WorldWideScience

Sample records for actinium 230

  1. Actinium radioisotope products of enhanced purity

    Science.gov (United States)

    Meikrantz, David Herbert; Todd, Terry Allen; Tranter, Troy Joseph; Horwitz, E. Philip

    2010-06-15

    A product includes actinium-225 (.sup.225Ac) and less than about 1 microgram (.mu.g) of iron (Fe) per millicurie (mCi) of actinium-225. The product may have a radioisotopic purity of greater than about 99.99 atomic percent (at %) actinium-225 and daughter isotopes of actinium-225, and may be formed by a method that includes providing a radioisotope mixture solution comprising at least one of uranium-233 (.sup.233U) and thorium-229 (.sup.229Th), extracting the at least one of uranium-233 and thorium-229 into an organic phase, substantially continuously contacting the organic phase with an aqueous phase, substantially continuously extracting actinium-225 into the aqueous phase, and purifying the actinium-225 from the aqueous phase. In some embodiments, the product may include less than about 1 nanogram (ng) of iron per millicurie (mCi) of actinium-225, and may include less than about 1 microgram (.mu.g) each of magnesium (Mg), Chromium (Cr), and manganese (Mn) per millicurie (mCi) of actinium-225.

  2. Radioactive disequilibrium of uranium and actinium series nuclides in soil

    International Nuclear Information System (INIS)

    Megumi, K.

    1979-01-01

    The concentration of uranium series nuclides ( 238 U, 234 U, 230 Th, 226 Ra, and 210 Pb) and actinium series nuclides ( 235 U and 227 Ac) were determined by γ ray spectrometry for size-separated soil samples collected in Murho and originating from the weathering of granite rock. Each activity ratio of a descendant to 238 U or 235 U is found to be larger than unity. Extraction tests show that approximately 50% of the uranium series nuclides reside on the surface of soil particles and approximately 80% of the 230 Th is surface correlated. Because of the anomalously high radioactivity levels, it was possible to obtain sufficient data to estimate the age of weathering of the soil. A weathering age of >10 3 years was estimated from the 230 Th and 226 Ra surface-correlated activities

  3. Actinium extraction with di(2-ethylhexyl)phosphoric acid

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Rodionova, L.M.; Pyzhova, Z.I.; Myasoedov, B.F.

    1978-01-01

    The extraction of actinium with hdehp from HNO 3 and HClO 4 solutions has been studied in a wide range of acid concentrations. Radioactive Ac 228 has been used as a tracer. Benzene and n-octane have been used as solvents. It has been established that Ac is extracted quantitatively with 0.5 mhdehp in n-octane at HNO 3 concentration -2 M and HClO 4 ( -2 M. Actinium extraction from 8.5 M HClO 4 is 94.7%. The mechanism of actinium extraction has been considered. The composition of the extracted compounds was established, the extraction constant was determined. The most probable form of actinium existance in an organic phase upon extraction from weakly acid solutions is a Asub(c)Xsub(3)x2HX complex and from strongly acid solutions - a solvated complex acid of the HAc(ClO 4 ) 4 x2HX type (where HX - is hdehp)

  4. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  6. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  7. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  8. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  9. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  10. 17 CFR 230.300-230.346 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... REGULATIONS, SECURITIES ACT OF 1933 Regulation A-Conditional Small Issues Exemption §§ 230.300-230.346... THIS CHAPTER), WHICH GOVERNS THE PREPARATION AND SUBMISSION OF DOCUMENTS IN ELECTRONIC FORMAT. MANY PROVISIONS RELATING TO THE PREPARATION AND SUBMISSION OF DOCUMENTS IN PAPER FORMAT CONTAINED IN THIS...

  11. 17 CFR 230.702(T)-230.703(T) - [Reserved

    Science.gov (United States)

    2010-04-01

    ... Small Business Investment Companies §§ 230.702(T)-230.703(T) [Reserved] Exemptions for Cross-Border Rights Offerings, Exchange Offers and Business Combinations Source: Sections 230.800 through 230.802... with § 230.801 and § 230.802 but are part of a plan or scheme to evade the registration provisions of...

  12. 49 CFR 230.111 - Spring rigging.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Spring rigging. 230.111 Section 230.111... Tenders Trucks, Frames and Equalizing System § 230.111 Spring rigging. (a) Arrangement of springs and equalizers. Springs and equalizers shall be arranged to ensure the proper distribution of weight to the...

  13. 33 CFR 230.3 - References.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 230.3 Section 230.3 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.3 References. (a) Executive Order 12291, Federal Regulation, February 17...

  14. 38 CFR 41.230 - Audit costs.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Audit costs. 41.230 Section 41.230 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 41.230 Audit costs. (a) Allowable...

  15. 46 CFR 132.230 - Spare charges.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Spare charges. 132.230 Section 132.230 Shipping COAST... Portable and Semiportable Fire Extinguishers § 132.230 Spare charges. (a) Except as provided by paragraph (b) or (c) of this section, each vessel must carry spare charges for 50 percent of the portable fire...

  16. 40 CFR 230.22 - Water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water. 230.22 Section 230.22... Chemical Characteristics of the Aquatic Ecosystem § 230.22 Water. (a) Water is the part of the aquatic... the liquid phase and is contained by the substrate. Water forms part of a dynamic aquatic life...

  17. 22 CFR 230.16 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 230.16 Section 230.16 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States of...

  18. 33 CFR 230.21 - Adoption.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Adoption. 230.21 Section 230.21 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.21 Adoption. See 40 CFR 1506.3. A district commander will normally adopt...

  19. 49 CFR 230.76 - Piston travel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Piston travel. 230.76 Section 230.76... Tenders Brake and Signal Equipment § 230.76 Piston travel. (a) Minimum piston travel. The minimum piston travel shall be sufficient to provide proper brake shoe clearance when the brakes are released. (b...

  20. 40 CFR 230.97 - Management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Management. 230.97 Section 230.97... Losses of Aquatic Resources § 230.97 Management. (a) Site protection. (1) The aquatic habitats, riparian.... For government property, long-term protection may be provided through federal facility management...

  1. 49 CFR 230.43 - Gauge siphon.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gauge siphon. 230.43 Section 230.43 Transportation... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.43 Gauge siphon. The steam gauge supply pipe shall have a siphon on it of ample capacity to prevent...

  2. 15 CFR 230.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... General Information § 230.1 Introduction. This part states the procedure for ordering Standard Reference... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Introduction. 230.1 Section 230.1... measurement systems, evaluate measurement methods, or produce scientific data that can be referred to a common...

  3. 46 CFR 183.230 - Temperature ratings.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Temperature ratings. 183.230 Section 183.230 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) ELECTRICAL INSTALLATION General Requirements § 183.230 Temperature ratings. Temperature ratings of electrical...

  4. 40 CFR 230.25 - Salinity gradients.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Salinity gradients. 230.25 Section 230.25 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b... Physical and Chemical Characteristics of the Aquatic Ecosystem § 230.25 Salinity gradients. (a) Salinity...

  5. 49 CFR 230.73 - Air gauges.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Air gauges. 230.73 Section 230.73 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Steam Locomotives and Tenders Brake and Signal Equipment § 230.73 Air gauges....

  6. 49 CFR 230.35 - Pressure testing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Pressure testing. 230.35 Section 230.35 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Pressure Testing of Boilers § 230.35 Pressure testing. The temperature of the steam locomotive boiler shall...

  7. 49 CFR 230.114 - Wheel centers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Wheel centers. 230.114 Section 230.114... Tenders Wheels and Tires § 230.114 Wheel centers. (a) Filling blocks and shims. Driving and trailing wheel... and the wheel center, not more than two thicknesses of shims may be used, one of which must extend...

  8. 17 CFR 230.902 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... accordance with § 230.135 or § 230.135c; (vii) Providing any journalist with access to press conferences held... outstanding of its debt securities, the greater of liquidation preference or par value of its securities... value of its securities described in § 230.902(a)(1), and the principal amount or principal balance of...

  9. 12 CFR 230.4 - Account disclosures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Account disclosures. 230.4 Section 230.4 Banks... IN SAVINGS (REGULATION DD) § 230.4 Account disclosures. (a) Delivery of account disclosures—(1) Account opening. (i) General. A depository institution shall provide account disclosures to a consumer...

  10. 22 CFR 230.14 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 230.14 Section 230.14 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.14 Arbitration. Any... arbitration to be held in Washington, DC in accordance with the then prevailing rules of the American...

  11. 33 CFR 230.18 - Availability.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Availability. 230.18 Section 230.18 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.18 Availability. Draft and final EISs and supplements will be...

  12. 40 CFR 230.41 - Wetlands.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Wetlands. 230.41 Section 230.41... Aquatic Sites § 230.41 Wetlands. (a)(1) Wetlands consist of areas that are inundated or saturated by...) Where wetlands are adjacent to open water, they generally constitute the transition to upland. The...

  13. 49 CFR 230.95 - Guides.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Guides. 230.95 Section 230.95 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... § 230.95 Guides. Guides shall be securely fastened and maintained in a safe and suitable condition for...

  14. 40 CFR 230.44 - Coral reefs.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Coral reefs. 230.44 Section 230.44... Aquatic Sites § 230.44 Coral reefs. (a) Coral reefs consist of the skeletal deposit, usually of calcareous... organisms present in growing portions of the reef. (b) Possible loss of values: The discharge of dredged or...

  15. 12 CFR 230.8 - Advertising.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Advertising. 230.8 Section 230.8 Banks and... SAVINGS (REGULATION DD) § 230.8 Advertising. (a) Misleading or inaccurate advertisements. An advertisement... obtain the advertised annual percentage yield. For tiered-rate accounts, the minimum balance required for...

  16. 29 CFR 99.230 - Audit costs.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Audit costs. 99.230 Section 99.230 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.230 Audit... provisions of this part are allowable charges to Federal awards. The charges may be considered a direct cost...

  17. 24 CFR 583.230 - Environmental review.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Environmental review. 583.230... § 583.230 Environmental review. (a) Activities under this part are subject to HUD environmental regulations in part 58 of this title, except that HUD will perform an environmental review in accordance with...

  18. 7 CFR 65.230 - Production step.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Production step. 65.230 Section 65.230 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE...

  19. 49 CFR 230.5 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 230.5 Section 230.5 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... effect. The Locomotive Boiler Inspection Act (49 U.S.C. 20701-20703) preempts all State laws or...

  20. 49 CFR 230.9 - Information collection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Information collection. 230.9 Section 230.9 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Information collection. (a) [Reserved] (b) The information collection requirements are found in the following...

  1. 12 CFR 19.230 - Scope.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.230 Section 19.230 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Order To Dismiss a... and part 6 of this chapter. ...

  2. 40 CFR 230.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... U.S. 1 (1976). (p) The term pollution means the man-made or man-induced alteration of the chemical... of vegetation typically adapted for life in saturated soil conditions. Wetlands generally include... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 230.3 Section 230.3...

  3. 23 CFR 230.121 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Reports. 230.121 Section 230.121 Highways FEDERAL... Reports. (a) Employment reports on Federal-aid highway construction contracts not subject to “Hometown” or... reporting requirements. FHWA Form PR-1391, Federal-Aid Highway Construction Contractors Annual EEO Report...

  4. 22 CFR 230.15 - Notice.

    Science.gov (United States)

    2010-04-01

    ... shall be actually received by USAID at the Office of Development Credit, Bureau for Economic Growth, Agriculture and Trade, United States Agency for International Development, Washington, DC 20523-0030. Other... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Notice. 230.15 Section 230.15 Foreign Relations...

  5. 22 CFR 230.04 - Guarantee eligibility.

    Science.gov (United States)

    2010-04-01

    ... Financial Officer, Assistant Administrator and Deputy, Bureau for Economic Growth, Agriculture and Trade... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Guarantee eligibility. 230.04 Section 230.04 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ISRAEL LOAN GUARANTEES ISSUED UNDER THE EMERGENCY...

  6. 40 CFR 230.42 - Mud flats.

    Science.gov (United States)

    2010-07-01

    ... Aquatic Sites § 230.42 Mud flats. (a) Mud flats are broad flat areas along the sea coast and in coastal rivers to the head of tidal influence and in inland lakes, ponds, and riverine systems. When mud flats...

  7. 21 CFR 173.230 - Ethylene dichloride.

    Science.gov (United States)

    2010-04-01

    ... HUMAN CONSUMPTION (CONTINUED) SECONDARY DIRECT FOOD ADDITIVES PERMITTED IN FOOD FOR HUMAN CONSUMPTION Solvents, Lubricants, Release Agents and Related Substances § 173.230 Ethylene dichloride. A tolerance of...

  8. 49 CFR 230.89 - Reverse gear.

    Science.gov (United States)

    2010-10-01

    ... Reversing Gear § 230.89 Reverse gear. (a) General provisions. Reverse gear, reverse levers, and quadrants shall be maintained in a safe and suitable condition for service. Reverse lever latch shall be so...

  9. 17 CFR 230.425 - Filing of certain prospectuses and communications under § 230.135 in connection with business...

    Science.gov (United States)

    2010-04-01

    ... and communications under § 230.135 in connection with business combination transactions. 230.425... and communications under § 230.135 in connection with business combination transactions. (a) All written communications made in reliance on § 230.165 are prospectuses that must be filed with the...

  10. Determination of thorium 230Th in soils

    International Nuclear Information System (INIS)

    Alvarez, A.; Palomares, J.

    1988-01-01

    A method for the determination of 230 Th in environmental soils is described. Hydroxides formed, previous fusion with sodium peroxide are dissolved with HNO 3 8N. The thorium is coprecipitated with F 3 La and purified by anion exchange (AG 1x8 50-100 mesh). Thorium is electroplated onto a stainless steel disc, 230 Th is counted by alpha spectrometry and 234 Th used as a tracer by beta counting. The chemical yield for 1g of soil sample is 60-80%. Minimum detectable activities are about 2 mBq/g. (Author)

  11. Determination of 230Th in soils

    International Nuclear Information System (INIS)

    Alvarez, A.; Palomares, J.

    1988-01-01

    A method for the determination of 230Th in environmental soils is described. Hydroxides formed, previous fusion with sodium peroxide are dissolved with HNO3 8N. The thorium is coprecipitated with F3La and purified by anion exchange (AG 1x8 50-100 mesh). Thorium is electroplated onto a stainless steel disc, 230xh is counted by alpha spectrometry and 234'fn u;;ed as tracer by beta counting. The chemical yield for 1g of soil sample is 60-80%. Minimum detectable activities are about 2 mBq/g

  12. 24 CFR 582.230 - Environmental review.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Environmental review. 582.230... Environmental review. (a) Activities under this part are subject to HUD environmental regulations in part 58 of this title, except that HUD will perform an environmental review in accordance with part 50 of this...

  13. 40 CFR 1042.230 - Engine families.

    Science.gov (United States)

    2010-07-01

    ....230 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW AND IN-USE MARINE COMPRESSION-IGNITION ENGINES AND VESSELS Certifying Engine... families of engines that are expected to have similar emission characteristics throughout the useful life...

  14. 49 CFR 230.46 - Badge plates.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.46 Badge plates. A metal badge plate showing the allowed steam pressure shall be attached to the boiler backhead in the cab. If boiler backhead is lagged, the lagging and jacket shall be cut away so...

  15. 9 CFR 2.30 - Registration.

    Science.gov (United States)

    2010-01-01

    ... being in an inactive status. (3) A research facility which goes out of business or which ceases to function as a research facility, or which changes its method of operation so that it no longer uses... WELFARE REGULATIONS Research Facilities § 2.30 Registration. (a) Requirements and procedures. (1) Each...

  16. 40 CFR 230.23 - Current patterns and water circulation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Current patterns and water circulation. 230.23 Section 230.23 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN... the water body; and water stratification. ...

  17. 22 CFR 230.09 - No acceleration of Eligible Notes.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false No acceleration of Eligible Notes. 230.09 Section 230.09 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ISRAEL LOAN GUARANTEES ISSUED UNDER... CONDITIONS § 230.09 No acceleration of Eligible Notes. Eligible Notes shall not be subject to acceleration...

  18. 2 CFR 230.45 - Relationship to previous issuance.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Relationship to previous issuance. 230.45 Section 230.45 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-122) § 230.45 Relationship to previous issuance. (a...

  19. 7 CFR 58.230 - Heavy duty vacuum cleaners.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Heavy duty vacuum cleaners. 58.230 Section 58.230....230 Heavy duty vacuum cleaners. Each plant handling dry milk products shall be equipped with a heavy duty industrial vacuum cleaner. The vacuum cleaner shall be of a type that has a collector or...

  20. 49 CFR 230.115 - Feed water tanks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Feed water tanks. 230.115 Section 230.115... Tenders Steam Locomotive Tanks § 230.115 Feed water tanks. (a) General provisions. Tanks shall be... water. Feed water tanks shall be equipped with a device that permits the measurement of the quantity of...

  1. 7 CFR 4290.230 - Private Capital for RBICs.

    Science.gov (United States)

    2010-01-01

    ... partners' contributed capital of a Partnership RBIC, in each case subject to the limitations in paragraph... 7 Agriculture 15 2010-01-01 2010-01-01 false Private Capital for RBICs. 4290.230 Section 4290.230... Qualifications for the RBIC Program Capitalizing A Rbic § 4290.230 Private Capital for RBICs. (a) General...

  2. 29 CFR 779.230 - Franchise and other arrangements.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Franchise and other arrangements. 779.230 Section 779.230... Coverage Leased Departments, Franchise and Other Business Arrangements § 779.230 Franchise and other.... The quotation in § 779.229 from the Senate Report shows that Congress recognized that some franchise...

  3. 49 CFR 230.49 - Setting of safety relief valves.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Setting of safety relief valves. 230.49 Section 230.49 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Appurtenances Safety Relief Valves § 230.49 Setting of safety relief valves. (a) Qualifications of individual...

  4. 49 CFR 230.107 - Tender frame and body.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender frame and body. 230.107 Section 230.107... Tenders Trucks, Frames and Equalizing System § 230.107 Tender frame and body. (a) Maintenance. Tender... repaired: (1) Portions of the tender frame or body (except wheels) that have less than a 21/2 inches...

  5. 40 CFR 230.40 - Sanctuaries and refuges.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Sanctuaries and refuges. 230.40 Section 230.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... Impacts on Special Aquatic Sites § 230.40 Sanctuaries and refuges. (a) Sanctuaries and refuges consist of...

  6. 49 CFR 230.30 - Lap-joint seam boilers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lap-joint seam boilers. 230.30 Section 230.30..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Inspection and Repair § 230.30 Lap-joint seam boilers. Every boiler having lap-joint longitudinal seams...

  7. 49 CFR 230.36 - Hydrostatic testing of boilers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Hydrostatic testing of boilers. 230.36 Section 230... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Pressure Testing of Boilers § 230.36 Hydrostatic testing of boilers. (a) Time of test. The...

  8. 49 CFR 230.57 - Injectors and feedwater pumps.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Injectors and feedwater pumps. 230.57 Section 230... Appurtenances Injectors, Feedwater Pumps, and Flue Plugs § 230.57 Injectors and feedwater pumps. (a) Water.... Injectors and feedwater pumps must be kept in good condition, free from scale, and must be tested at the...

  9. 49 CFR 230.24 - Maximum allowable stress.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Maximum allowable stress. 230.24 Section 230.24... Allowable Stress § 230.24 Maximum allowable stress. (a) Maximum allowable stress value. The maximum allowable stress value on any component of a steam locomotive boiler shall not exceed 1/4 of the ultimate...

  10. 40 CFR 230.74 - Actions related to technology.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Actions related to technology. 230.74 Section 230.74 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... Minimize Adverse Effects § 230.74 Actions related to technology. Discharge technology should be adapted to...

  11. 17 CFR 230.608 - Prohibition of certain statements.

    Science.gov (United States)

    2010-04-01

    ... Business Investment Companies § 230.608 Prohibition of certain statements. No offering circular or other written or oral communication used in connection with any offering under §§ 230.601 to 230.610a shall... any such offering circular or other communication are accurate or complete. ...

  12. 49 CFR 230.21 - Steam locomotive number change.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive number change. 230.21 Section 230... Recordkeeping Requirements § 230.21 Steam locomotive number change. When a steam locomotive number is changed, the steam locomotive owner and/or operator must reflect the change in the upper right-hand corner of...

  13. 49 CFR 230.51 - Number and location.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Number and location. 230.51 Section 230.51 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Water Glasses and Gauge Cocks § 230.51 Number and location. Every boiler shall be equipped with at least...

