (b) Maintenance and testing...

  5. 49 CFR 230.50 - Time of testing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances... necessary, under steam at every 92 service day inspection, and also whenever any irregularity is reported...

  6. 49 CFR 230.33 - Welded repairs and alterations.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and... portions of the boiler, the steam locomotive owner and/or operator shall submit a written request for... national standard for boiler repairs. The steam locomotive owner and/or operator shall satisfy reporting...

  7. 49 CFR 230.41 - Flexible staybolts with caps.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and... length of the bolt and into the head not less than one third of the diameter of the head, the steam.... Before the steam locomotive is placed in service, the inner ends of all telltale holes shall be closed...

  8. 9 CFR 354.230 - Equipment and utensils.

    Science.gov (United States)

    2010-01-01

    ... drop chain or shackle, which shall be of noncorrosive metal. (3) Nonmetallic belt-type conveyors used... and key and the key shall not leave the custody of the inspector in charge of the plant. Such trucks...

  9. 49 CFR 238.230 - Safety appliances-new equipment.

    Science.gov (United States)

    2010-10-01

    ... drawings, sketches, or other visual aids that provide detailed information relating to the design, location...; (v) The weld is designed for infinite fatigue life in the application that it will be placed; (vi... railroad provides a detailed basis as to why the design of the vehicle or placement of the safety appliance...

  10. All projects related to | Page 230 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-05-09

    Obesity in South Africa is becoming a major public health issue for the country - nearly 60% of adult women and 31% percent of adult men are either obese or overweight. Start Date: May 9, 2012. End Date: November 9, 2013. Topic: WOMEN'S HEALTH, PUBLIC HEALTH, NUTRITION, DISEASES, LOW INCOME GROUPS, ...

  11. 17 CFR 230.405 - Definitions of terms.

    Science.gov (United States)

    2010-04-01

    ... distributed (rather than individually distributed) on telephone answering or voice mail systems, computers, computer networks and other forms of computer data compilation. Graphic communication shall not include a... court appointed a receiver, fiscal agent or similar officer with respect to the business or property of...

  12. Dicty_cDB: CFI230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DAAKWNIDLNNFSLVGDSAGG NMAIVLGLMAKVRNGPSFKRICLYYPAIDSGMNSGSYKEFHNDFYLTKDGMKWFWDAYTN SPKDTNEIYCSPSKCKE...DAAKWNIDLNNFSLVGDSAGG NMAIVLGLMAKVRNGPSFKRICLYYPAIDSGMNSGSYKEFHNDFYLTKDGMKWFWDAYTN SPKDTNEIYCSPSKCKE

  13. Dicty_cDB: VFM230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Female 1 Aedes aegypti cDNA clone ... 50 0.100 1 ( DW185535 ) EST01805 Whole Female 1 Aedes aegypti cDNA...Female 1 Aedes aegypti cDNA clone ... 50 0.100 1 ( DW185251 ) EST01521 Whole Female 1 Aedes aegypti cDNA...Female 1 Aedes aegypti cDNA clone ... 50 0.100 1 ( DW184846 ) EST01116 Whole Female 1 Aedes aegypti cDNA...EST00287 Whole Female 1 Aedes aegypti cDNA clone ... 50 0.100 1 ( DV435461 ) NADD187TR Aedes aegypti infected

  14. Dicty_cDB: SLA230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IRIGSSALTSRGLKEADFEKIADFLDRIVSISLEIQG RVGKKLVDFVVEINKSKELLDLRKEVEEFSSKFTLPGI*iir*ktl Translated Amino...IRIGSSALTSRGLKEADFEKIADFLDRIVSISLEIQG RVGKKLVDFVVEINKSKELLDLRKEVEEFSSKFTLPGI*iir*ktl Homology vs CSM-cDNA

  15. Dicty_cDB: CHQ230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kqlketekrfhc**k*iqsctkq*nxngncqefrsqepqefq slkmklml*iyy*mksqkvlkscalavvplmksvsrkf...elhqamkp*wklsri*kprttefqslkmkl ml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsstfikrf*ly...qlinklmlvk ml*phntfyhl*lqspklemfmlptl--- ---NQPKVNK**ikmltfkqlketekrfhc**k*iqsctkq*nxngncqefrsqepqefq slkmklml*iyy*mksqkvlkscala

  16. 36 CFR 230.4 - State program administration.

    Science.gov (United States)

    2010-07-01

    ... composition meets the requirements of section 19(b) of the Act. The Committee shall be chaired by the State... cost for practice components; (7) The distribution mechanism for the allocation of cost-share funds...; and make planning recommendations for Federal, State, and local implementation of the Act. (1) The...

  17. Page 1 230 Bishambhar Dayal Saksena *** TABLE I Relation ...

    Indian Academy of Sciences (India)

    goes deformation, and the changes will naturally be determined by the nature and extent of such deformation ; we shall now proceed to show that we are justified in regarding the Raman lines observed ... those of low frequencies constituting the acoustic or sound-wave spectrum, and those of higher frequency forming the ...

  18. 40 CFR 1033.230 - Grouping locomotives into engine families.

    Science.gov (United States)

    2010-07-01

    ..., naturally aspirated, Roots blown). (11) The general performance characteristics of the turbocharger or... calculated emission rates differ, such as locomotives with and without energy-saving design features. For the...

  19. 33 CFR 110.230 - Puget Sound Area, Wash.

    Science.gov (United States)

    2010-07-01

    ... 122°29′16″; thence 250° to the dock at Harper; thence westerly and northerly along the shoreline to... constructed of wood shall, unless there are steel bulwarks or metallic cases or cargo on board, be fitted with...

  20. 23 CFR 230.113 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... productive relationship with contractors, unions (if appropriate), minority and women groups, minority and... training opportunities for minorities, women, and the disadvantaged on Federal-aid highway projects; (2) A... highway construction projects for up to 6 months during periods when their training is interrupted. Such...

  1. 230-IJBCS-Article-Dr P N Ndoutoumou

    African Journals Online (AJOL)

    RHUMSIKI

    vulgaris, respectively originating from. Mexico and Brasilia were chosen for their aptitude to flowering under our experimental conditions, their biological status and ..... pine (Pinus taeda L.): stage-specific elemental analyses of zygotic embryo and female gametophyte tissue. Plant. Sciences, 164: 943-954. Russell SD. 1993.

  2. Dicty_cDB: VFH230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6899 |BF936899.1 EST459954 Schistosoma mansoni female, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clo...ne SMFCC91 5' end, mRNA sequence. 44 5e-11 3 AI975066 |AI975066.1 EST269660 Schistosoma mansoni female, Phil LoVerde/Joe

  3. Fluoridation and Defluoridation. Training Module 2.230.2.77.

    Science.gov (United States)

    McMullen, L. D.

    This document is an instructional module package prepared in objective form for use by an instructor familiar with fluoridation and fluoride feeding equipment. Enclosed are objectives, an instructor guide, student handouts and transparency masters. The module considers the principles and purposes of fluoridation, methods of feeding fluoride,…

  4. 23 CFR 230.415 - Consolidated compliance reviews.

    Science.gov (United States)

    2010-04-01

    ... inferences drawn from such comparisons. (C) If applicable, discuss local labor unions' membership and/or... Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS... in union membership or referral practices by local unions involved in highway construction; (iii...

  5. 17 CFR 230.607 - Sales material to be filed.

    Science.gov (United States)

    2010-04-01

    ..., may authorize: (a) Every advertisement, article or other communication proposed to be published in any newspaper, magazine or other periodical; (b) The script of every radio or television broadcast; and (c...

  6. Publications | Page 230 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  7. 24 CFR 1006.230 - Administrative and planning costs.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Administrative and planning costs... Administrative and planning costs. Up to such amount as HUD may authorize, or such other limit as may be... planning expenses of the DHHL relating to carrying out the Act and this part and activities assisted with...

  8. 49 CFR 195.230 - Welds: Repair or removal of defects.

    Science.gov (United States)

    2010-10-01

    ... offshore pipeline being installed from a pipelay vessel, a weld must be removed if it has a crack that is... must be inspected to ensure its acceptability. (c) Repair of a crack, or of any defect in a previously... welding procedure used to make the original weld are met upon completion of the final weld repair. [Amdt...

  9. 17 CFR 230.501 - Definitions and terms used in Regulation D.

    Science.gov (United States)

    2010-04-01

    ... of $5,000,000; (4) Any director, executive officer, or general partner of the issuer of the securities being offered or sold, or any director, executive officer, or general partner of a general partner... securities are being offered for both cash and non-cash consideration, the aggregate offering price shall be...

  10. 33 CFR 230.26 - General considerations in preparing Corps EISs.

    Science.gov (United States)

    2010-07-01

    ... with 40 CFR 1502.21. Footnotes should be used only where their use greatly aids the reader's understanding of the point discussed. Citation in the EIS of material incorporated by reference should be made...

  11. 17 CFR 230.430B - Prospectus in a registration statement after effective date.

    Science.gov (United States)

    2010-04-01

    ...) The registration statement refers to any unnamed selling security holders in a generic manner by... subsequent form of prospectus is first used or the date and time of the first contract of sale of securities... pursuant to this section will, as to a purchaser with a time of contract of sale prior to such effective...

  12. supplementary material taford, s. afr. j. chem., 2013, 66, 221–230 ...

    African Journals Online (AJOL)

    NICO

    microwave. 22. HF microwave. 9. NCCN microwave. 19. HF infrared. 10. NH3 microwave. 17,23,24. HCl. MBER a. 11. PH3 microwave. 25. CO. MBER a. 8. HCCCN infrared. 18. CO infrared. 12,13. CH3F infrared. 26,27. NO. UV-PES b. 14,15. CH3CN. UV-PES b. 14,15. HCN microwave. 16,17. CH3CN microwave. 28. HCN.

  13. 230Th/U ages Supporting Hanford Site-Wide Probabilistic Seismic Hazard Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Paces, James B. [U.S. Geological Survey

    2014-08-31

    This product represents a USGS Administrative Report that discusses samples and methods used to conduct uranium-series isotope analyses and resulting ages and initial 234U/238U activity ratios of pedogenic cements developed in several different surfaces in the Hanford area middle to late Pleistocene. Samples were collected and dated to provide calibration of soil development in surface deposits that are being used in the Hanford Site-Wide probabilistic seismic hazard analysis conducted by AMEC. The report includes description of sample locations and physical characteristics, sample preparation, chemical processing and mass spectrometry, analytical results, and calculated ages for individual sites. Ages of innermost rinds on a number of samples from five sites in eastern Washington are consistent with a range of minimum depositional ages from 17 ka for cataclysmic flood deposits to greater than 500 ka for alluvium at several sites.