  14. 40 CFR 230.51 - Recreational and commercial fisheries.

    Science.gov (United States)

    2010-07-01

    .... 230.51 Section 230.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN... Potential Effects on Human Use Characteristics § 230.51 Recreational and commercial fisheries. (a... these impacts can be of short duration or prolonged, depending upon the physical and chemical impacts of...

  15. 27 CFR 28.230 - Consignment, shipment, and delivery.

    Science.gov (United States)

    2010-04-01

    ... delivery. 28.230 Section 28.230 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Drawback Consignment, Shipment, and Delivery § 28.230 Consignment, shipment, and delivery. The consignment, shipment, and delivery of taxpaid beer removed under this subpart shall be made under the provisions of...

  16. 50 CFR 230.8 - Reporting by whaling captains.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Reporting by whaling captains. 230.8... ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.8 Reporting by whaling captains. (a) The relevant Native American whaling organization shall require each whaling captain licensed pursuant to § 230...

  17. 50 CFR 230.5 - Licenses for aboriginal subsistence whaling.

    Science.gov (United States)

    2010-10-01

    ... whaling. 230.5 Section 230.5 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.5 Licenses for aboriginal subsistence whaling. (a) A license is hereby issued to whaling captains identified by the relevant...

  18. Determination of 230Th in soils; Determinacion de 230Th en suelos

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez, A.; Palomares, J.

    1988-07-01

    A method for the determination of 230Th in environmental soils is described. Hydroxides formed, previous fusion with sodium peroxide are dissolved with HNO3 8N. The thorium is coprecipitated with F3La and purified by anion exchange (AG 1x8 50-100 mesh). Thorium is electroplated onto a stainless steel disc, 230xh is counted by alpha spectrometry and 234'fn u;;ed as tracer by beta counting. The chemical yield for 1g of soil sample is 60-80%. Minimum detectable activities are about 2 mBq/g.

  19. 40 CFR 230.76 - Actions affecting human use.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Actions affecting human use. 230.76... Minimize Adverse Effects § 230.76 Actions affecting human use. Minimization of adverse effects on human use... aquatic areas; (c) Timing the discharge to avoid the seasons or periods when human recreational activity...

  20. 23 CFR 230.415 - Consolidated compliance reviews.

    Science.gov (United States)

    2010-04-01

    ... Construction Contract Equal Opportunity Compliance Procedures § 230.415 Consolidated compliance reviews. (a... in union membership or referral practices by local unions involved in highway construction; (iii... sent a notification letter as outlined in § 230.409(c) along with a request for current workforce data...

  1. 33 CFR 230.16 - Lead and cooperating agencies.

    Science.gov (United States)

    2010-07-01

    ... be determined on the basis of 40 CFR 1501.5(c). (b) Corps as a Cooperating Agency. For cooperating.... 230.16 Section 230.16 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY... (e) and (f). (a) Lead Agency. The Corps will normally be lead agency for Corps civil works projects...

  2. 36 CFR 230.6 - Landowner forest stewardship plan.

    Science.gov (United States)

    2010-07-01

    ... manage soil, water, aesthetic qualities, recreation, timber, and fish and wildlife resources in a manner... sells or otherwise conveys land covered by a landowner forest stewardship plan, such plan shall remain... plan. 230.6 Section 230.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE...

  3. 33 CFR 2.30 - Exclusive Economic Zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Exclusive Economic Zone. 2.30... JURISDICTION Jurisdictional Terms § 2.30 Exclusive Economic Zone. (a) With respect to the United States... States exercises sovereignty, exclusive economic zone means the zone seaward of and adjacent to the...

  4. 17 CFR 230.135 - Notice of proposed registered offerings.

    Science.gov (United States)

    2010-04-01

    ... issuer or a selling security holder (and any person acting on behalf of either of them) that publishes... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Notice of proposed registered offerings. 230.135 Section 230.135 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  5. 49 CFR 230.103 - Tender roller bearing journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender roller bearing journal boxes. 230.103... Locomotives and Tenders Running Gear § 230.103 Tender roller bearing journal boxes. Tender roller bearing journal boxes shall be maintained in a safe and suitable condition. ...

  6. 49 CFR 230.102 - Tender plain bearing journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender plain bearing journal boxes. 230.102... Locomotives and Tenders Running Gear § 230.102 Tender plain bearing journal boxes. Plain bearing journal boxes... expected to damage the bearing; or have a detrimental effect on the lubrication of the journal and bearing...

  7. 49 CFR 230.101 - Steam locomotive driving journal boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive driving journal boxes. 230.101... Locomotives and Tenders Running Gear § 230.101 Steam locomotive driving journal boxes. (a) Driving journal boxes. Driving journal boxes shall be maintained in a safe and suitable condition for service. Not more...

  8. 40 CFR 230.5 - General procedures to be followed.

    Science.gov (United States)

    2010-07-01

    ... components which characterize the non-living environment of the candidate site, the substrate and the water... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General procedures to be followed. 230.5 Section 230.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING...

  9. 49 CFR 230.26 - Tensile strength of shell plates.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tensile strength of shell plates. 230.26 Section... Appurtenances Strength of Materials § 230.26 Tensile strength of shell plates. When the tensile strength of steel or wrought-iron shell plates is not known, it shall be taken at 50,000 psi for steel and 45,000...

  10. 17 CFR 230.135a - Generic advertising.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Generic advertising. 230.135a... REGULATIONS, SECURITIES ACT OF 1933 General § 230.135a Generic advertising. (a) For the purposes only of... different generic types or having various investment objectives, such as balanced funds, growth funds...

  11. 39 CFR 230.10 - What do these rules govern?

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false What do these rules govern? 230.10 Section 230.10 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL Rules Governing Compliance With Subpoenas, Summonses, and Court Orders by Postal Employees Within the...

  12. 22 CFR 230.11 - Subrogation of USAID.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Subrogation of USAID. 230.11 Section 230.11 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ISRAEL LOAN GUARANTEES ISSUED UNDER THE EMERGENCY... Subrogation of USAID. In the event of payment by USAID to a Noteholder under this Guarantee, USAID shall be...

  13. 46 CFR 199.230 - Stowage of survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stowage of survival craft. 199.230 Section 199.230... Stowage of survival craft. (a) To meet the requirements of § 199.130(b)(1), each lifeboat on a passenger... height of a survival craft must take into account the vessel's escape provisions, the vessel's size, and...

  14. 21 CFR 172.230 - Microcapsules for flavoring substances.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Coatings, Films and Related Substances § 172.230 Microcapsules for flavoring... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Microcapsules for flavoring substances. 172.230...

  15. 40 CFR 230.52 - Water-related recreation.

    Science.gov (United States)

    2010-07-01

    ... Section 230.52 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... Effects on Human Use Characteristics § 230.52 Water-related recreation. (a) Water-related recreation.... canoeing and sight-seeing. (b) Possible loss of values: One of the more important direct impacts of dredged...

  16. 50 CFR 230.4 - Aboriginal subsistence whaling.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Aboriginal subsistence whaling. 230.4... ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.4 Aboriginal subsistence whaling. (a) No person shall engage in aboriginal subsistence whaling, except a whaling captain licensed pursuant to...

  17. 49 CFR 230.74 - Time of cleaning.

    Science.gov (United States)

    2010-10-01

    ... Tenders Brake and Signal Equipment § 230.74 Time of cleaning. All valves in the air brake system, including related dirt collectors and filters, shall be cleaned and tested in accordance with accepted brake...

  18. 15 CFR 230.3 - New Standard Reference Materials.

    Science.gov (United States)

    2010-01-01

    ... NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE STANDARD REFERENCE MATERIALS STANDARD REFERENCE MATERIALS General Information § 230.3 New Standard Reference Materials. When new SRM's... scientific and trade journals. ...

  19. 49 CFR Appendix B to Part 230 - Diagrams and Drawings

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Diagrams and Drawings B Appendix B to Part 230 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... to Part 230—Diagrams and Drawings ER17No99.015 ER17No99.016 ER17No99.017 ER17No99.018 ER17No99.019...

  20. 39 CFR 230.5 - Release of information.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Release of information. 230.5 Section 230.5 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL General..., contained in Section 552 of Title 5 of the U.S. Code and 39 U.S.C. 410 (c), and/or the Privacy Act, Section...

  1. 39 CFR 230.1 - Establishment and authority.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Establishment and authority. 230.1 Section 230.1... the Inspector General Act of 1978, as amended (5 U.S.C. App.3), and 39 U.S.C. 410, an independent... subscribe to the oath of office required of all Postal Service employees under 39 U.S.C. 1011, and the...

  2. Reinterpretation of oceanic230Th profiles based on decadal export productivity (2003-2010).

    Science.gov (United States)

    Luo, Yiming

    2017-03-29

    Understanding 230 Th distributions in the global ocean is important to support and guide the use of this important radioactive nuclide in multiple aspects of oceanographic research, and this issue is now revisited. Based on estimates of export productivity (EP) over 2003-2010 and assuming 230 Th scavenging at equilibrium at seven Pacific stations where linear 230 Th profiles are found, an empirical equilibrium-state 230 Th-scavenging versus EP correlation is established. This correlation demonstrates the relationship between 230 Th-scavenging intensity and EP in the absence of advection. With this correlation, other 230 Th profiles from global oceans are reinterpreted. My findings provide alternative explanations of signals carried by 230 Th distributions with regard to advection, by a reassessment of the 230 Th deficits in deep waters. Such an equilibrium-state 230 Th-scavenging versus EP correlation provides a basis for convenient parameterization for use in 3D modeling studies of the 230 Th distributions.

  3. 17 CFR 230.461 - Acceleration of effective date.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Acceleration of effective date... RULES AND REGULATIONS, SECURITIES ACT OF 1933 Filings; Fees; Effective Date § 230.461 Acceleration of effective date. (a) Requests for acceleration of the effective date of a registration statement shall be...

  4. 13 CFR 108.230 - Private Capital for NMVC Companies.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Private Capital for NMVC Companies... VENTURE CAPITAL (âNMVCâ) PROGRAM Qualifications for the NMVC Program Capitalizing A Nmvc Company § 108.230 Private Capital for NMVC Companies. (a) General. Private Capital means the contributed capital of a NMVC...

  5. 49 CFR Appendix D to Part 230 - Civil Penalty Schedule

    Science.gov (United States)

    2010-10-01

    ... and alterations: (a) Failure to obtain approval before making riveted alterations on unstayed portions...; failure to properly note removal 1,500 3,000 230.60 Time of washing: (a) Failure to thoroughly wash boiler...: (a) Condemning defects 1,000 2,000 (b) Journal diameter: Failure to stamp on end of axle 750 1,000...

  6. 2 CFR Appendix A to Part 230 - General Principles

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false General Principles A Appendix A to Part 230 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR... Principles General Principles Table of Contents A. Basic Considerations 1. Composition of total costs 2...

  7. 17 CFR 230.481 - Information required in prospectuses.

    Science.gov (United States)

    2010-04-01

    ... in the copy of the prospectus filed under § 230.497. This information need not be included if dealers... information in a format readily communicated to investors, and where indicated, in a manner reasonably calculated to draw investor attention to specific information. [63 FR 6385, Feb. 6, 1998] ...

  8. 40 CFR 230.50 - Municipal and private water supplies.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Municipal and private water supplies... Potential Effects on Human Use Characteristics § 230.50 Municipal and private water supplies. (a) Municipal and private water supplies consist of surface water or ground water which is directed to the intake of...

  9. Design of RF system for CYCIAE-230 superconducting cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Zhiguo, E-mail: bitbearAT@hotmail.com; Ji, Bin; Fu, Xiaoliang; Cao, Xuelong; Zhao, Zhenlu; Zhang, Tinajue

    2017-05-11

    The CYCIAE230 is a low-current, compact superconducting cyclotron designed for proton therapy. The Radio Frequency system consists of four RF cavities and applies second harmonic to accelerate beams. The driving power for the cavity system is estimated to be approximately 150 kW. The LLRF controller is a self-made device developed and tested at low power using a small-scale cavity model. In this paper, the resonator systems of an S.C. cyclotron in history are reviewed. Contrary to those RF systems, the cavities of the CYCIAE230 cyclotron connect two opposite dees. Two high-power RF windows are included in the system. Each window carries approximately 75 kW RF power from the driver to the cavities. Thus, the RF system for the CY-CIAE230 cyclotron is operated in driven push–pull mode. The two-way amplifier-coupler-cavity systems are operated with approximately the same amount of RF power but 180° out of phase compared with each other. The design, as well as the technical advantage and limitations of this operating mode, of the CYCIAE230 cyclotron RF system is analyzed.

  10. 42 CFR 438.230 - Subcontractual relationships and delegation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Subcontractual relationships and delegation. 438... HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Quality Assessment and Performance Improvement Structure and Operation Standards § 438.230 Subcontractual relationships and delegation. (a...

  11. 48 CFR 52.230-2 - Cost Accounting Standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Accounting Standards....230-2 Cost Accounting Standards. As prescribed in 30.201-4(a), insert the following clause: Cost Accounting Standards (OCT 2010) (a) Unless the contract is exempt under 48 CFR 9903.201-1 and 9903.201-2, the...

  12. 17 CFR 230.502 - General conditions to be met.

    Science.gov (United States)

    2010-04-01

    ... offered: (A) Non-financial statement information. If the issuer is eligible to use Regulation A (§ 230.251... entitled to use. (B) Financial statement information—(1) Offerings up to $2,000,000. The information....506 to any purchaser that is not an accredited investor, the issuer shall furnish the information...

  13. Schweizer Gesetze das Wesentliche der Schweizer Gesetzgebung in 230 Gesetztexten

    CERN Document Server

    Suisse

    1999-01-01

    Ce CD-Rom contient 230 textes représentant les plus importantes lois et ordonnances du Recueil systématique fédéral (RS) : Constitution fédérale, Code civil, Code des obligations, Code pénal ...

  14. 33 CFR 230.13 - Environmental Impact Statement (EIS).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Environmental Impact Statement..., DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.13 Environmental Impact Statement (EIS). An EIS... issues and impacts. The transmittal letter to EPA as well as the cover sheet should clearly identify the...

  15. 49 CFR 230.42 - Location of gauges.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.42 Location of gauges. Every boiler shall have at least one steam gauge which will correctly indicate the working pressure. The gauge shall be positioned so that it will be kept reasonably...

  16. 49 CFR 230.34 - Riveted repairs and alterations.

    Science.gov (United States)

    2010-10-01

    ... satisfy reporting requirements in § 230.20 at this time. Pressure Testing of Boilers ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and... portions of the boiler. Prior to making riveted alterations on unstayed portions of the boiler, the steam...

  17. 49 CFR 230.48 - Number and capacity.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Safety Relief Valves § 230.48 Number and capacity. (a) Number and capacity. Every boiler shall be... preventing an accumulation of pressure greater than 6 percent above the MAWP under any conditions of service...

  18. 15 CFR 230.5 - Terms and shipping.

    Science.gov (United States)

    2010-01-01

    ... OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE STANDARD REFERENCE MATERIALS STANDARD REFERENCE MATERIALS Purchase Procedure § 230.5 Terms and shipping. (a) Prices are given in the SP 260 supplement. These prices are subject to revision and orders will be billed for prices in effect at the time of...

  19. 50 CFR 230.1 - Purpose and scope.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.1 Purpose and scope. The purpose of the regulations in this part is to implement the Whaling Convention Act (16 U.S.C. 916 et seq.) by prohibiting whaling except for aboriginal subsistence whaling allowed by the International Whaling Commission...

  20. 40 CFR 230.21 - Suspended particulates/turbidity.

    Science.gov (United States)

    2010-07-01

    ..., particulate specific gravity, particle shape, and physical and chemical properties of particle surfaces. (b... Impacts on Physical and Chemical Characteristics of the Aquatic Ecosystem § 230.21 Suspended particulates..., usually smaller than silt, and organic particles. Suspended particulates may enter water bodies as a...

  1. 17 CFR 230.145 - Reclassification of securities, mergers, consolidations and acquisitions of assets.

    Science.gov (United States)

    2010-04-01

    ..., mergers, consolidations and acquisitions of assets. 230.145 Section 230.145 Commodity and Securities... § 230.145 Reclassification of securities, mergers, consolidations and acquisitions of assets.... A statutory merger or consolidation or similar plan or acquisition in which securities of such...

  2. 40 CFR 421.230 - Applicability: Description of the primary nickel and cobalt subcategory.

    Science.gov (United States)

    2010-07-01

    ... primary nickel and cobalt subcategory. 421.230 Section 421.230 Protection of Environment ENVIRONMENTAL... CATEGORY Primary Nickel and Cobalt Subcategory § 421.230 Applicability: Description of the primary nickel and cobalt subcategory. The provisions of this subpart are applicable to discharges resulting from the...

  3. 12 CFR Appendix D to Part 230 - Issuance of Staff Interpretations

    Science.gov (United States)

    2010-01-01

    ... to Part 230 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM TRUTH IN SAVINGS (REGULATION DD) Pt. 230, App. D Appendix D to Part 230—Issuance of Staff... calculation tools or methods. ...

  4. 48 CFR 52.230-4 - Disclosure and Consistency of Cost Accounting Practices-Foreign Concerns.

    Science.gov (United States)

    2010-10-01

    ... of Cost Accounting Practices-Foreign Concerns. 52.230-4 Section 52.230-4 Federal Acquisition... CONTRACT CLAUSES Text of Provisions and Clauses 52.230-4 Disclosure and Consistency of Cost Accounting... Consistency of Cost Accounting Practices—Foreign Concerns (JUN 2010) (a) The Contractor, in connection with...

  5. 48 CFR 52.230-3 - Disclosure and Consistency of Cost Accounting Practices.

    Science.gov (United States)

    2010-10-01

    ... of Cost Accounting Practices. 52.230-3 Section 52.230-3 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.230-3 Disclosure and Consistency of Cost Accounting Practices. As prescribed in 30.201-4(b)(1), insert the following clause: Disclosure and Consistency of Cost Accounting...

  6. 17 CFR 230.254 - Solicitation of interest document for use prior to an offering statement.

    Science.gov (United States)

    2010-04-01

    ... subject to the antifraud provisions of the federal securities laws. No solicitation or acceptance of money... document for use prior to an offering statement. 230.254 Section 230.254 Commodity and Securities Exchanges...-Conditional Small Issues Exemption § 230.254 Solicitation of interest document for use prior to an offering...

  7. 39 CFR 230.3 - Cooperation with the Office of Inspector General.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Cooperation with the Office of Inspector General. 230.3 Section 230.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL General Policy and Authority § 230.3 Cooperation with the Office of Inspector...

  8. 39 CFR 230.4 - Arrest and investigative powers of criminal investigators.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Arrest and investigative powers of criminal investigators. 230.4 Section 230.4 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL General Policy and Authority § 230.4 Arrest and investigative powers of...

  9. 39 CFR 230.2 - Access to information and other responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Access to information and other responsibilities. 230.2 Section 230.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL General Policy and Authority § 230.2 Access to information and other...

  10. 49 CFR 195.230 - Welds: Repair or removal of defects.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.230 Welds: Repair or removal of defects. (a... 49 Transportation 3 2010-10-01 2010-10-01 false Welds: Repair or removal of defects. 195.230 Section 195.230 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND...

  11. 17 CFR 230.491 - Information to be furnished under paragraph (6) of Schedule B.

    Science.gov (United States)

    2010-04-01

    ... under paragraph (6) of Schedule B. 230.491 Section 230.491 Commodity and Securities Exchanges SECURITIES... Governments Or Political Subdivisions Thereof § 230.491 Information to be furnished under paragraph (6) of... state, in furnishing the information required by paragraph (6), the names and addresses only of...

  12. 17 CFR 230.490 - Information to be furnished under paragraph (3) of Schedule B.

    Science.gov (United States)

    2010-04-01

    ... under paragraph (3) of Schedule B. 230.490 Section 230.490 Commodity and Securities Exchanges SECURITIES... Governments Or Political Subdivisions Thereof § 230.490 Information to be furnished under paragraph (3) of... the detailed information specified in paragraph (3) as to issues of outstanding funded debt the...

  13. 17 CFR 230.403 - Requirements as to paper, printing, language and pagination.

    Science.gov (United States)

    2010-04-01

    ..., printing, language and pagination. 230.403 Section 230.403 Commodity and Securities Exchanges SECURITIES... § 230.403 Requirements as to paper, printing, language and pagination. (a) Registration statements... designated so as to be clearly distinguishable as such on photocopies. (c)(1) All Securities Act filings and...