  14. Breed distribution of the nt230(del4) MDR1 mutation in dogs.

    Science.gov (United States)

    Gramer, Irina; Leidolf, Regina; Döring, Barbara; Klintzsch, Stefanie; Krämer, Eva-Maria; Yalcin, Ebru; Petzinger, Ernst; Geyer, Joachim

    2011-07-01

    A 4-bp deletion mutation associated with multiple drug sensitivity exists in the canine multidrug resistance (MDR1) gene. This mutation has been detected in more than 10 purebred dog breeds as well as in mixed breed dogs. To evaluate the breed distribution of this mutation in Germany, 7378 dogs were screened, including 6999 purebred and 379 mixed breed dogs. The study included dog breeds that show close genetic relationship or share breeding history with one of the predisposed breeds but in which the occurrence of the MDR1 mutation has not been reported. The breeds comprised Bearded Collies, Anatolian Shepherd Dog, Greyhound, Belgian Tervuren, Kelpie, Borzoi, Australian Cattle Dog and the Irish Wolfhound. The MDR1 mutation was not detected is any of these breeds, although it was found as expected in the Collie, Longhaired Whippet, Shetland Sheepdog, Miniature Australian Shepherd, Australian Shepherd, Wäller, White Swiss Shepherd, Old English Sheepdog and Border Collie with varying allelic frequencies for the mutant MDR1 allele of 59%, 45%, 30%, 24%, 22%, 17%, 14%, 4% and 1%, respectively. Allelic frequencies of 8% and 2% were determined in herding breed mixes and unclassified mixed breeds, respectively. Because of its widespread breed distribution and occurrence in many mixed breed dogs, it is difficult for veterinarians and dog owners to recognise whether MDR1-related drug sensitivity is relevant for an individual animal. This study provides a comprehensive overview of all affected dog breeds and many dog breeds that are probably unaffected on the basis of ∼15,000 worldwide MDR1 genotyping data. Copyright © 2010 Elsevier Ltd. All rights reserved.

  15. 17 CFR 230.144A - Private resales of securities to institutions.

    Science.gov (United States)

    2010-04-01

    ... participations; repurchase agreements; securities owned but subject to a repurchase agreement; and currency, interest rate and commodity swaps. (3) The aggregate value of securities owned and invested on a...

  16. 13 CFR 107.230 - Permitted sources of Private Capital for Licensees.

    Science.gov (United States)

    2010-01-01

    ... include: (1) Funds borrowed by a Licensee from any source. (2) Funds obtained through the issuance of Leverage. (3) Funds obtained directly or indirectly from any Federal, State, or local government agency or instrumentality, except for: (i) Funds invested by a public pension fund; (ii) Funds obtained from the business...

  17. 40 CFR 1051.230 - How do I select engine families?

    Science.gov (United States)

    2010-07-01

    ... family is limited to a single model year. (b) For exhaust emissions, group vehicles in the same engine... system (liquid-cooled vs. air-cooled). (3) Configuration of the fuel system (for example, port fuel... configuration), and approximate bore diameter of cylinders. (8) Numerical level of the emission standards that...

  18. Characteristics and Career Paths of North Carolina School Leaders. REL 2017-230

    Science.gov (United States)

    Osborne-Lampkin, La'Tara; Folsom, Jessica Sidler

    2017-01-01

    Researchers have linked positive student outcomes, including student achievement, to high-quality school leadership. Due in part to this research, the North Carolina Department of Public Instruction and the North Carolina Principals and Assistant Principals' Association are interested in increasing the number of high-quality principals in North…

  19. Liu et al., Afr J Tradit Complement Altern Med. (2016) 13(3):230-242 ...

    African Journals Online (AJOL)

    hepatic tumors of murine hepatocarcinoma cell line H22, and could also promote the proliferation of splenocytes and the phagocytosis of .... the labeled carbohydrate was filtered through 0.22 µm nylon membranes. The filtrate (10 ..... Figure 4: Schematic diagram of the antitumor effects of four molecular communities in SCP ...

  20. : tous les projets | Page 230 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , RESOURCES UTILIZATION, DISASTER PREPAREDNESS, EARLY WARNING SYSTEMS. Région: Brazil, South America, North and Central America. Programme: Changements climatiques. Financement total : CA$ 530,464.00. Adaptation ...

  1. System innovation and life cycle management in service packaging 230: Tarjoilupakkausten systeemi- innovaatio ja elinkaaren hallinta

    Energy Technology Data Exchange (ETDEWEB)

    Aarnio, T. [McDonald' s Oy, Helsinki. (Finland)

    2004-07-01

    International fast food restaurant company McDonald's Oy operates its 87 restaurants in Finland at 38 different communities. An integral part of its environmental work is material flow management. Material flow is homogenous due to the centralized supply of food, service packages, and other utensils. However, different local waste regulations make it extremely challenging to standardize material flow on company level. The project initiated in 1.4.2002 and ended 31.12.2003. Its main target was to increase recycling of used service packaging either as material or as energy. The possibility to develop an efficient recycling system for the whole company was studied. The introduced system consists of (1) the optimized amount of fractions, (2) the selection of recyclable materials, especially service packaging material, (3) the customer friendly sorting station at dining area, (4) means to reach fraction purity at the acceptable level, (5) the efficient fraction logistics, as well as (6) the minimizing amount of landfill waste. This report summarizes the key findings and future challenges identified in the project. (orig.)

  2. 49 CFR 230.20 - Alteration and repair report for steam locomotive boilers.

    Science.gov (United States)

    2010-10-01

    ... boilers. (a) Alterations. When an alteration is made to a steam locomotive boiler, the steam locomotive... steam locomotive boiler, the steam locomotive owner and/or operator shall file with the FRA Regional... the boiler. Whenever welded or riveted repairs are performed on stayed portions of a steam locomotive...

  3. 49 CFR 230.23 - Responsibility for general construction and safe working pressure.

    Science.gov (United States)

    2010-10-01

    ... construction of the steam locomotive boilers under their control. The steam locomotive owner shall establish the safe working pressure for each steam locomotive boiler, after giving full consideration to the... (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND...

  4. Blood Transfusions in Dogs and Cats Receiving Hemodialysis: 230 Cases (June 1997-September 2012).

    Science.gov (United States)

    Langston, C; Cook, A; Eatroff, A; Mitelberg, E; Chalhoub, S

    2017-03-01

    Multiple factors exist that contribute to anemia in dogs and cats receiving hemodialysis, can necessitate transfusion. To describe blood product usage in dogs and cats with acute and chronic kidney disease that were treated with intermittent hemodialysis to determine risk factors associated with the requirement for blood product transfusion. 83 cats and 147 dogs undergoing renal replacement therapy at the Animal Medical Center for acute or chronic kidney disease. Retrospective medical record review of all dogs and cats receiving renal replacement therapy for kidney disease, from June 1997 through September 2012. Blood products (whole blood, packed RBCs, or stromal-free hemoglobin) were administered to 87% of cats and 32% of dogs. The number of dialysis treatments was associated with the requirement for transfusion in cats (adjusted OR 2.21, 95% CI 1.13, 4.32), but not in dogs (adjusted OR 0.98, 95% CI 0.95, 1.03). Administration of a blood product was associated with a higher likelihood of death in dogs (OR 3.198, 95% CI 1.352, 7.565; P = .0098), but not in cats (OR 1.527, 95% CI 0.5404, 4.317, P = .2). Veterinary hospitals with a hemodialysis unit should have reliable and rapid access to safe blood products in order to meet the needs of dogs and cats receiving dialysis. Copyright © 2017 The Authors. Journal of Veterinary Internal Medicine published by Wiley Periodicals, Inc. on behalf of the American College of Veterinary Internal Medicine.

  5. 40 CFR 1054.230 - How do I select emission families?

    Science.gov (United States)

    2010-07-01

    ... of catalytic converters. (6) The number and arrangement of cylinders (such as in-line or vee... of this part. (e) Select test engines from the emission family as described in 40 CFR 1065.401. (f...

  6. 40 CFR 1045.230 - How do I select engine families?

    Science.gov (United States)

    2010-07-01

    ... aspirated). (3) The number, location, volume, and composition of catalytic converters. (4) The number... requirements in subpart B of this part. (e) You may certify dual-fuel or flexible-fuel engines in a single...

  7. 22 CFR 230.05 - Non-impairment of the Guarantee.

    Science.gov (United States)

    2010-04-01

    ... agreement or other document executed by a Noteholder, USAID, the Fiscal Agent or the Borrower in connection... guarantee provision shall not, however, be operative with respect to any loss arising out of fraud or...

  8. 76 FR 12022 - Foreign-Trade Zone 230-Greensboro, NC; Application for Subzone; VF Jeanswear (Apparel...

    Science.gov (United States)

    2011-03-04

    ... status for the warehousing and distribution facility of VF Jeanswear, located in Mocksville, North... warehousing and distribution of foreign-origin apparel (duty rates 16.6%-28.6%) for the U.S. market and export... realize logistical benefits through the use of certain customs procedures. The request indicates that the...

  9. TRAP230/ARC240 and TRAP240/ARC250 Mediator subunits are functionally conserved through evolution

    OpenAIRE

    Samuelsen, Camilla O.; Baraznenok, Vera; Khorosjutina, Olga; Spåhr, Henrik; Kieselbach, Thomas; Holmberg, Steen; Gustafsson, Claes M.

    2003-01-01

    In Saccharomyces cerevisiae Mediator, a subgroup of proteins (Srb8, Srb9, Srb10, and Srb11) form a module, which is involved in negative regulation of transcription. Homologues of Srb10 and Srb11 are found in some mammalian Mediator preparations, whereas no clear homologues have been reported for Srb8 and Srb9. Here, we identify a TRAP240/ARC250 homologue in Schizosaccharomyces pombe and demonstrate that this protein, spTrap240, is stably associated with a larger form of Mediator, which...

  10. 7 CFR 2.30 - Director, Office of Budget and Program Analysis.

    Science.gov (United States)

    2010-01-01

    ... and implementing USDA policies and programs. (6) Review and analyze legislation, regulations, and... budget. (7) Monitor ongoing studies with significant program or policy implications. (b) The following... financial plans. ...

  11. Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    Directory of Open Access Journals (Sweden)

    Diab S. M.

    2008-01-01

    Full Text Available A good description of the excited positive and negative parity states of radium nuclei (Z=88, N=130-142 is achieved using the interacting boson approximation model (IBA-1. The potential energy surfaces, energy levels, parity shift, electromagnetic transition rates B(E1, B(E2 and electric monopole strength X(E0/E2 are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. Due to this interaction the $Delta I = 1$ staggering effect, between the energies of the ground state band and the negative parity state band, is produced including beat patterns.

  12. 40 CFR 280.230 - Operating an underground storage tank or underground storage tank system.

    Science.gov (United States)

    2010-07-01

    ... underground storage tank or underground storage tank system. (a) Operating an UST or UST system prior to...) Operating an UST or UST system after foreclosure. The following provisions apply to a holder who, through..., the purchaser must decide whether to operate or close the UST or UST system in accordance with...

  13. Afolabi et al., Afr J Tradit Complement Altern Med. (2013) 10(5):230 ...

    African Journals Online (AJOL)

    AJTCAM

    flavonoids and carotenoids are examples of exogenous antioxidants found in food (Asma et al., 2005). Moringa oleifera (Horse-radish tree or Drumstick) is a medium-sized (about 10 metres high) tree belonging to, and most widely known species of the Moringaceae family cultivated in the tropical belt (Jahn, 1988).

  14. 40 CFR 230.60 - General evaluation of dredged or fill material.

    Science.gov (United States)

    2010-07-01

    ... substances designated as hazardous under section 311 of the Clean Water Act (See 40 CFR part 116); (5... of substantial natural deposits of minerals or other substances which could be released to the... (previous tests, the presence of polluting industries and information about their discharge or runoff into...

  15. 40 CFR 230.75 - Actions affecting plant and animal populations.