  14. Variation of 231Pa, 230Th and 231Paex/230Thex in surface sediments of the Sabah-Sarawak coastal waters

    International Nuclear Information System (INIS)

    Zal U'yun Wan Mahmood; Zaharudin Ahmad; Abdul Kadir Ishak; Norfaizal Mohamed; Che Abd Rahim Mohamed

    2011-01-01

    Protactinium and thorium activities were measured in eight surface sediment taken in 2004 to determine effectiveness scavenging of 231 Pa at Sabah-Sarawak coastal waters. The result found that activity ratios of 231 Pa ex / 230 Th ex were ranged from 0.07 to 0.13 at all sampling stations. The high 231 Pa ex / 230 Th ex activity ratio than the production ratio of 0.093 in seawater at station SR 01, SR 02, SR 04, SB 02 and SB 05, revealed that 231 Pa is effectively removed from the water column into the sediment in comparison with 230 Th at those stations. Low percentage of 230 Th ex (90-95%) in comparison with 231 Pa ex at all stations can be attributed to less efficiently scavenged of 230 Th onto particles prior deposited at the marine sediment bed. (author)

  15. Phenotype-gene: 230 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 230 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1228i decreased size... in organ named whole plant for AT5G24630 Kirik Viktor et al. 2007 Oct. Plant Cell 19(10):3100-10. http://metadb.riken....jp/db/SciNetS_ria224i/cria224u4ria224u17951446i decreased size in organ named whole plant http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u733i AT5G24630

  16. Corona performance of a compact 230-kV line

    International Nuclear Information System (INIS)

    Chartier, V.L.; Blair, D.E.

    1994-01-01

    Permitting requirements and the acquisition of new rights-of-way for transmission facilities has in recent years become increasingly difficult for most utilities, including Puget Sound Power and Light Company. In order to maintain a high degree of reliability of service while being responsive to public concerns regarding the siting of high voltage (HV) transmission facilities, Puget Power has found it necessary to more heavily rely upon the use of compact lines in franchise corridors. Compaction does, however, precipitant increased levels of audible noise (AN) and radio and TV interference (RI and TVI) due to corona on the conductors and insulator assemblies. Puget Power relies upon the Bonneville Power Administration (BPA) Corona and Field Effects computer program to calculate AN and RI for new lines. Since there was some question of the program's ability to accurately represent quiet 230-kV compact designs, a joint project was undertaken with BPA to verify the program's algorithms. Long-term measurements made on an operating Puget Power 230-kV compact line confirmed the accuracy of BPA's AN model; however, the RI measurements were much lower than predicted by the BPA computer and other programs. This paper also describes how the BPA computer program can be used to calculate the voltage needed to expose insulator assemblies to the correct electric field in single test setups in HV laboratories

  17. Field method for detemining thorium-230 in soils

    International Nuclear Information System (INIS)

    Dechant, G.

    1989-05-01

    The US Department of Energy (DOE) Office of Remedial Action and Waste Technology established the Technical Measurements Center at the DOE Grand Junction, Colorado, Projects Office to develop and/or recommend measurement methods for use in support of its remedial action programs. This report describes a field method for the determination of Th-230 in soils for remedial action projects. The method involves a cold acid digestion, organic extraction, and precipitation of Th-230 for counting by alpha spectrometry. An internal Th-228 spike is added early in the method to eliminate the need to determine losses through the separation steps. A step-by-step procedure is included in the report. The method requires a small portable or mobile laboratory equipped with electrical power and ventilation. All additional equipment is commercially available and no special equipment is required. Chemical wastes for each analysis are stored for appropriate disposal off site. A chemist or chemical technician can complete 15--30 analyses per day depending primarily on the number of alpha spectrometers available. 8 refs., 2 figs., 7 tabs

  18. 43 CFR 2.30 - How do I file an appeal?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How do I file an appeal? 2.30 Section 2.30... INFORMATION ACT FOIA Appeals § 2.30 How do I file an appeal? (a) You must submit your appeal in writing, i.e... appeal will not begin to run until the documents are received. (c) You also should include in as much...

  19. MFTF 230 kV pulsed power substation

    International Nuclear Information System (INIS)

    Wilson, J.H.

    1979-01-01

    The Mirror Fusion Test Facility (MFTF) currently under construction at the Lawrence Livermore Laboratory includes a Sustaining Neutral Beam Power Supply System (SNBPSS) consisting of 24 power-supply sets. The System will operate in long pulses (initially .5 seconds and eventually 30 seconds) at high power (200 MW), which will necessitate a large source of ac power. To meet this requirement, a new 230-kV substation is also being built at LLL. The constraints of cost, equipment protection, short operating lifetime (10 years), and reliability dictated a unique substation design. Its unusual features include provisions for fast fault detection and tripping, a capability for limiting ground fault current, low impedance, and economical design

  20. Experimental project of a compact 230 kV urban transmission line; Projeto experimental de uma LT urbana compacta em 230 kV

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, Joao Nelson; Prosdocimo, Nelson; Moreira, Ilmar da Silva [Companhia Paranaense de Energia, Curitiba, PR (Brazil). Copel Transmissao; Swinka Filho, Vitoldo [LACTEC - Instituto de Tecnologia para o Desenvolvimento, Cutitiba, PR (Brazil)

    2005-02-01

    This article presents the preliminary studies performed for a conception of a 230 kV compact transmission line and also details, measurements and results obtained for a part constructed for experimental purposes.

  1. 238U-230Th radioactive disequilibrium in the northern Izu arc. (230Th/232Th) in the sub-arc mantle

    International Nuclear Information System (INIS)

    Fukuda, Satoru; Nakai, Shunichi; Niihori, Kenji; Nakada, Setsuya; Fujii, Toshitsugu; Tsukui, Masashi; Tani, Kenichiro

    2008-01-01

    Major and trace element abundances, Sr and Nd isotopic ratios, and 238 U- 230 Th radioactive disequilibria have been analyzed for samples from five volcanoes, Oshima, Miyakejima, Niijima, Teishi Knoll and Fuji, located in the northern Izu arc to investigate across-arc and regional variations of chemical compositions of mantle and fluids expelled from a subducting slab. The abundances and abundance ratios of both fluid mobile and immobile trace elements show across-arc variations. All samples but one have radioactive disequilibria, with ( 238 U/ 230 Th) greater than unity (herein, a ratio in parentheses denotes the activity ratio). The observed disequilibrium is similar to those reported for other arc systems, such a Mariana, Tonga, Kermadec, Chile. It originates from higher mobility of uranium relative to thorium during dewatering of the subducting slab. The degree of radioactive disequilibrium of ( 238 U/ 230 Th) decreases with depth to the Wadati-Benioff zone at each volcano. The radioactivity ratios of ( 230 Th/ 232 Th) of the samples from Miyakejima, however, deviate from an across-arc trend formed by Oshima, Niijima, Teishi Knoll and Fuji. The combined data of 230 Th/ 232 Th)-( 238 U/ 232 Th) of the samples from the Izu and the Mariana arc revealed a well defined array in an isochron diagram with the exceptions of the samples from Miyakejima and Alamagan. This finding requires ( 230 Th/ 232 Th) of the sub-arc mantle beneath the arcs of Izu and Mariana except the magma sources of the two islands of Miyakejima and Alamagan was around 1.1 and relatively homogeneous before the final addition of fluid from slab. The homogeneous ( 230 Th/ 232 Th) necessitates input of Th with homogeneous ( 230 Th/ 232 Th) contributed from sediment melt, which dominates the budget of Th in the sub-arc mantle. It also suggests that influence of fluid addition before the final one had not caused a variation in Th isotopic compositions of the sub-arc mantle. (author)

  2. 20 CFR 662.230 - What are the responsibilities of the required One-Stop partners?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What are the responsibilities of the required One-Stop partners? 662.230 Section 662.230 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... operating costs of the system will be funded, and methods for referrals (WIA sec. 121(c)); (d) Participate...

  3. 13 CFR 107.230 - Permitted sources of Private Capital for Licensees.

    Science.gov (United States)

    2010-01-01

    ..., or the partners' contributed capital of a Partnership Licensee, in either case subject to the... Capital for Licensees. 107.230 Section 107.230 Business Credit and Assistance SMALL BUSINESS... Permitted sources of Private Capital for Licensees. Private Capital means the contributed capital of a...

  4. 30 CFR 285.230 - May I request a lease if there is no Call?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I request a lease if there is no Call? 285.230 Section 285.230 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Issuance of OCS...

  5. 27 CFR 26.230 - Containers of distilled spirits to bear closures.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Containers of distilled spirits to bear closures. 26.230 Section 26.230 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO... distilled spirits to bear closures. Containers of 1 gallon (3.785 liters) or less of distilled spirits, upon...

  6. 49 CFR 230.20 - Alteration and repair report for steam locomotive boilers.

    Science.gov (United States)

    2010-10-01

    ... boilers. 230.20 Section 230.20 Transportation Other Regulations Relating to Transportation (Continued... boilers. (a) Alterations. When an alteration is made to a steam locomotive boiler, the steam locomotive... maintained for the life of the boiler. (See appendix B of this part.) (b) Welded and riveted repairs to...

  7. 49 CFR 230.90 - Draw gear between steam locomotive and tender.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Draw gear between steam locomotive and tender. 230... Steam Locomotives and Tenders Draw Gear and Draft Systems § 230.90 Draw gear between steam locomotive and tender. (a) Maintenance and testing. The draw gear between the steam locomotive and tender...

  8. 49 CFR 230.25 - Maximum allowable stress on stays and braces.

    Science.gov (United States)

    2010-10-01

    ... Boilers and Appurtenances Allowable Stress § 230.25 Maximum allowable stress on stays and braces. The maximum allowable stress per square inch of net cross sectional area on fire box and combustion chamber... 49 Transportation 4 2010-10-01 2010-10-01 false Maximum allowable stress on stays and braces. 230...

  9. Construction of recombinant ZNF230/GFP fused plasmids and their expression and cellular localization

    DEFF Research Database (Denmark)

    Xu, Wen-Ming; Zhang, Si-Zhong; Qiu, Wei-Min

    2004-01-01

    To use green fluorescent protein as a marker to study the localization of the fusion protein, the mutant full length cDNAs of human ZNF230 and mouse znf230 with their stop codon TGA changed to TGG were obtained by PCR amplification, and then cloned into pGEM-Teasy vector. After the double enzyme...... cutting, the mutated human and mouse ZNF230(znf230) were inserted into mammalian expression plasmid pEGFP-N1. Thus we constructed the plasmid with fusion gene of ZNF230 and green fluorescent protein(GFP). Then the Cos cell was transfected with the fused gene by liposome. Fluorescence microscopy showed...... that green fluorescence protein expressed over the whole cell when transfected with vector pEGFP-N1. While after the transfection with pEGFP-ZNF230, the fluorescence located mainly on the nuclei of the cells. We demonstrated that the transfected Cos cell line can express human ZNF230 and mouse znf230...

  10. 39 CFR 230.11 - What special definitions apply to these rules?

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false What special definitions apply to these rules? 230.11 Section 230.11 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL Rules Governing Compliance With Subpoenas, Summonses, and Court Orders by Postal...

  11. 39 CFR 230.20 - What records will not be released?

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false What records will not be released? 230.20 Section... Federal Agency Is a Party § 230.20 What records will not be released? Generally, any record demanded by a... Act, 5 U.S.C. app. 3, because release of the information would adversely affect the duties and...

  12. 49 CFR 230.63 - Smoke box, steam pipes and pressure parts.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Smoke box, steam pipes and pressure parts. 230.63... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Pipes § 230.63 Smoke box, steam pipes and pressure parts. The smoke box, steam pipes and...

  13. 21 CFR 175.230 - Hot-melt strippable food coatings.

    Science.gov (United States)

    2010-04-01

    ..., white For use only as a component of hot-melt strippable food coatings applied to frozen meats and... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Hot-melt strippable food coatings. 175.230 Section 175.230 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  14. 49 CFR 230.100 - Defects in tender truck axles and journals.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defects in tender truck axles and journals. 230... Steam Locomotives and Tenders Running Gear § 230.100 Defects in tender truck axles and journals. (a... wheel seats that is more than 1/8 of an inch in depth. (b) Tender truck journal condemning defects...

  15. 45 CFR 1173.230 - How and when must I identify workplaces?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false How and when must I identify workplaces? 1173.230 Section 1173.230 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL FOUNDATION ON... operation, State employees in each local unemployment office, performers in concert halls or radio studios...

  16. 41 CFR 105-74.230 - How and when must I identify workplaces?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How and when must I identify workplaces? 105-74.230 Section 105-74.230 Public Contracts and Property Management Federal... employees in each local unemployment office, performers in concert halls or radio studios). (c) If you...

  17. 43 CFR 43.230 - How and when must I identify workplaces?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How and when must I identify workplaces? 43.230 Section 43.230 Public Lands: Interior Office of the Secretary of the Interior GOVERNMENTWIDE... operation, State employees in each local unemployment office, performers in concert halls or radio studios...

  18. 45 CFR 630.230 - How and when must I identify workplaces?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false How and when must I identify workplaces? 630.230 Section 630.230 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL SCIENCE..., performers in concert halls or radio studios). (c) If you identified workplaces to the National Science...

  19. 36 CFR 1212.230 - How and when must I identify workplaces?

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false How and when must I identify workplaces? 1212.230 Section 1212.230 Parks, Forests, and Public Property NATIONAL ARCHIVES AND RECORDS... employees in each local unemployment office, performers in concert halls or radio studios). (c) If you...

  20. 45 CFR 1155.230 - How and when must I identify workplaces?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false How and when must I identify workplaces? 1155.230 Section 1155.230 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL FOUNDATION ON... operation, State employees in each local unemployment office, performers in concert halls or radio studios...

  1. 47 CFR 51.230 - Presumption of acceptability for deployment of an advanced services loop technology.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Presumption of acceptability for deployment of an advanced services loop technology. 51.230 Section 51.230 Telecommunication FEDERAL COMMUNICATIONS... following circumstances, where the technology: (1) Complies with existing industry standards; or (2) Is...

  2. 25 CFR 171.230 - What are my responsibilities for wastewater?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are my responsibilities for wastewater? 171.230... OPERATION AND MAINTENANCE Irrigation Service § 171.230 What are my responsibilities for wastewater? (a) You are responsible for your wastewater. (b) Wastewater may be returned to our facilities, but only at...

  3. 40 CFR 230.72 - Actions controlling the material after discharge.

    Science.gov (United States)

    2010-07-01

    ... discharge. 230.72 Section 230.72 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN... surrounding aquatic ecosystem will be reduced. These sites or methods include, but are not limited to: (1... discharge to minimize impact, for instance during periods of unusual high water flows, wind, wave, and tidal...

  4. Therapeutic Effect of 131I for 230 Patients with Hyperthyroidism

    International Nuclear Information System (INIS)

    He Yujie; Zhang Chengxi; Hu Jiqing; Guo Sihui; Yuan Hui; Li Jing

    2009-01-01

    To evaluate the therapeutic effect of 131 I in treatment of patients with hyperthyroidism and analysis the factors that influence the effect, 230 cases of hyperthyroidism were treated with 131 I, and were followed-up at 1.5, 3, 6, 12 months and even longer time after 131 I radiotherapy. The serum levels of FT3, FT4 and TSH were detected in all cases. The results showed that 181 patients were cured (78.6%), 22 patients were improved (9.5%), 23 cases developed early hypothyroidism(10.0%),and 4 cases developed later hypothyroidism. 12 cases in 27 patients with hypothyroidism treated with thyroxin were recovered, but the other 15 cases need to be given permanent treatment. The factors which influence 131 I radiotherapeutic effect include the patient age, course of disease,application of ATD, size and quality of thyroid, and the level of thyroid hormone. The patients should be followed up to prevent occurrence of hypothyroidism. The early hypothyroidism should be treated in order to decrease the permanent hypothyroidism rate. (authors)

  5. Remeasurement of thorium-230 in the pore water of Lacnor tailings

    International Nuclear Information System (INIS)

    Snodgrass, W.J.; Hart, D.R.

    1990-02-01

    A resampling of the Lacnor tailings management area was undertaken under a comprehensive quality assurance programme to establish levels of thorium 230 in pore water. A quality assurance programme was established for field sampling, sample handling and transport, and laboratory procedures and reporting. The external audit was used to evaluate analytical bias (on synthetic and field samples) and precision (by comparison of duplicate-duplicate results). Accuracy was assessed using synthetic samples. The external audit indicates that thorium 230 measurements by the main laboratory are not significantly different from the interlaboratory average within standard statistical limits. The results of the audit are based on measurement of environmental samples and known synthetic samples. This shows that present and previous measurements of thorium 230 varying from 0,1 to 150 Bq/L are valid data. A qualitative interpretation of the controls on thorium 230 geochemistry is provided in terms of control by thorium 232 and thorium dioxide(c) solid phase. Generic dose estimates for consumption of water containing thorium 230 are made but require refinement ot account for the actual pH of the drinking water and the degree of dilution of the pore water. The results of this project indicate that the performance of the laboratory that will conduct future thorium 230 measurements can be assessed satisfactorily with a smaller scale external laboratory assurance programme. The programme should include replicate samples sent to each laboratory and interlaboratory comparison on samples having high and low values of thorium 230

  6. Efficacy of 230Th normalization in sediments from the Juan de Fuca Ridge, northeast Pacific Ocean

    Science.gov (United States)

    Costa, Kassandra; McManus, Jerry

    2017-01-01

    230Th normalization is an indispensable method for reconstructing sedimentation rates and mass fluxes over time, but the validity of this approach has generated considerable debate in the paleoceanographic community. 230Th systematics have been challenged with regards to grain size bias, sediment composition (CaCO3), water column advection, and other processes. In this study, we investigate the consequences of these effects on 230Th normalization from a suite of six cores on the Juan de Fuca Ridge. The proximity of these cores (carbonate preservation, both of which may limit the usage of 230Th in this region. Despite anticipated complications, 230Th normalization effectively reconstructs nearly identical particle rain rates from all six cores, which are summarily unrelated to the total sedimentation rates as calculated from the age models. Instead the total sedimentation rates are controlled almost entirely by sediment focusing and winnowing, which are highly variable even over the short spatial scales investigated in this study. Furthermore, no feedbacks on 230Th systematics were detected as a consequence of sediment focusing, coarse fraction variability, or calcium carbonate content, supporting the robustness of the 230Th normalization technique.

  7. Mechanisms of TL for production of the 230 {sup o}C peak in natural sodalite

    Energy Technology Data Exchange (ETDEWEB)

    Cano, Nilo F., E-mail: nilocano@dfn.if.usp.b [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Blak, Ana R. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Ayala-Arenas, Jorge S. [Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil)

    2011-02-15

    The thermoluminescence (TL) peak in natural sodalite near 230 {sup o}C, which appears only after submitted to thermal treatments and to gamma irradiation, has been studied in parallel with electron paramagnetic resonance (EPR) spectrum appearing under the same procedure. This study revealed a full correlation between the 230 {sup o}C TL peak and the eleven hyperfine lines from EPR spectrum. In both case, the centers disappear at the same temperature and are restored after gamma irradiation. A complete model for the 230 {sup o}C TL peak is presented and discussed. In addition to the correlation and TL model, specific characteristics of the TL peaks are described.

  8. Performance analysis of WWER-440/230 nuclear power plants

    International Nuclear Information System (INIS)

    1997-01-01

    This report examines one particular design, the WWER-440/230, the first generation of commercial WWERs, essentially comparable to the western PWR. This design was installed widely in eastern Europe with a total of 16 unites being completed in what are now Armenia, Bulgaria, Germany (the former German Democratic Republic) the Slovak Republic and Russia. The plants in Armenia and Germany (the former German Democratic Republic) have been closed down, but particularly in Bulgaria and to a lesser extent the Slovak Republic the remaining plants supply a significant proportion of the electricity of the country and decisions to close them could not be taken lightly. The aim of this report is twofold: first to determine whether the impression given by these good overall performance indicators is confirmed using more detailed indicators covering a wide range of factors; second, to see to what extent good performance can be attributed to the industrial and institutional environment in which these plants were designed, built and operated. Particular attention is paid to identifying factors that may impact the quality of the service provided, especially those factors under management control which can be strongly influenced by current and future policy changes and those factors that are beyond the plant management control but could have influenced the performance of the power plants. Issues concerning the safety of these plants are of considerable importance, but they remain outside the scope of this report. Conclusions and recommendations formulated by the IAEA related to WWER safety are contained in the series of reports prepared in the framework of the Extrabudgetary Programme on WWER Safety. A programme progress report was published in 1994 (IAEA-TECDOC-773). Refs, figs, tabs

  9. Seismic upgrading of WWER 440-230 structures, units 1/2, Kozloduy NPP

    International Nuclear Information System (INIS)

    Stafanov, D.; Kostov, M.; Boncheva, H.; Varbanov, G.