    Science.gov (United States)

    2010-07-01

    ... endangered -species; (d) Using planning and construction practices to institute habitat development and... techniques can be used to minimize adverse impacts and to compensate for destroyed habitat. Additional criteria for compensation measures are provided in subpart J of this part. Use techniques that have been...

  16. 33 CFR 155.230 - Emergency control systems for tank barges.

    Science.gov (United States)

    2010-07-01

    ... HOMELAND SECURITY (CONTINUED) POLLUTION OIL OR HAZARDOUS MATERIAL POLLUTION PREVENTION REGULATIONS FOR..., and must include a visual inspection of the equipment that comprises the system in accordance with the... emergency retrieval system is ready for immediate use, and must include a visual inspection of the equipment...

  17. 17 CFR 230.134a - Options material not deemed a prospectus.

    Science.gov (United States)

    2010-04-01

    ... prospectus. Written materials, including advertisements, relating to standardized options, as that term is... or more strategies; And, Provided further, That: (a) The potential risks related to options trading generally and to each strategy addressed are explained; (b) No past or projected performance figures...

  18. 39 CFR 230.11 - What special definitions apply to these rules?

    Science.gov (United States)

    2010-07-01

    ... accumulations, records of meetings and conversations, film impressions, magnetic tapes, computer discs, and sound or mechanical reproductions. (e) Employee or Office of Inspector General employee, for the purpose..., or subpoena for testimony or the production of documents. (d) Document means all records, papers, or...

  19. 49 CFR 230.96 - Main, side, and valve motion rods.

    Science.gov (United States)

    2010-10-01

    ... bore of main rod bearings shall not exceed pin diameters more than 3/32 inch at front or back end. The total lost motion at both ends shall not exceed 5/32 inch. (g) Side rod bearings. The bore of side rod.... The total amount of side motion of each rod on its crank pin shall not exceed 1/4 inch. (e) Oil and...

  20. 17 CFR 230.801 - Exemption in connection with a rights offering.

    Science.gov (United States)

    2010-04-01

    .... ownership. U.S. holders hold no more than 10 percent of the outstanding class of securities that is the... thereto, in English, to the Commission on Form CB (§ 239.800 of this chapter) by the first business day... rights offering is exempt from the provisions of Section 5 of the Act (15 U.S.C. 77e), so long as the...

  1. 40 CFR 230.98 - Mitigation banks and in-lieu fee programs.

    Science.gov (United States)

    2010-07-01

    ..., including uncertainties in construction and real estate expenses. The cost per unit of credit must also take... maintenance may be required to ensure their long-term viability and sustainability. Examples of acceptable... to support the long-term sustainability of the mitigation bank. (viii) For a proposed in-lieu fee...

  2. Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    OpenAIRE

    Diab S. M.

    2008-01-01

    A good description of the excited positive and negative parity states of radium nuclei (Z=88, N=130-142) is achieved using the interacting boson approximation model (IBA-1). The potential energy surfaces, energy levels, parity shift, electromagnetic transition rates B(E1), B(E2) and electric monopole strength X(E0/E2) are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. ...

  3. 12 CFR Appendix A to Part 230 - Annual Percentage Yield Calculation

    Science.gov (United States)

    2010-01-01

    ... pays 5.25% on $2,500 and 5.50% on $5,500 (the difference between $8,000 and the first tier cut-off of... the tiers in Method A, has the same annual percentage yield throughout). The low figure for an annual...% interest rate plus interest on $.01 at 5.50%. For the low end of the second tier, therefore, the annual...

  4. Page 1 Bull. Mater, Sci, Vol. 20, No. 2, April 1997, pp. 141-230. (C ...

    Indian Academy of Sciences (India)

    fullerenes (figure 1) formed entirely of carbon in sp-hybridized state. The fullerenes are considered as the third allotrope of carbon after diamond and graphite. The stability of C molecule is due to the structure in which the carbon atoms are arranged at the 60 vertices of a truncated icosahedron composed of 32 faces, a.

  5. The Radio/Gamma-Ray Connection from 120 MHz to 230 GHz

    Directory of Open Access Journals (Sweden)

    Marcello Giroletti

    2016-09-01

    Full Text Available Radio loud active galactic nuclei are composed of different spatial features, each one characterized by different spectral properties in the radio band. Among them, blazars are the most common class of sources detected at gamma-rays by Fermi, and their radio emission is dominated by the flat spectrum compact core. In this contribution, we explore the connection between emission at high energy revealed by Fermi and at radio frequencies. Taking as a reference the strong and very highly significant correlation found between gamma rays and cm-λ radio emission, we explore the different behaviours found as we change the energy range in gamma rays and in radio, therefore changing the physical parameters of the zones involved in the emitted radiation. We find that the correlation weakens when we consider (1 gamma rays of energy above 10 GeV (except for high synchrotron peaked blazars or (2 low frequency radio data taken by the Murchison Widefield Array; on the other hand, the correlation strengthens when we consider mm-λ data taken by Atacama Large Millimeter Array (ALMA.

  6. 230. Actividad antitrombina III en pacientes intervenidos bajo circulación extracorpórea

    Directory of Open Access Journals (Sweden)

    A.L. Fernández

    2010-01-01

    Conclusiones: La CEC disminuye la AT-III. La administración intraoperatoria de dosis bajas de antitrombina es segura, y logra un aumento significativo de la AT-III, aunque no se han demostrado cambios clínicos significativos ni en los parámetros de anticoagulación/fibrinólisis.

  7. 12 CFR Appendix B to Part 230 - Model Clauses and Sample Forms

    Science.gov (United States)

    2010-01-01

    ... maturity of this account to withdraw funds without penalty. (2) Non-automatically renewable time accounts... rate and annual percentage yield for your new account. (b) Non-automatically renewable time accounts...) Automatically renewable time accounts This account will automatically renew at maturity. You will have days...

  8. 17 CFR 230.498 - Summary Prospectuses for open-end management investment companies.

    Science.gov (United States)

    2010-04-01

    ... Fund's name and the Class or Classes, if any, to which the Summary Prospectus relates. (ii) The exchange ticker symbol of the Fund's shares or, if the Summary Prospectus relates to one or more Classes of... must provide an Internet address, other than the address of the Commission's electronic filing system...

  9. 17 CFR 230.433 - Conditions to permissible post-filing free writing prospectuses.

    Science.gov (United States)

    2010-04-01

    ... accessing the issuer's Web site and provide the Internet address and the particular location of the... offering participant, after such terms have been established for all classes in the offering; and (ii) Any... two days of the later of the date such final terms have been established for all classes of the...

  10. 46 CFR 8.230 - Minimum standards for a recognized classification society.

    Science.gov (United States)

    2010-10-01

    ...) Not have any business interest in, or share of ownership of, any vessel in its classed fleet; and (23) Not be involved in any activities which could result in a conflict of interest. (b) Recognition may be... English language; (9) Have adequate resources, including research, technical, and managerial staff, to...

  11. Page 1 230 A Mary Selvam et al Malkus J S 1952 Tellus 4 71 ...

    Indian Academy of Sciences (India)

    Miller FR and Keshava Murthy R N 1967 Structure of an Arabian sea summer monsoon system,. (Honolulu, University of Hawaii; East–West Press) pp. 94. Ruskin A E and Scott W D 1974 in Weather and climate modification, ed. W N Hess (New York: John Wiley) pp. 842 -. Siegel S 1956 Non-parametric statistics for the ...

  12. Editorial Revista Contaduría y Administración No.230

    OpenAIRE

    López Herrera Francisco

    2011-01-01

    En este número de Contaduría y Administración, Homero Zambrano nos presenta su artículo Minimización del tracking error con solución analítica para portafolios indizados, en el cual el autor se ocupa de desarrollar una solución analítica para una de las herramientas ocupadas en la administración de fondos indizados de activos financieros. Además de proporcionar dicha solución, Zambrano demuestra que si bien la minimización del error de seguimiento de un índice de referencia es relativamente f...

  13. 36 CFR 230.40 - Eligible practices for cost-share assistance.

    Science.gov (United States)

    2010-07-01

    ...) Management Plan Development—Development or revision of a management plan that must meet the minimum standards..., diseases, and animal damage to established stands. (8) Invasive Species Control—Establishment, maintenance and restoration practices primarily to detect, monitor, eradicate, or control the spread of invasive...

  14. TACIS 91: Application of leak-before-break concept in VVER 440-230

    Energy Technology Data Exchange (ETDEWEB)

    Bartholome, G.; Faidy, C.; Franco, C. [and others

    1997-04-01

    The applicability of the leak-before-break (LBB) concept for primary piping in the first generation of WWER type plants in Russia is investigated. The procedures for LBB behavior used in France and Germany are applied, and the evaluation is discussed within the framework of the European Technical Assistance for the Community of Independent States (TACIS) project. Emphasis is placed on experimental validation of national and international engineering practice for evaluating and optimizing existing installations. Design criteria of WWER plants are compared to western standard design.

  15. 17 CFR 230.403 - Requirements as to paper, printing, language and pagination.

    Science.gov (United States)

    2010-04-01

    ... submit instead a fair and accurate English translation of the entire foreign language document, except as...) When submitting an English summary or English translation of a foreign language document under this... may submit a copy of the unabridged foreign language document when including an English summary or...

  16. TRAP230/ARC240 and TRAP240/ARC250 Mediator subunits are functionally conserved through evolution

    DEFF Research Database (Denmark)

    Samuelsen, Camilla O; Baraznenok, Vera; Khorosjutina, Olga

    2003-01-01

    In Saccharomyces cerevisiae Mediator, a subgroup of proteins (Srb8, Srb9, Srb10, and Srb11) form a module, which is involved in negative regulation of transcription. Homologues of Srb10 and Srb11 are found in some mammalian Mediator preparations, whereas no clear homologues have been reported......Srb8) regulate the same distinct subset of genes and have indistinguishable phenotypic characteristics. Importantly, Mediator containing the spSrb8/spTrap240/spSrb10/spSrb11 subunits is isolated only in free form, devoid of RNA polymerase II. In contrast, Mediator lacking this module associates...

  17. 40 CFR 1060.230 - How do I select emission families?

    Science.gov (United States)

    2010-07-01

    ... subject to diurnal emission requirements. (4) Gasket material. (5) Emission control strategy. (6) Family... life will be similar. The provisions of this paragraph (f) do not exempt any engines or equipment from...

  18. 36 CFR 230.39 - State priority plan-financial assistance.

    Science.gov (United States)

    2010-07-01

    ... with Federal financial accounting standards. If an existing cost-share program is used, a copy of the... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false State priority plan-financial...—financial assistance. (a) Cost-share financial assistance includes a wide range of activities and practices...

  19. S. Afr. Tydskr. Veek. I , 225 -230 ( l97l ) 'N OORSIG VAN DIE ...

    African Journals Online (AJOL)

    , 1967). 2.3. Telling: Tel die gebonde fraksie en lees die hormoon (s) kon- sentrasie van die standaardkurwe af (Mancuso, Dell'Aqua,. Erickson, Migvest & Diczfalusy, 1965). C. Radioimmunologiese bepoling von estrogene en pro- gesteroon.

  20. 17 CFR 230.606 - Offering not in excess of $100,000.

    Science.gov (United States)

    2010-04-01

    ... forth in an offering circular. (b) No advertisement, article or other communication published in any newspaper, magazine or other periodical and no radio or television broadcast in regard to the offering shall...