    1995-01-01

    The purpose of this paper is to present final results from a big amount of computational work in connection with the investigations of the possibilities for upgrading of WWER 440-230 structures, units 1/2, Kozloduy NPP. (author)

  10. 10Be/230Th ratios as proxy for particle flux in the equatorial Pacific ocean

    International Nuclear Information System (INIS)

    Anderson, R.F.; Fleisher, M.Q.; Kubik, P.W.; Suter, M.

    1997-01-01

    Particulate 10 Be/ 230 Th ratios collected by sediment traps in the central equatorial Pacific Ocean exhibit a positive correlation with particle flux, but little or no correlation with particle composition. (author) 1 fig., 4 refs

  11. Why are so many arc magmas close to 238U- 230Th radioactive equilibrium?

    Science.gov (United States)

    Condomines, Michel; Sigmarsson, Olgeir

    1993-09-01

    New analyses of 238U- 230Th disequilibria are reported for four active volcanoes: Merapi and Krakatoa in the Sunda arc (Indonesia), Masaya in Central America (Nicaragua), and Ambrym in the New Hebrides island arc. Despite a large range in ( 230Th /232Th ) ratios (from 0.65 in Merapi andesites to 2.5 in Masaya basalts), 238U and 230Th are close to radioactive equilibrium, as in many other arc magmas. In several mantle sources, Th/U ratios have clearly been modified by metasomatic processes associated with subduction. This is demonstrated in Central America by the correlation between ( 230Th /232Th ) and 10Be /9Be ratios for several active volcanoes along the arc. It is proposed that the 238U- 230Th radioactive equilibrium found in many arc magmas is the result of disequilibrium melting involving an easily melted, slab-derived, metasomatic component which dominates the uranium and thorium budget of the mantle sources. The departure from equilibrium may be either due to mixing with 230Th enriched melts derived from unmetasomatized mantle sources or to a late stage uranium addition by fluids. This latter process, producing uranium enriched magmas, has a greater influence in uranium and thorium poor magmas.

  12. Cross sections of the reaction Pa-231(d,3n)U-230 for the production of U-230/Th-226 for targeted alpha therapy

    Czech Academy of Sciences Publication Activity Database

    Morgenstern, A.; Lebeda, Ondřej; Štursa, Jan; Capote, R.; Sin, M.; Bruchertseifer, F.; Zielinska, B.; Apostolidis, C.

    2009-01-01

    Roč. 80, č. 5 (2009), 054612/1-054612/6 ISSN 0556-2813 Institutional research plan: CEZ:AV0Z10480505 Keywords : Pa-231 * U-230 * Th-226 * reaction cross section * targeted alpha therapy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.477, year: 2009

  13. Uranium Age Determination by Measuring the 230Th / 234U Ratio

    International Nuclear Information System (INIS)

    LAMONT, STEPHEN P.

    2004-01-01

    A radiochemical isotope dilution mass spectrometry method has been developed to determine the age of uranium materials. The amount of 230Th activity, the first progeny of 234U, that had grown into a small uranium metal sample was used to determine the elapsed time since the material was last radiochemically purified. To preserve the sample, only a small amount of oxidized uranium was removed from the surface of the sample and dissolved. Aliquots of the dissolved sample were spiked with 233U tracer and radiochemically purified by anion-exchange chromatography. The 234U isotopic concentration was then determined by thermal ionization mass spectrometry. Additional aliquots of the sample were spiked with 229Th tracer, and the thorium was purified using two sequential anion-exchange chromatography separations. The isotopic concentrations of 230Th and 232Th were determined by TIMS. The lack of any 232Th confirmed the assumption that all thorium was removed from the uranium sample at the time of purification. The 230Th and 234U mass concentrations were converted to activities and the 230Th/234U ratio for the sample was calculated. The experimental 230Th/234U ratio showed the uranium in this sample was radiochemically purified in about 1945. Isotope dilution thermal ionization mass spectrometry has sufficient sensitivity to determine the age of 100 samples of uranium. This method could certainly be employed as a nuclear forensic method to determine the age of small quantities of uranium metal or salts. Accurate determination of the ultra-trace 230Th radiochemically separated from the uranium is possible due to the use of 229Th as an isotope dilution tracer. The precision in the experimental age of the uranium could be improved by making additional replicate measurements of the 230Th/234U isotopic ratio or using a larger initial sample

  14. Developments for 230 MeV superconducting cyclotrons for proton therapy and proton irradiation

    Science.gov (United States)

    Zhang, Tianjue; Wang, Chuan; Li, Ming; Cui, Tao; Yin, Zhiguo; Ji, Bin; Lv, Yinlong; Guan, Fengping; Ge, Tao; Xing, Jiansheng; Yang, Jianjun; Jia, Xianlu; Yin, Meng; Zhang, Suping; Cao, Xuelong; An, Shizhong; Wei, Sumin; Lin, Jun; Cao, Lei; Zhang, Dongsheng; Hou, Shigang; Wang, Feng; Gong, Pengfei

    2017-09-01

    There are very strong demands for mid-energy proton machine in recent years due to the surging cancer patients and fast progress of the space science in China. For the applications of proton therapy and proton irradiation, the energy range of proton beam is usually from 200 MeV to 250 MeV, or even higher for astronavigation. Based on the R&D starting from 2009, a construction project of a 230 MeV superconducting cyclotron (CYCIAE-230) has been launched recently at China Institute of Atomic Energy (CIAE). It was started in Jan 2015, for the program of proton therapy and space science launched by China National Nuclear Corporation (CNNC). In this paper, the designs for the superconducting (SC) cyclotron and its key components, including the main magnet, SC coils, internal ion source and central region, extraction system, etc, and the construction progress of the machine CYCIAE-230 will be presented.

  15. SLUDGE PARTICLE SEPAPATION EFFICIENCIES DURING SETTLER TANK RETRIEVAL INTO SCS-CON-230

    Energy Technology Data Exchange (ETDEWEB)

    DEARING JI; EPSTEIN M; PLYS MG

    2009-07-16

    The purpose of this document is to release, into the Hanford Document Control System, FA1/0991, Sludge Particle Separation Efficiencies for the Rectangular SCS-CON-230 Container, by M. Epstein and M. G. Plys, Fauske & Associates, LLC, June 2009. The Sludge Treatment Project (STP) will retrieve sludge from the 105-K West Integrated Water Treatment System (IWTS) Settler Tanks and transfer it to container SCS-CON-230 using the Settler Tank Retrieval System (STRS). The sludge will enter the container through two distributors. The container will have a filtration system that is designed to minimize the overflow of sludge fines from the container to the basin. FAI/09-91 was performed to quantify the effect of the STRS on sludge distribution inside of and overflow out of SCS-CON-230. Selected results of the analysis and a system description are discussed. The principal result of the analysis is that the STRS filtration system reduces the overflow of sludge from SCS-CON-230 to the basin by roughly a factor of 10. Some turbidity can be expected in the center bay where the container is located. The exact amount of overflow and subsequent turbidity is dependent on the density of the sludge (which will vary with location in the Settler Tanks) and the thermal gradient between the SCS-CON-230 and the basin. Attachment A presents the full analytical results. These results are applicable specifically to SCS-CON-230 and the STRS filtration system's expected operating duty cycles.

  16. Sludge Particle Sepapation Efficiencies During Settler Tank Retrieval Into SCS-CON-230

    International Nuclear Information System (INIS)

    Dearing, J.I.; Epstein, M.; Plys, M.G.

    2009-01-01

    The purpose of this document is to release, into the Hanford Document Control System, FA1/0991, Sludge Particle Separation Efficiencies for the Rectangular SCS-CON-230 Container, by M. Epstein and M. G. Plys, Fauske and Associates, LLC, June 2009. The Sludge Treatment Project (STP) will retrieve sludge from the 105-K West Integrated Water Treatment System (IWTS) Settler Tanks and transfer it to container SCS-CON-230 using the Settler Tank Retrieval System (STRS). The sludge will enter the container through two distributors. The container will have a filtration system that is designed to minimize the overflow of sludge fines from the container to the basin. FAI/09-91 was performed to quantify the effect of the STRS on sludge distribution inside of and overflow out of SCS-CON-230. Selected results of the analysis and a system description are discussed. The principal result of the analysis is that the STRS filtration system reduces the overflow of sludge from SCS-CON-230 to the basin by roughly a factor of 10. Some turbidity can be expected in the center bay where the container is located. The exact amount of overflow and subsequent turbidity is dependent on the density of the sludge (which will vary with location in the Settler Tanks) and the thermal gradient between the SCS-CON-230 and the basin. Attachment A presents the full analytical results. These results are applicable specifically to SCS-CON-230 and the STRS filtration system's expected operating duty cycles.

  17. Concentration of 232Th, 230Th and 228Th in various tissues of Japanese subjects

    International Nuclear Information System (INIS)

    Takizawa, Y.; Qingmei, H.; Hisamatsu, S.; Abe, T.

    1997-01-01

    The concentration of 232 Th, 230 Th and 228 Th in various human tissues of Japanese subjects obtained at autopsies are reported. The tissue samples were weighed, spiked with 234 Th tracer and ashed by acid. The solution was dried on a hot-plate. Separation of thorium radionuclides was accomplished through cation-exchange resin chromatography and electrodeposition. The concentrations of thorium isotopes were measured by α-spectrometry. Thorium-232 and 230 Th concentrations were found to be highest in lung, followed by bone. The maximum concentration of 228 Th was in bone. The lowest concentrations of thorium isotopes were in muscle. (author)

  18. A plant-produced Pfs230 vaccine candidate blocks transmission of Plasmodium falciparum.

    Science.gov (United States)

    Farrance, Christine E; Rhee, Amy; Jones, R Mark; Musiychuk, Konstantin; Shamloul, Moneim; Sharma, Satish; Mett, Vadim; Chichester, Jessica A; Streatfield, Stephen J; Roeffen, Will; van de Vegte-Bolmer, Marga; Sauerwein, Robert W; Tsuboi, Takafumi; Muratova, Olga V; Wu, Yimin; Yusibov, Vidadi

    2011-08-01

    Plasmodium falciparum is transmitted to a new host after completing its sexual cycle within a mosquito. Developing vaccines against the parasite sexual stages is a critical component in the fight against malaria. We are targeting multiple proteins of P. falciparum which are found only on the surfaces of the sexual forms of the parasite and where antibodies against these proteins have been shown to block the progression of the parasite's life cycle in the mosquito and thus block transmission to the next human host. We have successfully produced a region of the Pfs230 antigen in our plant-based transient-expression system and evaluated this vaccine candidate in an animal model. This plant-produced protein, 230CMB, is expressed at approximately 800 mg/kg in fresh whole leaf tissue and is 100% soluble. Administration of 230CMB with >90% purity induces strong immune responses in rabbits with high titers of transmission-blocking antibodies, resulting in a greater than 99% reduction in oocyst counts in the presence of complement, as determined by a standard membrane feeding assay. Our data provide a clear perspective on the clinical development of a Pfs230-based transmission-blocking malaria vaccine.

  19. Precise timing of the last interglacial period from mass spectrometric determination of thorium-230 in corals

    Science.gov (United States)

    Chen, J. H.; Wasserburg, G. J.; Ku, T.-L.; Edwards, R. Lawrence

    1987-01-01

    The development of mass spectrometric techniques for determination of Th-230 abundance has made it possible to reduce analytical errors in (U-238)-(U-234)-(Th-230) dating of corals even with very small samples. Samples of 6 x 10 to the 8th atoms of Th-230 can be measured to an accuracy of + or - 3 percent (2sigma), and 3 x 10 to the 10th atoms of Th-230 can be measured to an accuracy of + or - 0.2 percent. The time range over which useful age data on corals can be obtained now ranges from about 50 to about 500,000 years. For young corals, this approach may be preferable to C-14 dating. The precision with which the age of a coral can now be determined should make it possible to critically test the Milankovitch hypothesis concerning Pleistocene climate fluctuations. Analyses of a number of corals that grew during the last interglacial period yield ages of 122,000 to 130,000 years. The ages coincide with, or slightly post-date, the summer solar insolation high at 65 deg N latitude which occurred 128,000 years ago. This supports the idea that changes in Pleistocene climate can be the result of variations in the distribution of solar insolation caused by changes in the geometry of the earth's orbit and rotation axis.

  20. 12 CFR 230.1 - Authority, purpose, coverage, and effect on state laws.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority, purpose, coverage, and effect on..., and effect on state laws. (a) Authority. This part, known as Regulation DD, is issued by the Board of... advertising rules in § 230.8 of this part apply to any person who advertises an account offered by a...

  1. 48 CFR 52.230-7 - Proposal Disclosure-Cost Accounting Practice Changes.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 52.230-7 Proposal Disclosure—Cost Accounting Practice Changes. As prescribed in 30.201-3(c), insert the following provision: Proposal Disclosure—Cost Accounting Practice Changes (APR 2005... change in cost accounting practice, including unilateral changes requested to be desirable changes. YesNo...

  2. 230Th/234U dating of coral limestones and vertical uplift at Djibouti

    International Nuclear Information System (INIS)

    Faure, Hugues; Hoang, C.T.; Lalou, Claude

    1980-01-01

    Coral limestones sampled from marine terraces along the Afar coast have been dated by the 230 Th/ 234 U method. The ages confirm the stratigraphic unity of these formations and the existence of the paleo sea level dated 124 000 years ago in this region. These results permit to deduce the uplift rates of this littoral [fr

  3. 49 CFR 230.23 - Responsibility for general construction and safe working pressure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Responsibility for general construction and safe... MAINTENANCE STANDARDS Boilers and Appurtenances § 230.23 Responsibility for general construction and safe... general design, workmanship, age, and overall condition of the complete boiler unit. The condition of the...

  4. NEURONAL DEGENERATION, SYNAPTIC DEFECTS, AND BEHAVIORAL ABNORMALITIES IN TAU45-230 TRANSGENIC MICE

    Science.gov (United States)

    Lang, Ashlee E.; Methner, D. Nicole Riherd; Ferreira, Adriana

    2014-01-01

    The complement of mechanisms underlying tau pathology in neurodegenerative disorders has yet to be elucidated. Among these mechanisms, abnormal tau phosphorylation has received the most attention because neurofibrillary tangles present in Alzheimer’s disease (AD) and related disorders known as tauopathies are composed of hyperphosphorylated forms of this microtubule-associated protein. More recently, we showed that calpain-mediated cleavage leading to the generation of the 17 kDa tau45-230 fragment is a conserved mechanism in these diseases. To obtain insights into the role of this fragment in neurodegeneration, we generated transgenic mice that express tau45-230 and characterized their phenotype. Our results showed a significant increase in cell death in the hippocampal pyramidal cell layer of transgenic tau45-230 mice when compared to wild type controls. In addition, significant synapse loss was detected as early as six months after birth in transgenic hippocampal neurons. These synaptic changes were accompanied by alterations in the expression of the N-methyl-D-aspartate glutamate (NMDA) receptor subunits. Furthermore, functional abnormalities were detected in the transgenic mice using Morris Water Maze and fear conditioning tests. These results suggest that the accumulation of tau45-230 is responsible, at least in part, for neuronal degeneration and some behavioral changes in AD and other tauopathies. Collectively, these data provide the first direct evidence of the toxic effects of a tau fragment biologically produced in the context of these diseases in vertebrate neurons that develop in situ. PMID:24952329

  5. 48 CFR 52.230-5 - Cost Accounting Standards-Educational Institution.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Accounting Standards... Clauses 52.230-5 Cost Accounting Standards—Educational Institution. As prescribed in 30.201-4(e), insert the following clause: Cost Accounting Standards—Educational Institution (OCT 2010) (a) Unless the...

  6. 48 CFR 52.230-1 - Cost Accounting Standards Notices and Certification.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Accounting Standards... Provisions and Clauses 52.230-1 Cost Accounting Standards Notices and Certification. As prescribed in 30.201-3, insert the following provisions: Cost Accounting Standards Notices and Certification (OCT 2008...

  7. 22 CFR 230.10 - Payment to USAID of excess amounts received by a Noteholder.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment to USAID of excess amounts received by...-11-STANDARD TERMS AND CONDITIONS § 230.10 Payment to USAID of excess amounts received by a Noteholder. If a Noteholder shall, as a result of USAID paying compensation under this Guarantee, receive an...

  8. 50 CFR 216.230 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Rocket Launches from the Kodiak Launch Complex, Kodiak Island, AK § 216.230 Specified activity and specified geographical region... paragraph (b) of this section by U.S. citizens engaged in rocket launch activities (up to nine launches per...

  9. 230,232Th in milk, meat, and grain in Korea

    International Nuclear Information System (INIS)

    Lin, Xiujing; Choi, Minseok; Kim, Wan; Kang, Heedong; Doh, Sihhong; Kim, Dosung; Kim, Changkyu

    2004-01-01

    The concentrations of natural radioisotopes 230 Th and 232 Th in Korean foods were measured by the method of calcium oxalate co-precipitation in addition to the conventional anion-exchange method and alpha spectroscopic measurement. The 230 Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.14-2.45, pork 2.98-8.97, beef 1.94-9.80, chicken 1.22-13.0, rice 0.43-2.35, wheat 0.53-14.4, and soybeans, 8.44-91.6. The 232 Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.01-2.46, pork 0.28-9.32, beef 1.02-5.34, chicken 0.56-4.98, rice 0.32-2.54, wheat 0.53-20.0, and soybeans, 2.30-42.2. The annual internal dose of Th was also estimated. The annual internal dose of 230 Th and 232 Th in milk was about 0.006 μSv/yr and much lower than that of other countries because of the low intake of milk in Korea compared to other countries. The annual internal dose of 230 Th and 232 Th in the rice was about 0.043 μSv/yr and highest because rice is the staple food of Koreans. (author)

  10. 49 CFR 230.37 - Steam test following repairs or alterations.

    Science.gov (United States)

    2010-10-01

    ... Boilers and Appurtenances Pressure Testing of Boilers § 230.37 Steam test following repairs or alterations... test of the boiler with steam pressure raised to between 95 percent and 100 percent of the MAWP. At this time, the boiler shall be inspected to ensure that it is in a safe and suitable condition for...

  11. 24 CFR 572.230 - Cash and Management Information (C/MI) System.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Cash and Management Information (C... HOMES PROGRAM (HOPE 3) Grants § 572.230 Cash and Management Information (C/MI) System. Disbursement of HOPE 3 grant funds is managed through HUD's Cash and Management Information (C/MI) System for the HOPE...

  12. 17 CFR 230.482 - Advertising by an investment company as satisfying requirements of section 10.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Advertising by an investment... Investment Companies; Business Development Companies § 230.482 Advertising by an investment company as... should be read carefully before investing. (2) Advertisements used prior to effectiveness of registration...

  13. 25 CFR 1000.230 - How is a waiver approval documented for the record?

    Science.gov (United States)

    2010-04-01

    ... INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.230 How is a waiver approval documented for the... posted on the Office of Self-Governance web site and all such decisions shall be made available on...

  14. Biaxial thermal creep of Inconel 617 and Haynes 230 at 850 and 950 °C

    International Nuclear Information System (INIS)

    Tung, Hsiao-Ming; Mo, Kun; Stubbins, James F.

    2014-01-01

    The biaxial thermal creep behavior of Inconel 617 and Haynes 230 at 850 and 950 °C was investigated. Biaxial stresses were generated using the pressurized tube technique. The detailed creep deformation and fracture mechanism have been studied. Creep curves for both alloys showed that tertiary creep accounts for a greater portion of the materials’ life, while secondary creep only accounts for a small portion. Fractographic examinations of the two alloys indicated that nucleation, growth, and coalescence of creep voids are the dominant micro-mechanisms for creep fracture. At 850 °C, alloy 230 has better creep resistance than alloy 617. When subjected to the biaxial stress state, the creep rupture life of the two alloys was considerably reduced when compared to the results obtained by uniaxial tensile creep tests. The Monkman–Grant relation proves to be a promising method for estimating the long-term creep life for alloy 617, whereas alloy 230 does not follow the relation. This might be associated with the significant changes in the microstructure of alloy 230 at high temperatures

  15. 40 CFR 230.54 - Parks, national and historical monuments, national seashores, wilderness areas, research sites...

    Science.gov (United States)

    2010-07-01

    ....54 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b... Human Use Characteristics § 230.54 Parks, national and historical monuments, national seashores... -managed. Note: Possible actions to minimize adverse impacts regarding site or material characteristics can...

  16. 33 CFR 96.230 - What objectives must a safety management system meet?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SYSTEMS Company and Vessel Safety Management Systems § 96.230 What objectives must a safety management system meet? The safety management system must: (a) Provide for safe practices in vessel operation... improve safety management skills of personnel ashore and aboard vessels, including preparation for...

  17. 17 CFR 230.146 - Rules under section 18 of the Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Rules under section 18 of the... GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.146 Rules under section 18 of the Act... national securities exchanges, or segments or tiers thereof, have listing standards that are substantially...

  18. 17 CFR 230.497 - Filing of investment company prospectuses-number of copies.

    Science.gov (United States)

    2010-04-01

    ... Governments Or Political Subdivisions Thereof § 230.497 Filing of investment company prospectuses—number of... 1934 (15 U.S.C. 78o) that has adopted rules providing standards for the investment company advertising practices of its members and has established and implemented procedures to review that advertising. (j) In...

  19. 17 CFR 230.801 - Exemption in connection with a rights offering.

    Science.gov (United States)

    2010-04-01

    ... thereto, in English, to the Commission on Form CB (§ 239.800 of this chapter) by the first business day..., Exchange Offers and Business Combinations § 230.801 Exemption in connection with a rights offering. A... document to U.S. holders, including any amendments thereto, in English, on a comparable basis to that...

  20. 22 CFR 230.08 - Event of Default; Application for Compensation; payment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Event of Default; Application for Compensation...-STANDARD TERMS AND CONDITIONS § 230.08 Event of Default; Application for Compensation; payment. At any time after an Event of Default, as this term is defined in an Eligible Note, any Noteholder hereunder, or the...

  1. 23 CFR 230.111 - Implementation of special requirements for the provision of on-the-job training.

    Science.gov (United States)

    2010-04-01

    ... of on-the-job training. 230.111 Section 230.111 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT... requirements for the provision of on-the-job training. (a) The State highway agency shall determine which... agency may modify the special provisions to specify the numbers to be trained in specific job...

  2. 40 CFR 745.230 - Work practice standards for conducting lead-based paint activities: public and commercial...

    Science.gov (United States)

    2010-07-01

    ... Activities § 745.230 Work practice standards for conducting lead-based paint activities: public and... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Work practice standards for conducting lead-based paint activities: public and commercial buildings, bridges and superstructures. 745.230...

  3. 76 FR 60733 - Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton...

    Science.gov (United States)

    2011-09-30

    .... Basis and Purpose The Captain of the Port New Orleans has implemented a safety zone from mile marker 230... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton Rouge, LA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule...

  4. 17 CFR 230.166 - Exemption from section 5(c) for certain communications in connection with business combination...

    Science.gov (United States)

    2010-04-01

    ...) for certain communications in connection with business combination transactions. 230.166 Section 230... only to communications relating to business combinations. The exemption does not apply to...) Communications. In a registered offering involving a business combination transaction, any communication made in...

  5. 77 FR 77016 - Authorization of Production Activity: Foreign-Trade Zone 230: Sonoco Corrflex (Kitting-Gift Sets...

    Science.gov (United States)

    2012-12-31

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-69-2012] Authorization of Production Activity: Foreign-Trade Zone 230: Sonoco Corrflex (Kitting-Gift Sets); Rural Hall and Winston-Salem, North Carolina On August 20, 2012, the Piedmont Triad Partnership, grantee of FTZ 230, submitted a notification of...

  6. 39 CFR 230.16 - Is there a prohibition on presenting Office of Inspector General reports or records during an...

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Is there a prohibition on presenting Office of Inspector General reports or records during an employee's testimony? 230.16 Section 230.16 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL Rules Governing...

  7. 39 CFR 230.14 - Who owns the written or recorded notes, memoranda, reports, and transcriptions made pursuant to...

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Who owns the written or recorded notes, memoranda, reports, and transcriptions made pursuant to an official investigation, audit, or review conducted by an employee of the Office of Inspector General? 230.14 Section 230.14 Postal Service UNITED STATES POSTAL...

  8. 39 CFR 230.13 - Why are restrictions on Office of Inspector General employees in civil proceedings necessary?

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Why are restrictions on Office of Inspector General employees in civil proceedings necessary? 230.13 Section 230.13 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL Rules Governing Compliance...

  9. 17 CFR 230.158 - Definitions of certain terms in the last paragraph of section 11(a).

    Science.gov (United States)

    2010-04-01

    ... in the last paragraph of section 11(a). 230.158 Section 230.158 Commodity and Securities Exchanges... Definitions of certain terms in the last paragraph of section 11(a). (a) An “earning statement” made generally available to securityholders of the registrant pursuant to the last paragraph of section 11(a) of the Act...

  10. 17 CFR 230.151 - Safe harbor definition of certain “annuity contracts or optional annuity contracts” within the...

    Science.gov (United States)

    2010-04-01

    ... law at the time the contract is issued (or if the minimum rate applicable to an existing contract is... certain âannuity contracts or optional annuity contractsâ within the meaning of section 3(a)(8). 230.151 Section 230.151 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND...

  11. Relationship between ISO 230-2/-6 Test Results and Positioning Accuracy of Machine Tools Using LaserTRACER

    Directory of Open Access Journals (Sweden)

    Hau-Wei Lee

    2016-04-01

    Full Text Available To test the positioning accuracy and repeatability of the linear axes of machine tools, ISO (International Standards Organization 230-2 and ISO 230-6 are usually adopted. Auto-tracking laser interferometers (ATLI can perform the testing for the positioning accuracy and the repeatability including x-, y- and z-axes according to ISO 230-2 as well as xy, xz, yz, and xyz diagonal lines following ISO 230-6. LaserTRACER is a kind of ATLI. One of the steps of the ISO 230-2 and -6 tests using LaserTRACER is to determine the coordinate of the LaserTRACER with respect to the home point of the machine tool. Positioning accuracy of the machine tool causes the coordinate determined error, which might influence the test result. To check on this error, this study performs three experiments. The experiment results show that the positioning error appears on the testing results.

  12. 231Pa and 230Th in the ocean model of the Community Earth System Model (CESM1.3)

    Science.gov (United States)

    Gu, Sifan; Liu, Zhengyu

    2017-12-01

    The sediment 231Pa / 230Th activity ratio is emerging as an important proxy for deep ocean circulation in the past. In order to allow for a direct model-data comparison and to improve our understanding of the sediment 231Pa / 230Th activity ratio, we implement 231Pa and 230Th in the ocean component of the Community Earth System Model (CESM). In addition to the fully coupled implementation of the scavenging behavior of 231Pa and 230Th with the active marine ecosystem module (particle-coupled: hereafter p-coupled), another form of 231Pa and 230Th have also been implemented with prescribed particle flux fields of the present climate (particle-fixed: hereafter p-fixed). The comparison of the two forms of 231Pa and 230Th helps to isolate the influence of the particle fluxes from that of ocean circulation. Under present-day climate forcing, our model is able to simulate water column 231Pa and 230Th activity and the sediment 231Pa / 230Th activity ratio in good agreement with available observations. In addition, in response to freshwater forcing, the p-coupled and p-fixed sediment 231Pa / 230Th activity ratios behave similarly over large areas of low productivity on long timescales, but can differ substantially in some regions of high productivity and on short timescales, indicating the importance of biological productivity in addition to ocean transport. Therefore, our model provides a potentially powerful tool to help the interpretation of sediment 231Pa / 230Th reconstructions and to improve our understanding of past ocean circulation and climate changes.

  13. 230Th-238U disequilibrium systematics in oceanic tholeiites from 210N on the East Pacific Rise

    International Nuclear Information System (INIS)

    Newman, S.; Finkel, R.C.; MacDougall, J.D.

    1983-01-01

    Significant disequilibrium occurs between 230 Th and its parent, 238 U, in a suite of fresh basalt glasses from the RISE Project study area at 21 0 N on the East Pacific Rise. The ( 230 Th/ 232 Th) activity ratios observed for eight of nine samples from the crest of the axis at this site are constant within analytical uncertainty, with a value of 1.22. This observed homogeneity of ( 230 Th/ 232 Th) has two possible interpretations. First, the measured ( 230 Th/ 232 Th) can be considered to indicate a mantle-source for the RISE basalts with Th/U of 2.5. This interpretation, however, conflicts with the proposed correlation between ( 230 Th/ 232 Th) and 87 Sr/ 86 Sr which predicts that ( 230 Th/ 232 Th) should equal 1.33 at the RISE site. A second possible interpretation is that radioactive decay of 230 Th, in the basalts themselves or in a magma chamber, has decreased ( 230 Th/ 232 Th) from 1.33 to the observed values. The required time span is 11,000 to > 100,000 years. However, petrologic arguments rule against long residence time in a magma chamber, and the spreading rate of this section of the East Pacific Rise (6 cm/yr) predicts that the maximum age for axis basalts is 27,000 years. Both interpretations of the measured ( 230 Th/ 232 Th) imply a low Th/U ratio for the RISE basalt source and suggest that the MORB source at this location is depleted in Th with respect to U relative to primitive mantle or bulk earth. (orig./WL)

  14. Measurement of 230Pa and 186Re Production Cross Sections Induced by Deuterons at Arronax Facility

    Science.gov (United States)

    Duchemin, Charlotte; Guertin, Arnaud; Metivier, Vincent; Haddad, Ferid; Michel, Nathalie

    2014-02-01

    A dedicated program has been launched on production of innovative radionuclides for PET imaging and for β- and α targeted radiotherapy using proton or α particles at the ARRONAX cyclotron. Since the accelerator is also able to deliver deuteron beams up to 35 MeV, we have reconsidered the possibility of using them to produce medical isotopes. Two isotopes dedicated to targeted therapy have been considered: 226Th, a decay product of 230Pa, and 186Re. The production cross sections of 230Pa and 186Re, as well as those of the contaminants created during the irradiation, have been determined by the stacked-foil technique using deuteron beams. Experimental values have been quantified using a referenced cross section. The measured cross sections have been used to determine expected production yields and compared with the calculated values obtained using the Talys code with default parameters.

  15. On the possible ''normalization'' of experimental curves of 230Th vertical distribution in abyssal oceanic sediments

    International Nuclear Information System (INIS)

    Kuznetsov, Yu.V.; Al'terman, Eh.I.; Lisitsyn, A.P.; AN SSSR, Moscow. Inst. Okeanologii)

    1981-01-01

    The possibilities of the method of normalization of experimental ionic curves in reference to dating of abyssal sediments and establishing their accumulation rapidities are studied. The method is based on using correlation between ionic curves extrema and variations of Fe, Mn, C org., and P contents in abyssal oceanic sediments. It has been found that the above method can be successfully applied for correction of 230 Th vertical distribution data obtained by low-background γ-spectrometry. The method leads to most reliable results in those cases when the vertical distribution curves in sediments of elements concentrators of 230 Th are symbasic between themselves. The normalization of experimental ionic curves in many cases gives the possibility to realize the sediment age stratification [ru

  16. Automatic Color Sorting Machine Using TCS230 Color Sensor And PIC Microcontroller

    Directory of Open Access Journals (Sweden)

    Kunhimohammed C K

    2015-12-01

    Full Text Available Sorting of products is a very difficult industrial process. Continuous manual sorting creates consistency issues. This paper describes a working prototype designed for automatic sorting of objects based on the color. TCS230 sensor was used to detect the color of the product and the PIC16F628A microcontroller was used to control the overall process. The identification of the color is based on the frequency analysis of the output of TCS230 sensor. Two conveyor belts were used, each controlled by separate DC motors. The first belt is for placing the product to be analyzed by the color sensor, and the second belt is for moving the container, having separated compartments, in order to separate the products. The experimental results promise that the prototype will fulfill the needs for higher production and precise quality in the field of automation.

  17. Antimicrobial susceptibility testing of 230 Helicobacter pylori strains: importance of medium, inoculum, and incubation time

    DEFF Research Database (Denmark)

    Hartzen, S H; Andersen, L P; Bremmelgaard, A

    1997-01-01

    No standardized method of susceptibility testing for Helicobacter pylori is currently available, so before a large agar dilution study comprising 230 H. pylori strains belonging to more than 80 genetically different groups was initiated, we performed a relatively small preliminary study....../spot) as the inoculum and 72 h as the incubation time. A modest inoculum effect was noted for amoxicillin and metronidazole. By the methodology derived from our preliminary study, the susceptibilities of 230 H. pylori strains to six antibiotics were subsequently determined. The results were generally in accord...... with those of others, and apart from metronidazole, the MIC of which for approximately 25% of the strains tested was >8 microg/ml, resistance was low in Denmark. The situation might, however, quickly change when and if the number of indications for antibiotic therapy for H. pylori infections increase...

  18. Determination of 232Th, 230Th and 228Th in liquid effluents from uranium mining

    International Nuclear Information System (INIS)

    Godoy, Jose Marcus de Oliveira

    1979-10-01

    A liquid scintillator αlpha spectrometer was built for the determination of Th- 228 , Th- 230 and Th- 232 in liquid effluents from Uranium mines and mills. The resolution of the αlpha spectrometer was found to be 200-300 KeV, when the scintillator was 8% T0P0, 0,77% scintimix-4 (91% PP0 and 9% Dimetil-P0P0P) and 10% of naphthalene in toluene. Aliquat-336 in xylene (30% v/v) was used to separate the thorium isotopes from other interfering radionuclides (U- 238 , U- 234 , Ra- 226 , Po- 210 ). Under the extraction experimental conditions, the detection limits were 1,2 pCi/1 for Th- 232 , 1,2 pCi/1 for Th- 230 and 0,9 pCi/1 for Th- 228 , for 1000 minutes of counting time. (author)

  19. TRAP230/ARC240 and TRAP240/ARC250 Mediator subunits are functionally conserved through evolution

    DEFF Research Database (Denmark)

    Samuelsen, Camilla O; Baraznenok, Vera; Khorosjutina, Olga

    2003-01-01

    for Srb8 and Srb9. Here, we identify a TRAP240/ARC250 homologue in Schizosaccharomyces pombe and demonstrate that this protein, spTrap240, is stably associated with a larger form of Mediator, which also contains conserved homologues of Srb8, Srb10, and Srb11. We find that spTrap240 and Sch. pombe Srb8 (sp...... with the polymerase. Our findings provide experimental evidence for recent suggestions that TRAP230/ARC240 and TRAP240/ARC250 may indeed be the Srb8 and Srb9 homologues of mammalian Mediator. Apparently Srb8/TRAP230/ARC240, Srb9/TRAP240/ARC250, Srb10, and Srb11 constitute a conserved Mediator submodule, which...

  20. Vectorization of nuclear codes on FACOM 230-75 APU computer

    International Nuclear Information System (INIS)

    Harada, Hiroo; Higuchi, Kenji; Ishiguro, Misako; Tsutsui, Tsuneo; Fujii, Minoru

    1983-02-01

    To provide for the future usage of supercomputer, we have investigated the vector processing efficiency of nuclear codes which are being used at JAERI. The investigation is performed by using FACOM 230-75 APU computer. The codes are CITATION (3D neutron diffusion), SAP5 (structural analysis), CASCMARL (irradiation damage simulation). FEM-BABEL (3D neutron diffusion by FEM), GMSCOPE (microscope simulation). DWBA (cross section calculation at molecular collisions). A new type of cell density calculation for particle-in-cell method is also investigated. For each code we have obtained a significant speedup which ranges from 1.8 (CASCMARL) to 7.5 (GMSCOPE), respectively. We have described in this report the running time dynamic profile analysis of the codes, numerical algorithms used, program restructuring for the vectorization, numerical experiments of the iterative process, vectorized ratios, speedup ratios on the FACOM 230-75 APU computer, and some vectorization views. (author)

  1. Microstructural Characterization of Foil-Gage Haynes (register trademark) 230 (registered trademark) (Preprint)

    Science.gov (United States)

    2010-01-01

    Haynes 230is a solid-solution- and carbide-strengthened nickel-based superalloy noted for its excellent high-temperature strength, resistance to... cobalt , iron and boron represent ‘not to exceed’ value and that the measured values from the ingot in this study meet this standard. Material...2002). Superalloys . A Technical Guide. 2nd edition. Materials Park: ASM International. 12 Davis, J.R., (1997). Heat Resistant Materials Materials

  2. The influence of nepheloid layers on global model simulations of 231Pa and 230Th.

    Science.gov (United States)

    Basak, C.; Plancherel, Y.; Khatiwala, S.; Anderson, R. F.

    2016-12-01

    231Pa and 230Th in the ocean are produced at a constant ratio by Uranium decay but adsorption onto particles removes these tracers differentially. This fractionation process makes it possible to use the elemental 231Pa/230Th ratio as a paleoceanography proxy, frequently used for deriving the strength of Atlantic Meridional Overturning Circulation. The removal process, however, is further complicated by the abundance and composition of the available particle types. Understanding how dissolved tracers interact with the particle field in the ocean is key to better understand the biogeochemical cycling of these particle-reactive elements and their use as a flux tracer in present and past oceans. We here present simulations of the 231Pa/230Th ratio using the Transport Matrix Method (TMM, Khatiwala, 2007), focusing especially on the role of the nepheloid layer in controlling the distribution of these radiotracers. The model simulates each tracer separately, with advective-diffusive transport based on the ECCO ocean state estimate (Stammer et al., 2004). Sources include production by Uranium decay and dust dissolution. Radioactive decay and importantly, reversible scavenging and sedimentation are the main sinks that control the removal of the radiotracers. Similar to previous studies, we consider particle fields consisting of calcium carbonate, opal, particle organic matter, and dust. A novelty is that we explicitly consider the influence of an additional bottom particle layer (nepheloid). Simulations that include a nepheloid layer produce vertical profiles that better fit the observed distribution of 230Th and 231Pa. Specifically, observational data in the South Atlantic and eastern South Pacific indicate a mid-depth inflection (for both Pa and Th), a feature that can only be obtained if a nepheloid layer is included in the simulation. Our simulations reinforce the idea that nepheloid layers play an important role in Pa and Th cycling in the ocean (Deng et al., 2014

  3. Floor response spectra for seismic qualification of Kozloduy VVER 440-230 NPP

    International Nuclear Information System (INIS)

    Kostov, M.K.; Prato, C.A.; Stevenson, J.D.

    1993-01-01

    In this paper the floor response spectra generation methodology for Kozloduy NPP, Unit 1-2 of VVER 440-230 is presented. The 2D coupled soil-structure interaction models are used combined with a simplified correction of the final results for accounting of torsional effects. Both time history and direct approach for in-structure spectra generation are used and discussion of results is made

  4. Floor response spectra for seismic qualification of Kozloduy VVER 440-230 NPP

    Energy Technology Data Exchange (ETDEWEB)

    Kostov, M.K. [Bulgarian Academy of Sciences, Sofia (BG). Central Lab. for Seismic Mechanics and Earthquake Engineering; Ma, D.C. [Argonne National Lab., IL (United States); Prato, C.A. [Univ. of Cordoba (AR); Stevenson, J.D. [Stevenson and Associates, Cleveland, OH (US)

    1993-08-01

    In this paper the floor response spectra generation methodology for Kozloduy NPP, Unit 1-2 of VVER 440-230 is presented. The 2D coupled soil-structure interaction models are used combined with a simplified correction of the final results for accounting of torsional effects. Both time history and direct approach for in-structure spectra generation are used and discussion of results is made.

  5. Measurements of 234U, 238U and 230Th in excreta of uranium-mill crushermen

    International Nuclear Information System (INIS)

    Fisher, D.R.; Jackson, P.O.; Brodacynski, G.G.; Scherpelz, R.I.