  1. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  2. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  3. MILROY, Lesley. Observing and Analysing Natural Language: A Critical Account of Sociolinguistic Method. Oxford: Basil Blackwell, 1987. 230pp. MILROY, Lesley. Observing and Analysing Natural Language: A Critical Account of Sociolinguistic Method. Oxford: Basil Blackwell, 1987. 230pp.

    Directory of Open Access Journals (Sweden)

    Iria Werlang Garcia

    2008-04-01

    Full Text Available Lesley Milroy's Observing and Analysing Natural Language is a recent addition to an ever growing number of publications in the field of Sociolinguistics. It carries the weight of one of the experienced authors in the current days in the specified field and should offer basic information to both newcomers and established investigators in natural language. Lesley Milroy's Observing and Analysing Natural Language is a recent addition to an ever growing number of publications in the field of Sociolinguistics. It carries the weight of one of the experienced authors in the current days in the specified field and should offer basic information to both newcomers and established investigators in natural language.

  4. 75 FR 33159 - Airworthiness Directives; Bell Helicopter Textron Canada Model 222, 222B, 222U, 230, and 430...

    Science.gov (United States)

    2010-06-11

    ... based on hours TIS. Additionally, this AD does not require operators to send their blades to Rotor... does not have an excepted S/N or code, certificated in any category. Helicopter model Helicopter S/N... area. Let the area dry for 30 minutes to 1 hour. Then, apply one sealer coat of polyurethane, MILC85285...

  5. 20 CFR 668.230 - How will we determine an entity's “ability to administer funds”?

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN PROGRAMS UNDER TITLE I OF THE WORKFORCE INVESTMENT ACT Service... be established by a satisfactory Federal audit record. It may also be established by a recent record...

  6. SU-E-T-230: Measurement of Proton-Activated Positron Emission with PRESAGE 3-D Dosimeters

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, M; Mawlawi, O; Ibbott, G [University of Texas MD Anderson Cancer Center, Houston, TX (United States); Adamovics, J [John Adamovics, Skillman, NJ (United States)

    2014-06-01

    Purpose: Measurement of positron emission following proton beam irradiation of a target has been studied as a method of in-vivo dosimetry. Relative dosimetry studies between a phantom and treatment plan are susceptible to range uncertainties from material heterogeneities and setup error. By using the radiochromic polyurethane dosimeter PRESAGE, we can correlate the proton dose distribution to the PET activity measurement within a single detector. The PRESAGE formulation used was developed for high-LET proton radiotherapy, has similar density and RLSP to tissue, and consists of a greater carbon component, which gives it a higher positron signal than many other 3D detectors. Methods: Three cylindrical PRESAGE dosimeters were irradiated semi-uniformly to 500 cGy with 180- MeV protons. The beam was directed along the dosimeter axis and delivered a 2-cm SOBP at the center of the dosimeter. The dosimeters were rushed to a nearby PET/CT where imaging began within 15 minutes, less than a single half-life of 11C. A 3-hr measurement captured the full activation decay. Afterwards, the dose profiles were measured by optical-CT. A direct comparison between the measured dose and the positron emission was performed using CERR software. Results: The correlations between dose distributions and PET activity were consistent with previous studies in that the proximal region of the SOBP displayed the highest activity. The spatial distributions between the dose and activity were similar. Along the central axis of the beam, we found a shift in the distal 80% of 1 cm. The lateral profile showed good agreement between dose and activity. PET imaging times between 30-min and 3-hrs showed <5% discrepancy. Conclusion: PRESAGE dosimeters offer a strong and unique potential to accurately correlate dosimetric and PET activation information. Implementation in an anthropomorphic phantom could be used to study representative treatment plans. NIH grant 5R01CA100835.

  7. Nodules thyroïdiens: à propos de 230 cas opérés au CHU de Conakry.

    African Journals Online (AJOL)

    La majorité des nodules (72,6%) était de siège lobo-isthmique et le goitre multi nodulaire solide était prédominant (59,1%). La thyroïdectomie subtotale a été la plus pratiquée (55,2%). L'examen anatomopathologique a montré que 95,6%des nodules étaient bénins contre 10 cas de cancer (4,3%). Les suites opératoires ont ...

  8. 17 CFR 230.701 - Exemption for offers and sales of securities pursuant to certain compensatory benefit plans and...

    Science.gov (United States)

    2010-04-01

    ... transactions are not exempt from the antifraud, civil liability, or other provisions of the federal securities... defined in Rule 405 must provide a reconciliation to generally accepted accounting principles in the...

  9. 76 FR 45609 - Notice of Availability of the Draft Environmental Impact Statement for the Gateway West 230/500...

    Science.gov (United States)

    2011-07-29

    ..., Caribou-Targhee National Forest. Donald A. Simpson, Wyoming State Director. BILLING CODE 4310-22-P ... electric transmission line from the proposed Windstar Substation near the Dave Johnston Power Plant at... units of the National Forest System: 7 miles in the Douglas Ranger District of the Medicine Bow-Routt...

  10. 41 CFR 102-73.230 - When must Federal agencies submit a prospectus to lease real property?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false When must Federal... Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 73-REAL ESTATE ACQUISITION Acquisition by Lease Limitations on the Use of Delegated...

  11. 17 CFR 230.903 - Offers or sales of securities by the issuer, a distributor, any of their respective affiliates...

    Science.gov (United States)

    2010-04-01

    ... applicable) are denominated in a currency other than U.S. dollars and such securities are neither convertible into U.S. dollar-denominated securities nor linked to U.S. dollars (other than through related currency or interest rate swap transactions that are commercial in nature) in a manner that in effect converts...

  12. 20 CFR 645.230 - What general fiscal and administrative rules apply to the use of Federal funds?