    1982-07-01

    Uranium and thorium levels in excreta of uranium mill crushermen who are routinely exposed to airborne uranium ore dust were measured. The purpose was to determine whether 230 Th was preferentially retained over either 234 U or 238 U in the body. Urine and fecal samples were obtained from fourteen active crushermen with long histories of exposure to uranium ore dust, plus four retired crushermen and three control individuals for comparison. Radiochemical procedures were used to separate out the uranium and thorium fractions, which were then electroplated on stainless steel discs and assayed by alpha spectrometry. Significantly greater activity levels of 234 U and 238 U were measured in both urine and fecal samples obtained from uranium mill crushermen, indicating that uranium in the inhaled ore dust was cleared from the body with a shorter biological half-time than the daughter product 230 Th. The measurements also indicated that uranium and thorium separate in vivo and have distinctly different metabolic pathways and transfer rates in the body. The appropriateness of current ICRP retention and clearance parameters for 230 Th in ore dust is questioned

  6. Ranking of safety issues for WWER-440 model 230 nuclear power plants

    International Nuclear Information System (INIS)

    1992-02-01

    In response to requests from Member States operating Soviet designed WWER-440/230 nuclear power plants (NPPs) for assistance through the IAEA's nuclear safety services, a major international project was established to evaluate these first generation reactors as a complement to relevant ongoing national, bilateral and multilateral activities. The objective is to assist countries operating WWER-440/230 NPPs in performing comprehensive safety reviews aimed at identifying design and operational weaknesses. The scope of the project includes a review of the conceptual design of WWER-440/230 NPPs, safety review missions to each one of the operating reactors to review design and operational aspects and studies to resolve issues of generic safety concern. This report was prepared by a group of international experts and the IAEA staff and discussed by the Project Steering Committee, December 9-13, 1991 in Vienna. An overview of the safety issues identified is presented indicating their effect on the performance of the basic safety functions. Conceptual recommendations related to design issues are given as a technical basis for the safety modifications required

  7. 230Th-234U Model-Ages of Some Uranium Standard Reference Materials

    International Nuclear Information System (INIS)

    Williams, R.W.; Gaffney, A.M.; Kristo, M.J.; Hutcheon, I.D.

    2009-01-01

    The 'age' of a sample of uranium is an important aspect of a nuclear forensic investigation and of the attribution of the material to its source. To the extent that the sample obeys the standard rules of radiochronometry, then the production ages of even very recent material can be determined using the 230 Th- 234 U chronometer. These standard rules may be summarized as (a) the daughter/parent ratio at time=zero must be known, and (b) there has been no daughter/parent fractionation since production. For most samples of uranium, the 'ages' determined using this chronometer are semantically 'model-ages' because (a) some assumption of the initial 230 Th content in the sample is required and (b) closed-system behavior is assumed. The uranium standard reference materials originally prepared and distributed by the former US National Bureau of Standards and now distributed by New Brunswick Laboratory as certified reference materials (NBS SRM = NBL CRM) are good candidates for samples where both rules are met. The U isotopic standards have known purification and production dates, and closed-system behavior in the solid form (U 3 O 8 ) may be assumed with confidence. We present here 230 Th- 234 U model-ages for several of these standards, determined by isotope dilution mass spectrometry using a multicollector ICP-MS, and compare these ages with their known production history

  8. A simple screening method for the determination of 230Th in soil and sediment samples by gamma-spectrometry

    International Nuclear Information System (INIS)

    Lozano, J.C.; Rodriguez, P.B.; Tome, F.V.

    2001-01-01

    A simple and easy to perform method for the determination of 230 Th in soil and sediment samples using gamma-spectrometry is proposed and compared with the more usual procedure using alpha-particle spectrometry. The proposed method involves an efficiency calibration for the specific determination of this radionuclide instead of a complete calibration of the spectra. A single density parameter is introduced to correct the efficiencies obtained from the reference sources. The activities of 230 Th determined by gamma-spectrometry and alpha-particle spectrometry are compared. The minimum detectable activity values obtained are completely adequate for 230 Th determination in soil and sediment samples, in which 230 Th activities are usually fairly high. Thus, this procedure is intended as a very easy way to obtain the activity of this radionuclide in these types of samples, at least as a screening method before carrying out other more laborious procedures. (author)

  9. {sup 10}Be/{sup 230}Th ratios as proxy for particle flux in the equatorial Pacific ocean

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, R.F.; Fleisher, M.Q. [LDEO of Columbia Univ. (United States); Kubik, P.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Suter, M. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

    1997-09-01

    Particulate {sup 10}Be/{sup 230}Th ratios collected by sediment traps in the central equatorial Pacific Ocean exhibit a positive correlation with particle flux, but little or no correlation with particle composition. (author) 1 fig., 4 refs.

  10. 230Th- 238U disequilibrium systematics in oceanic tholeiites from 21°N on the East Pacific Rise

    Science.gov (United States)

    Newman, S.; Finkel, R. C.; MacDougall, J. D.

    1983-10-01

    Significant disequilibrium occurs between 230Th and its parent, 238U, in a suite of fresh basalt glasses from the RISE Project study area at 21°N on the East Pacific Rise. The ( 230Th/ 232Th) activity ratios observed for eight of nine samples from the crest of the axis at this site are constant within analytical uncertainty, with a value of 1.22. This observed homogeneity of ( 230Th/ 232Th) has two possible interpretations. First, the measured ( 230Th/ 232Th) can be considered to indicate a mantle-source for the RISE basalts with Th/U of 2.5. This interpretation, however, conflicts with the proposed correlation between ( 230Th/ 232Th) and 87Sr/ 86Sr [1] which predicts that ( 230Th/ 232Th) should equal 1.33 at the RISE site. A second possible interpretation is that radioactive decay of 230Th, in the basalts themselves or in a magma chamber, has decreased ( 230Th/ 232Th) from 1.33 to the observed values. The required time span is 11,000 to > 100,000 years. However, petrologic arguments rule against long residence time in a magma chamber, and the spreading rate of this section of the East Pacific Rise (6 cm/yr) predicts that the maximum age for axis basalts is 27,000 years. Both interpretations of the measured ( 230Th/ 232Th) imply a low Th/U ratio for the RISE basalt source and suggest that the MORB source at this location is depleted in Th with respect to U relative to primitive mantle or bulk earth. In spite of their constant ( 230Th/ 232Th), the basalts from 21°N have wide ranges of measured Th/U and thorium and uranium concentrations, in apparent conflict with the common assumption that these two elements have very small, similar crystal-liquid partition coefficients. Participation of an accessory phase with high Th and U concentrations during partial melting or fractional crystallization appears to be required to explain this anomaly. Major and other trace element compositions provide more information about petrogenetic processes. Although fractional

  11. Development of an improved extruded dielectric cable rated 230 kV

    Energy Technology Data Exchange (ETDEWEB)

    Blais, L D; Traut, R T; Bolden, G N

    1977-05-01

    Work performed on developing an improved 230 kV extruded solid dielectric cable, the techniques of jointing such cables and the testing of terminations suitable for operation at that voltage level are described. Difficulties were encountered during manufacture in applying the semi-conducting extruded conductor shield. A new higher melt point compound solved the problem. A joint capable of operating at the 230 kV level was developed but showed a deficiency under voltage impulse testing while the conductor was at elevated temperature. A reduction in contract scope terminated this effort. Two terminals rated for 230 kV were found to be commercially available from domestic manufacturers. The limited testing performed showed them to be compatible with the cable cross-linked polyethylene insulation and electrically sound under 60 Hertz testing. No direct voltage or impulse voltage testing was performed on the terminations. A sample circuit, consisting of cable and joint, was subjected to impulse voltages at both room temperature and normal conductor operating temperature of 90/sup 0/C. While the cable only was able to withstand voltage impulses in excess of the Basic Impulse Level (BIL) at room temperature, it failed at BIL while conductor was heated to 90/sup 0/C. In like manner, a cable and joint circuit was assembled. Similar voltages were impressed at room temperature without incident. The joint failed at 90/sup 0/C conductor temperature. Cable, joint and termination were assembled in a simulated circuit and subjected to conductor loading to elevate temperature while 60 Hz voltages in excess of normal operating levels were continuously applied.

  12. Distribution of Th-230 and Th-228 in foods(II)

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Hee Dong; Kim, Wan; Lim, S. K.; Lee, S. A.; Choi, M. S.; Zheng, Y. C. [Kyungpook National Univ., Daegu (Korea, Republic of); Kim, Do Sung [Daegu Univ., Daegu (Korea, Republic of)

    2004-02-15

    Natural radioisotopes contained in foods can enter the human body by ingestion and contribute to internal doses to the population. It is necessary to measure the concentration of natural radioisotopes especially thorium in Korean foods and estimate the internal doses. In this study, we have established the thorium measuring process based on the thorium extraction chemical process and alpha spectroscopic method. The concentration of Th-228, Th-230 and Th-232 in Korean vegetables (potato, sweet potato, radish, cabbage, hot pepper, garlic, onion and pumpkin) and fruits(apple, persimmon, orange, pear, grape) are measured and their internal doses are estimated.

  13. Sidney-North Yuma 230-kV Transmission Line Project, Colorado and Nebraska

    Energy Technology Data Exchange (ETDEWEB)

    1991-06-01

    This report describes the need for a 230-kV overhead transmission line to supply power from Sidney, Nebraska to eastern Colorado. The alternative scenario compared to construction of the line is No Action. Rejected alternatives include underground lines and different routing paths, with a possible extension to the Sterling area. Both scenarios are evaluated for environmental effects, cost, and consequences for the eastern Colorado region. The proposed route is determined to be the environmentally preferred choice. 120 refs., 6 figs., 13 tabs. (MHB)

  14. Potential Energy Surfaces of the Even-Even 230-238 U Isotopes

    Directory of Open Access Journals (Sweden)

    Sohair M. Diab

    2008-07-01

    Full Text Available Nuclear structure of 230-238 U isotopes hav been studied in the frame work of the interacting boson approximation model (IBM-1. The contour plot of the potential energy surfaces, $V(eta,gamma$, shows that all nuclei are deformed and have rotational characters, $SU(3$. Levels energy spectra belonging to the $gsb$, $eta $, $gamma $ bands, electromagnetic transition rates $B(E1$ and $ B(E2$, quadrupole moment $Q_0 $, deformation parameter are $eta_2$ and the strength of the electric monopole transitions $X(E0/E2$ are calculated. The calculated values are compared with the available theoretical and experimental data and show reasonable agreement.

  15. Potential Energy Surfaces of the Even-Even 230-238 U Isotopes

    Directory of Open Access Journals (Sweden)

    Diab S. M.

    2008-07-01

    Full Text Available Nuclear structure of 230 - 238 U isotopes have been studied in the frame work of the in- teracting boson approximation model (IBM-I. The contour plot of the potential energy surfaces, V ( ; , shows that all nuclei are deformed and have rotational char- acters, SU (3 . Levels energy spectra belonging to the gsb , , bands, electromagnetic transition rates B ( E 1 and B ( E 2 , quadrupole moment Q 0 , deformation parameterare 2 and the strength of the electric monopole transitions X ( E 0 =E 2 are calculated. The calculated values are compared with the available theoretical and experimental data and show reasonable agreement.

  16. Testing the 231Pa/230Th paleo-circulation proxy: A data versus 2D model comparison

    International Nuclear Information System (INIS)

    Lippold, Jorg; Gherardi, Jeanne-Marie; Luo, Yiming

    2011-01-01

    Variations of the Atlantic Meridional Overturning Circulation (AMOC) are believed to have crucially influenced Earth's climate due to its key role in the inter-hemispheric redistribution of heat and carbon. To assess its past strength, the sedimentary 231 Pa/ 230 Th proxy has been developed and improved but also contested due to its sensitivity to other factors beyond ocean circulation. In order to provide a better basis for the understanding of the Atlantic 231 Pa/ 230 Th system, and therefore to shed light on the controversy, we compare new measurements of Holocene sediments from the north Brazilian margin to water column data and the output of a two-dimensional scavenging-circulation model, based on modern circulation patterns and reversible scavenging parameters. We show that sedimentary 231 Pa/ 230 Th data from one specific area of the Atlantic are in very good agreement with model results suggesting that sedimentary 231 Pa/ 230 Th is predominantly driven by the AMOC. Therefore, 231 Pa/ 230 Th represents an appropriate method to reconstruct past AMOC at least qualitatively along the western margin. (authors)

  17. Naturally acquired antibody responses to recombinant Pfs230 and Pfs48/45 transmission blocking vaccine candidates

    DEFF Research Database (Denmark)

    Jones, Sophie; Grignard, Lynn; Nebie, Issa

    2015-01-01

    for the future evaluation of vaccine immunogenicity and efficacy in populations naturally exposed to malaria. METHODS: We determined naturally acquired antibody responses to the recombinant proteins Pfs48/45-10C and Pfs230-230CMB in children from three malaria endemic settings in Ghana, Tanzania and Burkina Faso......OBJECTIVES: Pfs48/45 and Pfs230 are Plasmodium falciparum sexual stage proteins and promising malaria transmission-blocking vaccine candidates. Antibody responses against these proteins may be naturally acquired and target antigens may be under selective pressure. This has consequences....... CONCLUSIONS: We conclude there are naturally acquired antibody responses to both vaccine candidates which have functional relevance by reducing the transmissibility of infected individuals. We identified genetic polymorphisms, in pfs48/45 which exhibited geographical specificity....

  18. Accretion rate in mangroves sediment at Sungai Miang, Pahang, Malaysia: 230Thexcess versus artificial horizon marker method

    International Nuclear Information System (INIS)

    Kamaruzzaman Yunus; Jamil Tajam; Hasrizal Shaari; Noor Azhar Mohd Shazili; Misbahul Mohd Amin

    2008-01-01

    Mangroves have enormous ecological value and one of their important role is to act as an efficient sediment trappers which dominantly supplied by rivers and the atmosphere to the oceans. Applying the 230 Th excess method, an average accretion rate of 0.54 cm yr -1 was obtained. this is comparable to that of an artificial horizon marker method giving an average of 0.54 cm yr -1 . The 230 Th excess method provides a rapid and simple method of evaluating 230 Th excess accumulation histories in sediment cores. Sample preparation is also significantly simplified, thus providing a relatively quick and easy method for the determination of the accretion rate in mangrove area. (author)

  19. HCV-specific immune responses induced by CIGB-230 in combination with IFN-α plus ribavirin

    Science.gov (United States)

    Amador-Cañizares, Yalena; Martínez-Donato, Gillian; Álvarez-Lajonchere, Liz; Vasallo, Claudia; Dausá, Mariacarla; Aguilar-Noriega, Daylen; Valenzuela, Carmen; Raíces, Ivette; Dubuisson, Jean; Wychowski, Czeslaw; Cinza-Estévez, Zurina; Castellanos, Marlén; Núñez, Magdalys; Armas, Anny; González, Yaimé; Revé, Ismariley; Guerra, Ivis; Pérez Aguiar, Ángel; Dueñas-Carrera, Santiago

    2014-01-01

    AIM: To analyze hepatitis C virus (HCV)-specific immune responses in chronically infected patients under triple therapy with interferon-α (IFN-α) plus ribavirin and CIGB-230. METHODS: CIGB-230 was administered in different schedules with respect to IFN-α plus ribavirin therapy. Paired serum and peripheral blood mononuclear cells (PBMC) samples from baseline and end of treatment were analyzed. The HCV-specific humoral response was tested by enzyme-linked immunosorbent assay, neutralizing antibodies were evaluated by cell culture HCV neutralization assays, PBMC proliferation was assayed by carboxyfluorescein succinimidyl ester staining and IFN-γ secretion was assessed by enzyme-linked immunospot. Data on virological and histological response and their association with immune variables are also provided. RESULTS: From week 12 to week 48, all groups of patients showed a significant reduction in mean leukocyte counts. Statistically significant reductions in antibody titers were frequent, but only individuals immunized with CIGB-230 as early add-on treatment sustained the core-IgG response, and the neutralizing antibody response was enhanced only in patients receiving CIGB-230. Cell-mediated immune responses also tended to decline, but significant reductions in IFN-γ secretion and total absence of core-specific lymphoproliferation were exclusive of the control group. Only CIGB-230-immunized individuals showed de novo induced lymphoproliferative responses against the structural antigens. Importantly, it was demonstrated that the quality of the CIGB-230-induced immune response depended on the number of doses and timing of administration in relation to the antiviral therapy. Specifically, the administration of 6 doses of CIGB-230 as late add-on to therapy increased the neutralizing antibody activity and the de novo core-specific IFN-γ secretion, both of which were associated with the sustained virological response. CONCLUSION: CIGB-230, combined with IFN

  20. Effects of age, sex, and disorder on voice range profile characteristics of 230 children.

    Science.gov (United States)

    Wuyts, Floris L; Heylen, Louis; Mertens, Fons; Du Caju, Marc; Rooman, Raoul; Van de Heyning, Paul H; De Bodt, Marc

    2003-06-01

    In this study, the effect of age, sex, and disorder on the vocal performance of 230 children 6 to 11 years of age was investigated by means of the voice range profile (VRP). Ninety-four control children and 136 children with disorders were studied. The VRPs were quantitatively described by frequency and intensity characteristics, as well as by morphological characteristics. Significant differences between healthy children and children with disorders were found. Age has a different effect in girls than in boys regarding vocal performance. Most of the characteristics for the healthy girls change gradually over the period from 6 to 11 years. For the healthy boys, however, two age groups can be identified: one below and one above 8 years of age. It is hypothesized that the androgen dehydroepiandrosterone (DHEA) and its sulfate may play a role in this phenomenon.

  1. Recovery of protactinium-231 and thorium-230 from cotter concentrate: pilot plant operatins and process development

    International Nuclear Information System (INIS)

    Hertz, M.R.; Figgins, P.E.; Deal, W.R.

    1983-01-01

    The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 100 0 C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables

  2. Antimicrobial susceptibility testing of 230 Helicobacter pylori strains: importance of medium, inoculum, and incubation time

    DEFF Research Database (Denmark)

    Hartzen, S H; Andersen, L P; Bremmelgaard, A

    1997-01-01

    with those of others, and apart from metronidazole, the MIC of which for approximately 25% of the strains tested was >8 microg/ml, resistance was low in Denmark. The situation might, however, quickly change when and if the number of indications for antibiotic therapy for H. pylori infections increase....... Consequently, susceptibility testing of all H. pylori strains is recommended in order to survey the development of resistance, and in our hands the described methodology was relatively easy to perform and the results were easy to read.......No standardized method of susceptibility testing for Helicobacter pylori is currently available, so before a large agar dilution study comprising 230 H. pylori strains belonging to more than 80 genetically different groups was initiated, we performed a relatively small preliminary study...

  3. Dynamic effects in neutron induced fission of 230Th and 232Th

    International Nuclear Information System (INIS)

    Trochon, J.; Frehaut, J.; Pranal, Y.; Simon, G.; Boldeman, J.W.

    1982-09-01

    The fission fragment characteristics of the two thorium isotopes 230 Th and 232 Th have been measured in an attempt to study the evolution of the fissioning nucleus from saddle point to scission. The partial fission channel at the saddle point have been deduced from a fission fragment angular distribution and fission cross section analysis. Changes with energy in the average number of prompt neutron (νsub(p)) emitted per fission and the total fragment kinetic energy (TKE) have been observed in the fission threshold region. A rather good fit of νsub(p) and TKE values has been obtained on the basis of a correlation of these quantities and the partial fission channel ratios. This leads to expect for these isotopes a passage from saddle point to scission sufficiently rapid for the coupling between collective and intrinsic excitation to be very weak [fr

  4. 42 CFR 435.230 - Aged, blind, and disabled individuals in States that use more restrictive requirements for...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Aged, blind, and disabled individuals in States... Coverage of the Aged, Blind, and Disabled § 435.230 Aged, blind, and disabled individuals in States that... for aged, blind, and disabled SSI recipients using more restrictive requirements than those used under...

  5. 77 FR 56809 - Foreign-Trade Zone 230-Piedmont Triad Area, North Carolina; Notification of Proposed Production...

    Science.gov (United States)

    2012-09-14

    ... Proposed Production Activity, Sonoco Corrflex (Kitting--Gift Sets), Rural Hall and Winston-Salem, NC The Piedmont Triad Partnership, grantee of FTZ 230, submitted a notification of proposed production activity on..., and in the ``Reading Room'' section of the Board's Web site, which is accessible via www.trade.gov/ftz...

  6. 75 FR 71540 - Airworthiness Directives; Bell Helicopter Textron Canada Model 222, 222B, 222U, 230, and 430...

    Science.gov (United States)

    2010-11-24

    ... Textron Canada Model 222, 222B, 222U, 230, and 430 Helicopters AGENCY: Federal Aviation Administration... known U.S. owners and operators of the specified model Bell Helicopter Textron Canada (Bell) helicopters... Federal holidays. You may get the service information identified in this AD from Bell Helicopter Textron...

  7. 17 CFR 230.160 - Registered investment company exemption from Section 101(c)(1) of the Electronic Signatures in...

    Science.gov (United States)

    2010-04-01

    ... exemption from Section 101(c)(1) of the Electronic Signatures in Global and National Commerce Act. 230.160...(c)(1) of the Electronic Signatures in Global and National Commerce Act. A prospectus for an... 101(c)(1) of the Electronic Signatures in Global and National Commerce Act. [65 FR 47284, Aug. 2, 2000] ...

  8. 75 FR 9573 - Minnkota Power Cooperative, Inc: Bemidji-Grand Rapids 230kV Transmission Project

    Science.gov (United States)

    2010-03-03

    ... construction of a 230 kilovolt (kV) kV transmission line between the Wilton Substation near Bemidji, Minnesota, and the Boswell Substation near Grand Rapids, Minnesota in Beltrami, Hubbard, Itasca, and Cass... proposing to modify the existing Wilton and Boswell substations, construct a new 115 kV breaker station at...

  9. 39 CFR 230.15 - What must an Office of Inspector General employee do if served with a demand requiring the...

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false What must an Office of Inspector General employee do if served with a demand requiring the production of documents or an appearance in court? 230.15 Section 230.15 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF...

  10. 39 CFR 230.12 - Can Office of Inspector General employees testify or produce documents that would assist me in my...

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Can Office of Inspector General employees testify or produce documents that would assist me in my civil proceeding? 230.12 Section 230.12 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL Rules...

  11. Extended Neutral Hydrogen in the Aligned Shell Galaxies Arp 230 and MCG -5-7-1 : Formation of Disks in Merging Galaxies?

    NARCIS (Netherlands)

    Schiminovich, David; van Gorkom, J. H.; van der Hulst, J. M.

    As part of an ongoing study of the neutral hydrogen (H I) morphology and kinematics of "shell" elliptical galaxies, we present Very Large Array observations of two shell galaxies with aligned shells, Arp 230 and MCG -5-7-1. Our data provide the first Hi images of Arp 230 and deeper images of MCG

  12. 5 CFR 792.230 - May an agency use appropriated funds to improve the physical space of the family child care homes...

    Science.gov (United States)

    2010-01-01

    ... improve the physical space of the family child care homes or child care centers? 792.230 Section 792.230... child care centers? An agency may not use appropriated funds under this program to improve the physical space of child care centers and family child care homes. ...

  13. The recombinant pea defensin Drr230a is active against impacting soybean and cotton pathogenic fungi from the genera Fusarium, Colletotrichum and Phakopsora.

    Science.gov (United States)

    Lacerda, Ariane Ferreira; Del Sarto, Rafael Perseghini; Silva, Marilia Santos; de Vasconcelos, Erico Augusto Rosas; Coelho, Roberta Ramos; Dos Santos, Vanessa Olinto; Godoy, Claudia Vieira; Seixas, Claudine Dinali Santos; da Silva, Maria Cristina Mattar; Grossi-de-Sa, Maria Fatima

    2016-06-01

    Plant defensins are antifungal peptides produced by the innate immune system plants developed to circumvent fungal infection. The defensin Drr230a, originally isolated from pea, has been previously shown to be active against various entomopathogenic and phytopathogenic fungi. In the present study, the activity of a yeast-expressed recombinant Drr230a protein (rDrr230a) was tested against impacting soybean and cotton fungi. First, the gene was subcloned into the yeast expression vector pPICZαA and expressed in Pichia pastoris. Resulting rDrr230a exhibited in vitro activity against fungal growth and spore germination of Fusarium tucumaniae, which causes soybean sudden death syndrome, and against Colletotrichum gossypii var. cephalosporioides, which causes cotton ramulosis. The rDrr230a IC 50 corresponding to inhibition of fungal growth of F. tucumaniae and C. gossypii var. cephalosporioides was 7.67 and 0.84 µM, respectively, demonstrating moderate activity against F. tucumaniae and high potency against C. gossypii var. cephalosporioides. Additionally, rDrr230a at 25 ng/µl (3.83 µM) resulted in 100 % inhibition of spore germination of both fungi, demonstrating that rDrr230a affects fungal development since spore germination. Moreover, rDrr230a at 3 µg/µl (460.12 µM) inhibited 100 % of in vitro spore germination of the obligatory biotrophic fungus Phakopsora pachyrhizi, which causes Asian soybean rust. Interestingly, rDrr230a substantially decreased the severity of Asian rust, as demonstrated by in planta assay. To our knowledge, this is the first report of a plant defensin active against an obligatory biotrophic phytopathogenic fungus. Results revealed the potential of rDrr230a as a candidate to be used in plant genetic engineering to control relevant cotton and soybean fungal diseases.

  14. 230Th-234U Age-Dating Uranium by Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Williams, R W; Gaffney, A M

    2012-04-18

    This is the standard operating procedure used by the Isotope Ratio Mass Spectrometry Group of the Chemical Sciences Division at LLNL for the preparation of a sample of uranium oxide or uranium metal for {sup 230}Th-{sup 234}U age-dating. The method described here includes the dissolution of a sample of uranium oxide or uranium metal, preparation of a secondary dilution, spiking of separate aliquots for uranium and thorium isotope dilution measurements, and purification of uranium and thorium aliquots for mass spectrometry. This SOP may be applied to uranium samples of unknown purity as in a nuclear forensic investigation, and also to well-characterized samples such as, for example, U{sub 3}O{sub 8} and U-metal certified reference materials. The sample of uranium is transferred to a quartz or PFA vial, concentrated nitric acid is added and the sample is heated on a hotplate at approximately 100 C for several hours until it dissolves. The sample solution is diluted with water to make the solution approximately 4 M HNO{sub 3} and hydrofluoric acid is added to make it 0.05 M HF. A secondary dilution of the primary uranium solution is prepared. Separate aliquots for uranium and thorium isotope dilution measurements are taken and spiked with {sup 233}U and {sup 229}Th, respectively. The spiked aliquot for uranium isotope dilution analysis is purified using EiChrom UTEVA resin. The spiked aliquot for thorium isotope dilution analysis is purified by, first, a 1.8 mL AG1x8 resin bed in 9 M HCl on which U adsorbs and Th passes through; second, adsorbing Th on a 1 mL AG1x8 resin bed in 8 M HNO{sub 3} and then eluting it with 9 M HCl followed by 0.1 M HCl + 0.005 M HF; and third, by passing the Th through a final 1.0 mL AG1x8 resin bed in 9 M HCl. The mass spectrometry is performed using the procedure 'Th and U Mass Spectrometry for {sup 230}Th-{sup 234}U Age Dating'.

  15. Temperature correlations between the eastern equatorial Pacific and Antarctica over the past 230,000 years

    Science.gov (United States)

    Koutavas, Athanasios

    2018-03-01

    Tropical sea surface temperatures (SSTs) warmed and cooled in step with the Pleistocene ice age cycles, but the mechanisms are not known. It is assumed that the answer must involve radiative forcing by CO2 but SST reconstructions have been too sparse for a conclusive test. Here I present a 230,000-yr tropical SST stack from the eastern equatorial Pacific (EEP) using two new Mg/Ca reconstructions combined with three earlier ones. The EEP stack shows persistent covariation with Antarctic temperature on orbital and millennial timescales indicating tight coupling between the two regions. This coupling however cannot be explained solely by CO2 forcing because in at least one important case, the Marine Isotope Stage (MIS) 5e-5d glacial inception, both regions cooled ∼5-6.5 thousand years before CO2 decreased. More likely, their covariation was due to advection of Antarctic climate signals to the EEP by the ocean. To explain the MIS 5e-5d event and glacial inception in general the hypothesis is advanced that the cooling signal spreads globally from the Northern Hemisphere with an active ocean circulation - first from the North Atlantic to the Southern Ocean with a colder North Atlantic Deep Water, and then to the Indian and Pacific Oceans with cooler Antarctic deep and intermediate waters.

  16. Trimming algorithm of frequency modulation for CIAE-230 MeV proton superconducting synchrocyclotron model cavity

    Science.gov (United States)

    Li, Pengzhan; Zhang, Tianjue; Ji, Bin; Hou, Shigang; Guo, Juanjuan; Yin, Meng; Xing, Jiansheng; Lv, Yinlong; Guan, Fengping; Lin, Jun

    2017-01-01

    A new project, the 230 MeV proton superconducting synchrocyclotron for cancer therapy, was proposed at CIAE in 2013. A model cavity is designed to verify the frequency modulation trimming algorithm featuring a half-wave structure and eight sets of rotating blades for 1 kHz frequency modulation. Based on the electromagnetic (EM) field distribution analysis of the model cavity, the variable capacitor works as a function of time and the frequency can be written in Maclaurin series. Curve fitting is applied for theoretical frequency and original simulation frequency. The second-order fitting excels at the approximation given its minimum variance. Constant equivalent inductance is considered as an important condition in the calculation. The equivalent parameters of theoretical frequency can be achieved through this conversion. Then the trimming formula for rotor blade outer radius is found by discretization in time domain. Simulation verification has been performed and the results show that the calculation radius with minus 0.012 m yields an acceptable result. The trimming amendment in the time range of 0.328-0.4 ms helps to reduce the frequency error to 0.69% in Simulation C with an increment of 0.075 mm/0.001 ms, which is half of the error in Simulation A (constant radius in 0.328-0.4 ms). The verification confirms the feasibility of the trimming algorithm for synchrocyclotron frequency modulation.

  17. Development of the in-structure response spectra of the VVER-440 Model 230 Kozloduy Plant

    International Nuclear Information System (INIS)

    Kostov, M.K.; Prato, C.A.; Stevenson, J.D.

    1993-01-01

    The Kozloduy NPP is located in the North-West part of Bulgaria on the Danube river. The plant consists of four units of 440 MW and two units of 1,000 MW. In the last 15 years there have been three strong, intermediate depth earthquakes in the Vrancea seismic zone (1977, 1986, 1990) which have affected the NPP site. The Vrancea zone is located approximately 300 km northeast of the plant. It is known for the generation of strong, long-period seismic motions. In 1990 an intensive work program for qualification of the plant according to the international standards (IAEA 1991; IAEA 1992) was initiated. The work started by a project for site confirmation. As a result, new design seismic characteristics were obtained. A Review Level Earthquake is defined by a maximum acceleration of 0.2 g; a response spectrum is shown. The generation of the in-structure response spectra for units 1 and 2 VVER-440 Model 230 is presented in this paper. The coauthors belong to an IAEA Advisory Team assisting the seismic upgrading project of the Kozloduy plant

  18. Phase II trial of SOM230 (pasireotide LAR) in patients with unresectable hepatocellular carcinoma.

    Science.gov (United States)

    Feun, Lynn G; Wangpaichitr, Medhi; Li, Ying-Ying; Kwon, Deukwoo; Richman, Stephen P; Hosein, Peter J; Savaraj, Niramol

    2018-01-01

    A phase II trial of pasireotide was performed to assess its efficacy and safety in advanced or metastatic hepatocellular carcinoma (HCC). Patients with advanced HCC and Child-Pugh score ≤7 received pasireotide LAR 60 mg intramuscularly every 28 days. Primary endpoint was disease control rate. Secondary endpoints were time to tumor progression, response rate, treatment-related adverse events, and overall survival. Serum insulin growth factor-1 was measured before and after pasireotide. Twenty patients were treated and evaluable. Eighteen patients (90%) had prior therapy; 16 patients (80%) had multiple therapies. Median age was 65, 75% had Barcelona Clinic Liver Cancer stage C, and 55% had metastatic disease. The main toxicity was hyperglycemia. Rare adverse effects included reversible grade 4 elevation in alanina transaminase/aspartate transaminase in one patient. The best response was stable disease in 9 patients (45%). Median time to tumor progression for the 20 patients was 3 months, and median survival was 9 months. Pasireotide had limited clinical benefit as second-line or third-line treatment in patients with advanced or metastatic HCC. Low baseline insulin growth factor-1 level may be indicative when SOM230 treatment may be ineffective, and decreasing levels after treatment may be indicative of disease control.

  19. Childhood systemic lupus erythematosus in Latin America. The GLADEL experience in 230 children.

    Science.gov (United States)

    Ramírez Gómez, L A; Uribe Uribe, O; Osio Uribe, O; Grisales Romero, H; Cardiel, M H; Wojdyla, D; Pons-Estel, B A; Catoggio, Luis J; Soriano, Enrique R; Imamura, Patricia M; Manni, Jorge A; Grimaudo, Sebastián; Sarano, Judith; Maldonado-Cocco, José A; Arriola, Maria S; Gómez, Graciela; García, Mercedes A; Marcos, Ana Inés; Marcos, Juan Carlos; Scherbarth, Hugo R; Marino, Pilar C; Motta, Estela L; Drenkard, Cristina; Gamron, Susana; Buliubasich, Sandra; Onetti, Carlos M; Caeiro, Francisco; Alvarellos, Alejandro; Saurit, Verónica; Gentiletti, Silvana; Quagliatto, Norberto; Gentiletti, Alberto A; Machado, Daniel; Abdala, Marcelo; Palatnik, Simón; Berbotto, Guillermo A; Battagliotti, Carlos A; Sato, Emilia; Sella, Elaine M C; Souza, AlexandreW S; Costallat, Lilian T Lavras; Bertolo, Manoel Barros; Coimbra, Ibsen Bellini; Borba Neto, Eduardo Ferreira; Bonfá, Eloisa; Tavares, João Carlos; Brenol; Xavier, Ricardo; Mucenic, Tamara; Cavalcanti, Fernando de Souza; Duarte, Angela Luzia Branco; Marques, Cláudia Diniz Lopes; Da Silva, Nilzio Antonio; de O e Silva, Ana Carolina; Pacheco, Tatiana Ferracine; Molina-Restrepo, José Fernando; Molina-López, Javier; Iglesias-Gamarra, Antonio; Iglesias-Rodríguez, Antonio; Egea-Bermejo, Eduardo; Guzmán-Moreno, Renato A; Restrepo-Suárez, José F; Guibert-Toledano, Marlene; Reyes-Llerena, Gil Alberto; Massardo, Loreto; Gareca, Néstor; Jacobelli, Sergio; Neira, Oscar J; Guzmán, Leonardo R; Garcia-Kutzbach, Abraham; Castellanos, Claudia; Cajas, Erwin; Pascual-Ramos, Virginia; Barile-Fabris, Leonor A; Miranda-Limón, Juan Manuel; Amigo, Mary-Carmen; Silveira, Luis H; De La Torre, Ignacio García; Orozco-Barocio, Gerardo; Estrada-Contreras, Magali L; del Pozo, Maria Josefina Sauza; Aranda Baca, Laura E; Quezada, Adelfia Urenda; Huerta-Yáñez, Guillermo F; Acevedo-Vásquez, Eduardo M; Alfaro-Lozano, José Luis; Cucho-Venegas, Jorge M; Segami, Maria Inés; Chung, Cecilia P; Alva-Linares, Magaly; Abadi, Isaac; Chacón-Díaz, Rosa; Al Snih Al Snih, Soham; Esteva-Spinetti, Maria H; Vivas, Jorge

    2008-06-01

    To evaluate disease characteristics of childhood onset SLE in Latin America and to compare this information with an adult population in the same cohort of GLADEL. A protocol was designed as a multicenter, multinational, inception cohort of lupus patients to evaluate demographic, clinical, laboratory and serological variables, as well as classification criteria, disease activity, organ damage and mortality. Descriptive statistics, chi square, Fisher's exact test, Student's t test and multiple logistic regression were used to compare childhood and adult onset SLE. 230 patients were oral ulcers, thrombocytopenia and hemolytic anemia and some neurologic manifestations were more prevalent in children (p<0.05). On the other hand, myalgias, Sjögren's syndrome and cranial nerve involvement were more frequently seen in adults (p<0.05). Afro-Latin-American children had a higher prevalence of fever, thrombocytopenia and hemolytic anemia. White and mestizo children had a higher prevalence of malar rash. Mestizo children had a higher prevalence of cerebrovascular disease and cranial nerve involvement. Children met SLE ACR criteria earlier with higher mean values than adults (p: 0.001). They also had higher disease activity scores (p: 0.01), whereas adults had greater disease damage (p: 0.02). In Latin America, childhood onset SLE seems to be a more severe disease than adults. Some differences can be detected among ethnic groups.

  20. Ocorrência de micoses e pitiose em animais domésticos: 230 casos

    Directory of Open Access Journals (Sweden)

    Glauco J.N. Galiza

    2014-03-01

    Full Text Available Para determinar as principais micoses e oomicoses que acometeram animais domésticos na área de abrangência do Laboratório de Patologia Veterinária (LPV da Universidade Federal de Santa Maria (UFSM, foi realizado um estudo retrospectivo em 9.487 protocolos de necropsias e 20.199 exames histopatológicos (totalizando 29.686 casos, realizados no LPV-UFSM, entre janeiro de 1990 e dezembro de 2012. Do total de protocolos analisados, 230 apresentaram micoses ou pitiose (oomicose, sendo 179 casos (78% de micoses e 51 casos (22% de pitiose. Os protocolos foram revisados para determinar os principais achados referentes à epidemiologia, sinais clínicos e às alterações macroscópicas e microscópicas. Em dois casos (0,8% não foi possível determinar o gênero ou o grupo do fungo observado. As principais doenças diagnosticadas, em ordem decrescente de prevalência, foram: pitiose, candidíase, aspergilose, zigomicose, dermatofitose, malasseziose, criptococose, megabacteriose e esporotricose. Outras doenças diagnosticadas numa única ocorrência cada foram histoplasmose e pneumocistose. Os equinos foram os mais acometidos pela pitiose e os animais de companhia (cães e gatos foram os mais acometidos pelas micoses.

  1. Seismic assessment of Kozloduy WWER-440, model 230 nuclear power plant

    International Nuclear Information System (INIS)

    Monette, P.; Baltus, R.; Yanev, P.; Campbell, R.

    1993-01-01

    A preliminary report is given of the findings of an IAEA sponsored walkdown of the WWER-440, model 230 at Kozloduy, in May 1991. The scope of the IAEA mission was to determine the lower bound seismic capacity of the plant and to make recommendations for improvements to increase the earthquake resistance. The methodology utilized in the assessment is that used for evaluation of the seismic margin in U.S. nuclear power plants subjected to earthquakes beyond their design basis. Included in the assessment is the establishment of a safe shutdown path which would include the capacity to mitigate a small break in the primary system, performance of a walkdown of the safe shutdown path and calculation of the high-confidence-of-low-probability-of-failure (HCLPF) of the safe shutdown path. Excluding system design deficiency relative to U.S. and Western Europe standards, it was found that the plant has many seismic vulnerabilities similar to those that existed in many of the U.S. plants prior to about 1979 when the Systematic Evaluation Program was initiated. (Z.S.) 1 tab., 1 fig

  2. Statement about researches relative to the operation stability of the MPS P230 of Ariane 5; Point sur les recherches relatives a la stabilite de fonctionnement du MPS P230 d'Ariane 5

    Energy Technology Data Exchange (ETDEWEB)

    Vuillot, F.

    1998-07-01

    This paper makes a statement about the researches carried out in the framework of the ASSM (Aerodynamics of Segmented Solid Motors) research program on the operation stability of the MPS P230 solid propellant engine of the French Ariane 5 launcher. After a brief historical recall of the works performed on this topic during the last 10 years, the present day situation is detailed. The feasibility of a numerical capture of the instability phenomenon is now achieved and 3 scenarios leading to swirl flow instabilities could be identified. These scenarios were validated using numerical simulation, simulation in cold gases, and launcher tests. However, one scenario based on a strong instability mechanism, seems to better fit with the observations made on the P230 engine and will deeply influence the scientific strategy of the research program. (J.S.)

  3. Optimum design of a self-supported power transmission tower type 2M2 for 230 kW; Diseno optimo de una torre de transmision autosoportada tipo 2M2, para 230 kW

    Energy Technology Data Exchange (ETDEWEB)

    Espejel Valdez, Eduardo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Millan Monje, Alejandro; Honk Hernandez, Wenceslao [Comision Federal de Electricidad, (CFE), Mexico, D. F. (Mexico)

    1985-12-31

    A group of specialists from the Comision Federal de Electricidad (CFE) and of the Instituto de Investigaciones Electricas (IIE) analyzes the design of various types of power transmission towers in their application stage, in order to enhance them. In this article the structural characteristics of the self-supported tower type 2M2 for 230 kV of two circuits and of suspension, are presented. [Espanol] Un grupo de especialistas de la Comision Federal de Electricidad (CFE) y del Instituto de Investigaciones Electricas (IIE) analiza el diseno de diversos tipos de torres de transmision en su etapa de aplicacion, con el fin de mejorarlos. En este articulo se presentan las caracteristicas estructurales de la torre autosoportada tipo 2M2 para 230 kV, de dos circuitos y de suspension.