    Science.gov (United States)

    2010-04-01

    ... Acquisition Regulation (FAR) at 48 CFR Part 31. (d) Information technology costs. In addition to the allowable cost provisions identified in § 645.235 of this subpart, the costs of information technology—computer hardware and software—will only be allowable under WtW grants when such computer technology is “Year 2000...

  13. Effect of intravaginal dehydroepiandrosterone (DHEA) on the female sexual function in postmenopausal women: ERC-230 open-label study.

    Science.gov (United States)

    Bouchard, Céline; Labrie, Fernand; Derogatis, Leonard; Girard, Ginette; Ayotte, Normand; Gallagher, John; Cusan, Leonello; Archer, David F; Portman, David; Lavoie, Lyne; Beauregard, Adam; Côté, Isabelle; Martel, Céline; Vaillancourt, Mario; Balser, John; Moyneur, Erick

    2016-03-01

    Intravaginal DHEA (dehydroepiandrosterone, prasterone), the exclusive precursor of androgens and estrogens in postmenopausal women, has previously been shown to improve all the domains of sexual function by a strictly local action in the vagina. The well recognized female sexual function index (FSFI) questionnaire was used in the present study. The long-term effect of 52-week treatment with daily intravaginal 0.50% (6.5 mg) DHEA was evaluated on the various domains of female sexual function using the FSFI questionnaire at baseline, Week 26 and Week 52. One hundred and fifty-four postmenopausal women with at least one mild to severe symptom of vulvovaginal atrophy (VVA) and who have completed the FSFI questionnaire at baseline and at least one post-baseline timepoint were included in the analysis. The FSFI domains desire, arousal, lubrication, orgasm, satisfaction and pain were increased by 28%, 49%, 115%, 51%, 41% and 108%, respectively (pDHEA and all its metabolites, including estradiol and testosterone, show no meaningful change, the present clinical data indicate a stimulatory effect of intravaginal DHEA through a strictly local action in agreement with the preclinical data showing that the androgens made locally from DHEA in the vagina induce an increase in local nerve density.

  14. Superconducting fault current limiter. First quarterly technical progress report, August 8-November 7, 1978. [230 kV

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-01

    The purpose of this project is to investigate the suitability of using a superconducting fault current limiter (SCFCL) in conjunction with other superconducting apparatus or transmission lines. Literature search, consultation, analysis and experimentation are to be carried out to derive a set of operational parameters for a SCFCL and to answer key questions as to the feasibility of a superconducting element to meet these performance objectives. During the first quarter year of effort, substantial progress has been made on several of these program tasks. A comprehensive search of the literature on SCFCL devices and applications was initiated; the references which were obtained to date are evaluated within a framework into which additional references can be added as they are received. Consultation with key researchers has occurred to supplement and update the literature search. Device analyses have also been started in order to determine to what extent the various proposed SCFCL devices meet the requirements of the power system.

  15. 17 CFR 230.610a - Schedule A: Contents of offering circular for small business investment companies; Schedule B...

    Science.gov (United States)

    2010-04-01

    ..., controlled or held by issuer Value Percentage of total value of portfolio companies Instructions 1. Provide the city and state for address of portfolio companies. 2. State the value as of date of balance sheet... forseeable future. (b) Discuss briefly the principal risk factors associated with investment in the issuer...

  16. 75 FR 71540 - Airworthiness Directives; Bell Helicopter Textron Canada Model 222, 222B, 222U, 230, and 430...

    Science.gov (United States)

    2010-11-24

    ... bristle brush to remove any residue. If you find any corrosion that is red or orange in color, magnetic... Acetone and a nylon bristle brush removing all contaminates to allow for inspection. Inspecting the grind... piston rod by applying brush cadmium plating to all bare and reworked areas. Reassembling the servo...

  17. 20 CFR 30.230 - What are the criteria necessary to establish that an employee contracted a covered illness under...

    Science.gov (United States)

    2010-04-01

    ... employed in a uranium mine or mill located in Colorado, New Mexico, Arizona, Wyoming, South Dakota... such a mine or mill during that same period, and that he or she: (i) Has been diagnosed with an illness...

  18. Testing an e2v CCD230-42 sensor for dark current performance at ambient temperatures - Final Paper

    Energy Technology Data Exchange (ETDEWEB)

    Dungee, Ryan [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-08-20

    The design of the Guidance Focus and Alignment (GFA) system for the Dark Energy Spectroscopic Instrument (DESI) project calls for a set of charge-coupled devices (CCDs) which operate at ambient temperature. Here we assess the performance of these CCDs under such conditions. Data was collected from –21°C to 28°C and used to determine the effect of temperature on the effectiveness of dark current subtraction. Comparing the dark current uncertainty to our expected signal has shown that the DESI design specifications will be met without need for significant changes.

  19. 5 CFR 230.402 - Agency authority to make emergency-indefinite appointments in a national emergency.

    Science.gov (United States)

    2010-01-01

    ...) Definition. A national emergency must meet all of the following conditions: (i) It was declared by the...-indefinite appointments is necessary for economy and efficiency. Except as provided by paragraphs (c) and (d...

  20. Tritium and helium release from beryllium pebbles neutron-irradiated up to 230appm tritium and 3000appm helium

    Directory of Open Access Journals (Sweden)

    Vladimir Chakin

    2016-12-01

    Full Text Available Study of tritium and helium release from beryllium pebbles with diameters of 0.5 and 1mm after high-dose neutron irradiation at temperatures of 686–968K was performed. The release rate always has a single peak, and the peak temperatures at heating rates of 0.017K/s and 0.117K/s lie in the range of 1100–1350K for both tritium and helium release. The total tritium release from 1mm pebbles decreases considerably by increasing the irradiation temperature. The total tritium release from 0.5mm pebbles is less than that from 1mm pebbles and remains constant regardless of the irradiation temperature. At high irradiation temperatures, open channels are formed which contribute to the enhanced tritium release.