  4. Determination of 228Th, 230Th, and 232Th in environmental samples from uranium mining and milling operations

    International Nuclear Information System (INIS)

    Durham, R.W.; Joshi, S.R.

    1979-01-01

    A method is described for the determination of 228 Th, 230 Th, and 232 Th in environmental samples from uranium mining and milling operations. The analytical procedure is based on the direct determination of 228 Th in the sample by high resolution γ-spectrometry followed by extraction and purification of the thorium fraction using high molecular weight amines and an anion-exchange technique, respectively, prior to α-spectrometry to determine isotopic ratios. The lowest level of detection for each thorium isotope is 0.01 pCi/g for solid samples and 20 pCi/l for aqueous samples. Replicate analyses of a typical mine waste stream gave a standard deviation of +-3% for 228 Th. Standard deviations of the 230 Th and 232 Th increased to +-11% apparently due to traces of 210 Po interfering in the α-spectrometry. (author)

  5. Excitation Potentials and Shell Corrections for the Elements Z2=20 to Z2=30

    DEFF Research Database (Denmark)

    Andersen, H.H.; Sørensen, H.; Vadja, P.

    1969-01-01

    Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas-Fe...... are found by means of Bonderup's shell corrections. Within the Z2 interval treated here, it is found that I/Z2 increases with increasing Z2, contrary to the general trend through the periodic system of elements......Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas...

  6. 238U-230Th dating of chevkinite in high-silica rhyolites from La Primavera and Yellowstone calderas

    Science.gov (United States)

    Vazquez, Jorge A.; Velasco, Noel O.; Schmitt, Axel K.; Bleick, Heather A.; Stelten, Mark E.

    2014-01-01

    Application of 238U-230Th disequilibrium dating of accessory minerals with contrasting stabilities and compositions can provide a unique perspective on magmatic evolution by placing the thermochemical evolution of magma within the framework of absolute time. Chevkinite, a Th-rich accessory mineral that occurs in peralkaline and metaluminous rhyolites, may be particularly useful as a chronometer of crystallization and differentiation because its composition may reflect the chemical changes of its host melt. Ion microprobe 128U-230Th dating of single chevkinite microphenocrysts from pre- and post-caldera La Primavera, Mexico, rhyolites yields model crystallization ages that are within 10's of k.y. of their corresponding K-Ar ages of ca. 125 ka to 85 ka, while chevkinite microphenocrysts from a post-caldera Yellowstone, USA, rhyolite yield a range of ages from ca. 110 ka to 250 ka, which is indistinguishable from the age distribution of coexisting zircon. Internal chevkinite-zircon isochrons from La Primavera yield Pleistocene ages with ~5% precision due to the nearly two order difference in Th/U between both minerals. Coupling chevkinite 238U-230Th ages and compositional analyses reveals a secular trend of Th/U and rare earth elements recorded in Yellowstone rhyolite, likely reflecting progressive compositional evolution of host magma. The relatively short timescale between chevkinite-zircon crystallization and eruption suggests that crystal-poor rhyolites at La Primavera were erupted shortly after differentiation and/or reheating. These results indicate that 238U-230Th dating of chevkinite via ion microprobe analysis may be used to date crystallization and chemical evolution of silicic magmas.

  7. 230Th, 232Th and 238U determinations in phosphoric acid fertilizer and process products by ICP-MS

    International Nuclear Information System (INIS)

    Nascimento, Marcos R.L. do; Guerreiro, Luisa M.R.; Bonifacio, Rodrigo L.; Taddei, Maria H.T.

    2015-01-01

    Through processing of Santa Quiteria-CE mine phosphate rock, Brazil has established a project for production of phosphoric acid fertilizer and uranium as a by-product. Under leaching conditions of phosphate rock with sulfuric acid, which is the common route for preparing phosphoric acid fertilizer, a large part of uranium, thorium and their decay products naturally present in the rock are solubilized. In order to assess the contamination potential in phosphoric acid and others process products, this paper describes a previous precipitation and direct methods for routine analysis of thorium and uranium isotopes by ICP-MS. In all samples, 230 Th, 232 Th and 238 U were directly determined after dilution, except 230 Th in phosphoric acid loaded with uranium sample, which to overcome equipment contamination effect, was determined after its separation by oxalate precipitation using lanthanum as a carrier. The results obtained by the proposed method by ICP-MS, were in good agreement when compared to alpha spectrometry for 230 Th, and ICP-OES and spectrophotometry with arsenazo III for elementary uranium and thorium determinations. (author)

  8. Experimental and modeling results of creep fatigue life of Inconel 617 and Haynes 230 at 850 C

    International Nuclear Information System (INIS)

    Chen, Xiang; Sokolov, Mikhail A.; Sham, Sam; Erdman, Donald L. III; Busby, Jeremy T.; Mo, Kun; Stubbins, James

    2013-01-01

    Creep fatigue testing of Ni-based superalloy Inconel 617 and Haynes 230 were conducted in the air at 850 C. Tests were performed with fully reversed axial strain control at a total strain range of 0.5%, 1.0% or 1.5% and hold time at maximum tensile strain for 3, 10 or 30 min. In addition, two creep fatigue life prediction methods, i.e. linear damage summation and frequency-modified tensile hysteresis energy modeling, were evaluated and compared with experimental results. Under all creep fatigue tests, Haynes 230 performed better than Inconel 617. Compared to the low cycle fatigue life, the cycles to failure for both materials decreased under creep fatigue test conditions. Longer hold time at maximum tensile strain would cause a further reduction in both material creep fatigue life. The linear damage summation could predict the creep fatigue life of Inconel 617 for limited test conditions, but considerably underestimated the creep fatigue life of Haynes 230. In contrast, frequency-modified tensile hysteresis energy modeling showed promising creep fatigue life prediction results for both materials.

  9. Phase II trial of SOM230 (pasireotide LAR in patients with unresectable hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Feun LG

    2018-01-01

    Full Text Available Lynn G Feun,¹ Medhi Wangpaichitr,² Ying-Ying Li,¹ Deukwoo Kwon,³ Stephen P Richman,¹ Peter J Hosein,¹ Niramol Savaraj¹,² ¹Department of Medicine, Medical Oncology, Sylvester Comprehensive Cancer Center, University of Miami, ²Department of Surgery, Miami VA Healthcare System, Research Service, ³Biostatistics and Bioinformatics Core, Sylvester Comprehensive Cancer Center, University of Miami, Miami, FL, USA Background: A phase II trial of pasireotide was performed to assess its efficacy and safety in advanced or metastatic hepatocellular carcinoma (HCC.Patients and methods: Patients with advanced HCC and Child–Pugh score ≤7 received pasireotide LAR 60 mg intramuscularly every 28 days. Primary endpoint was disease control rate. Secondary endpoints were time to tumor progression, response rate, treatment-related adverse events, and overall survival. Serum insulin growth factor-1 was measured before and after pasireotide.Results: Twenty patients were treated and evaluable. Eighteen patients (90% had prior therapy; 16 patients (80% had multiple therapies. Median age was 65, 75% had Barcelona Clinic Liver Cancer stage C, and 55% had metastatic disease. The main toxicity was hyperglycemia. Rare adverse effects included reversible grade 4 elevation in alanina transaminase/aspartate transaminase in one patient. The best response was stable disease in 9 patients (45%. Median time to tumor progression for the 20 patients was 3 months, and median survival was 9 months.Conclusion: Pasireotide had limited clinical benefit as second-line or third-line treatment in patients with advanced or metastatic HCC. Low baseline insulin growth factor-1 level may be indicative when SOM230 treatment may be ineffective, and decreasing levels after treatment may be indicative of disease control. Keywords: pasireotide, hepatocellular carcinoma, insulin growth factor-1 

  10. 206Pb-230Th-234U-238U and 207Pb-235U geochronology of Quaternary opal, Yucca Mountain, Nevada

    Science.gov (United States)

    Neymark, Leonid A.; Amelin, Yuri V.; Paces, James B.

    2000-01-01

    U–Th–Pb isotopic systems have been studied in submillimeter-thick outermost layers of Quaternary opal occurring in calcite–silica fracture and cavity coatings within Tertiary tuffs at Yucca Mountain, Nevada, USA. These coatings preserve a record of paleohydrologic conditions at this site, which is being evaluated as a potential high-level nuclear waste repository. The opal precipitated from groundwater is variably enriched in 234U (measured 234U/238U activity ratio 1.124–6.179) and has high U (30–313 ppm), low Th (0.008–3.7 ppm), and low common Pb concentrations (measured 206Pb/204Pb up to 11,370). It has been demonstrated that the laboratory acid treatment used in this study to clean sample surfaces and to remove adherent calcite, did not disturb U–Th–Pb isotopic systems in opal. The opal ages calculated from 206Pb∗/238U and 207Pb∗/235U ratios display strong reverse discordance because of excess radiogenic 206Pb∗ derived from the elevated initial 234U. The data are best interpreted using projections of a new four-dimensional concordia diagram defined by 206Pb∗/238U, 207Pb∗/235U, 234U/238Uactivity, and 230Th/238Uactivity. Ages and initial 234U/238U activity ratios have been calculated using different projections of this diagram and tested for concordance. The data are discordant, that is observed 207Pb∗/235U ages of 170 ± 32 (2σ) to 1772 ± 40 ka are systematically older than 230Th/U ages of 34.1 ± 0.6 to 452 ± 32 ka. The age discordance is not a result of migration of uranium and its decay products under the open system conditions, but a consequence of noninstantaneous growth of opal. Combined U–Pb and 230Th/U ages support the model of slow mineral deposition at the rates of millimeters per million years resulting in layering on a scale too fine for mechanical sampling. In this case, U–Pb ages provide more accurate estimates of the average age for mixed multiage samples than 230Th/U ages, because ages based on shorter

  11. DC-Motor Drive Encompassing SiGe Asynchronous Control Electronics for Ultra-Wide (-230 °C to +130 °C) Environments, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This Small Business Innovation Research Phase I project seeks to investigate and prove the feasibility of developing ultra-wide temperature (-230oC to +130oC) motor...

  12. DC-Motor Drive Encompassing SiGe Asynchronous Control Electronics for Ultra-Wide (-230 °C to +130 °C) Environments, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — In Phase I, the research team formed by APEI, Inc. and University of Arkansas proved the feasibility of developing ultra-wide temperature (-230oC to +130 oC) motor...

  13. 226Ra-230Th Disequilibria in Magmas from Llaima and Lonquimay Volcanoes, Chile: On the Roles and Rates of Subvolcanic Magmatic Processes.

    Science.gov (United States)

    Reubi, O.; Cooper, L. B.; Dungan, M. A.; Bourdon, B.

    2014-12-01

    226Ra excesses in mafic arc magmas are generally attributed to recent (contamination had a secondary influence on 226Ra-230Th disequilibria. Magmas with the highest AFC contribution have 226Ra-230Th close to equilibrium, implying that (226Ra-230Th) are mostly affected by either differentiation on time scales of ~8 kyr, or more likely, mixing with mush bodies several kyr old. Lonquimay magmas (52 to 64 wt% SiO2) are almost aphyric. Their evolution was controlled by fractional crystallization with limited crustal contamination. (226Ra-230Th) range from moderate 226Ra excesses to small deficits, and are negatively correlated with Ba/Th and MgO. These observations are difficult to reconcile with only slab-fluid addition and mantle melting. We posit that this (226Ra-230Th) range results from diffusive Ra-exchange between young recharge melts and an old crystal mush. A similar process may also explain 226Ra deficits at some other SVZ volcanoes. Thus (226Ra-230Th) in erupted magmas reflect modification of mantle-derived signatures by open-system magmatic processes in the crust. 1Sigmarsson et al., 2002, Earth and Planet. Sc. Lett. 196, 189-196. 2 Reubi et al., 2011, Earth and Planet. Sc. Lett. 303, 37-47.

  14. N-Terminal Prodomain of Pfs230 Synthesized Using a Cell-Free System Is Sufficient To Induce Complement-Dependent Malaria Transmission-Blocking Activity▿

    Science.gov (United States)

    Tachibana, Mayumi; Wu, Yimin; Iriko, Hideyuki; Muratova, Olga; MacDonald, Nicholas J.; Sattabongkot, Jetsumon; Takeo, Satoru; Otsuki, Hitoshi; Torii, Motomi; Tsuboi, Takafumi

    2011-01-01

    The aim of a malaria transmission-blocking vaccine is to block the development of malaria parasites in the mosquito and thus prevent subsequent infection of the human host. Previous studies have demonstrated that the gametocyte/gamete surface protein Pfs230 can induce transmission-blocking immunity and have evaluated Escherichia coli-produced Pfs230 as a transmission-blocking vaccine candidate. In this study, we used the wheat germ cell-free expression system to produce N-terminal fragments of Pfs230 and evaluated the transmission-blocking activity of antisera raised against the recombinant Pfs230 protein. The rabbit antisera reacted to the surface of cultured gametocytes and gametes of the Plasmodium falciparum NF54 line, recognized the 360-kDa form of parasite-produced Pfs230 by Western blot assay, and reduced the infectivity of NF54 parasites to Anopheles stefensi mosquitoes in the presence of complement in a standard membrane feeding assay. Thus, our data demonstrate that the N-terminal pro domain of Pfs230 is sufficient to induce complement-dependent transmission-blocking activity against P. falciparum. PMID:21715579

  15. N-terminal prodomain of Pfs230 synthesized using a cell-free system is sufficient to induce complement-dependent malaria transmission-blocking activity.

    Science.gov (United States)

    Tachibana, Mayumi; Wu, Yimin; Iriko, Hideyuki; Muratova, Olga; MacDonald, Nicholas J; Sattabongkot, Jetsumon; Takeo, Satoru; Otsuki, Hitoshi; Torii, Motomi; Tsuboi, Takafumi

    2011-08-01

    The aim of a malaria transmission-blocking vaccine is to block the development of malaria parasites in the mosquito and thus prevent subsequent infection of the human host. Previous studies have demonstrated that the gametocyte/gamete surface protein Pfs230 can induce transmission-blocking immunity and have evaluated Escherichia coli-produced Pfs230 as a transmission-blocking vaccine candidate. In this study, we used the wheat germ cell-free expression system to produce N-terminal fragments of Pfs230 and evaluated the transmission-blocking activity of antisera raised against the recombinant Pfs230 protein. The rabbit antisera reacted to the surface of cultured gametocytes and gametes of the Plasmodium falciparum NF54 line, recognized the 360-kDa form of parasite-produced Pfs230 by Western blot assay, and reduced the infectivity of NF54 parasites to Anopheles stefensi mosquitoes in the presence of complement in a standard membrane feeding assay. Thus, our data demonstrate that the N-terminal pro domain of Pfs230 is sufficient to induce complement-dependent transmission-blocking activity against P. falciparum.

  16. Sediment 231Pa/230Th as a recorder of the rate of the Atlantic meridional overturning circulation: insights from a 2-D model

    Directory of Open Access Journals (Sweden)

    S. E. Allen

    2010-03-01

    Full Text Available A two dimensional scavenging model is used to investigate the patterns of sediment 231Pa/230Th generated by the Atlantic Meridional Overturning Circulation (AMOC and further advance the application of this proxy for ocean paleocirculation studies. The scavenging parameters and the geometry of the overturning circulation cell have been chosen so that the model generates meridional sections of dissolved 230Th and 231Pa consistent with published water column profiles and an additional 12 previously unpublished profiles measured in the North and Equatorial Atlantic. The processes that generate the meridional sections of dissolved and particulate 230Th, dissolved and particulate 231Pa, dissolved and particulate 231Pa/230Th, and sediment 231Pa/230Th are discussed in detail. The results indicate that the relationship between sediment 231Pa/230Th at any given site and the overturning circulation is very complex. They clearly show that constraining past changes in the strength and geometry of the AMOC requires an extensive data set and they suggest strategies to maximize information from a limited number of samples.

  17. Tank 241-TX-104, cores 230 and 231 analytical results for the final report

    International Nuclear Information System (INIS)

    Diaz, L.A.

    1998-01-01

    This document is the analytical laboratory report for tank 241-TX-104 push mode core segments collected between February 18, 1998 and February 23, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-104 Push Mode Core Sampling and Analysis Plan (TSAP) (McCain, 1997), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995) and the Safety Screening Data Quality Objective (DQO) (Dukelow, et.al., 1995). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report. Appearance and Sample Handling Attachment 1 is a cross reference to relate the tank farm identification numbers to the 222-S Laboratory LabCore/LIMS sample numbers. The subsamples generated in the laboratory for analyses are identified in these diagrams with their sources shown. Core 230: Three push mode core segments were removed from tank 241-TX-104 riser 9A on February 18, 1998. Segments were received by the 222-S Laboratory on February 19, 1998. Two segments were expected for this core. However, due to poor sample recovery, an additional segment was taken and identified as 2A. Core 231: Four push mode core segments were removed from tank 241-TX-104 riser 13A between February 19, 1998 and February 23, 1998. Segments were received by the 222-S Laboratory on February 24, 1998. Two segments were expected for this core. However, due to poor sample recovery, additional segments were taken and identified as 2A and 2B. The TSAP states the core samples should be transported to the laboratory within three

  18. Tank 241-TX-104, cores 230 and 231 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Diaz, L.A.

    1998-07-07

    This document is the analytical laboratory report for tank 241-TX-104 push mode core segments collected between February 18, 1998 and February 23, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-104 Push Mode Core Sampling and Analysis Plan (TSAP) (McCain, 1997), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995) and the Safety Screening Data Quality Objective (DQO) (Dukelow, et.al., 1995). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report. Appearance and Sample Handling Attachment 1 is a cross reference to relate the tank farm identification numbers to the 222-S Laboratory LabCore/LIMS sample numbers. The subsamples generated in the laboratory for analyses are identified in these diagrams with their sources shown. Core 230: Three push mode core segments were removed from tank 241-TX-104 riser 9A on February 18, 1998. Segments were received by the 222-S Laboratory on February 19, 1998. Two segments were expected for this core. However, due to poor sample recovery, an additional segment was taken and identified as 2A. Core 231: Four push mode core segments were removed from tank 241-TX-104 riser 13A between February 19, 1998 and February 23, 1998. Segments were received by the 222-S Laboratory on February 24, 1998. Two segments were expected for this core. However, due to poor sample recovery, additional segments were taken and identified as 2A and 2B. The TSAP states the core samples should be transported to the laboratory within three

  19. Effects of annealing on the modification of 230-MeV Pb ion irradiated sapphire

    International Nuclear Information System (INIS)

    Song Yin; Wang Zhiguang; Zhan Chonghong; Yao Cunfeng; Zang Hang; Liu Chunbao; Zhou Lihong; Sheng Yanbin; Xie Erqing

    2007-01-01

    Al 2 O 3 crystal is rhombohedral in cell structure and belongs to the D 3d space group with ionic bond. Sapphire posseses a wide band gap optical material for its broad transmission spectrum from ultraviolet to visible and near-infrared (0.2-2μm). It can be applied in the field of optics, fusion reactors as an insulator, the diagnostic systems and for optical window. In irradiation environment of reactor, radiation damage by neutron affects material characteristic, even possible result in accident. Ion implanted and high energy heavy ion irradiation as a sort of new technology of the modification of material, its good controllable, high reiteration and well-proportioned distributing, it can changes the surface and interior structure of material. These are help to the simulation of Al 2 O 3 interior structure modification of certain neutron radiation. In the present work the photoluminescence (PL) character of Single crystal sapphire (Al 2 O 3 ) samples and irradiated at 320 K by 230-MeV Pb ions and subsequently annealed at 600 K, 900 K and 1100 K temperature was studied. The modification of structure and optical properties induced by ion irradiation were analyzed using PL and FTIR spectra. The PL measurements showed that luminescence peaks located at 390, 413, 450, and 564 nm appeared in irradiated samples. The luminescence peaks appeared at 360, 380, and 516 nm after annealed irradiation samples. The peak of 380 nm became very intensity after 600 K anneal and other peak vanish. The peak of 380 nm weaken at 900 K anneal and 516 nm peak start buildup, the peak of 390 nm vanished and 510 nm peak increase along with temperature at 1100 K. The Fourier Transform Infrared (FTIR) spectra showed a broadening of the absorption band between 460 cm -1 and 510 cm -1 indicating strongly damaged regions formed in the Al 2 O 3 samples and position shift of the absorption band in 1000-1300 cm -1 towards to high wavenumber. After annealing, the lower irradiation fluence's samples

  20. The ABCA1 gene R230C variant is associated with decreased risk of premature coronary artery disease: the genetics of atherosclerotic disease (GEA study.

    Directory of Open Access Journals (Sweden)

    Teresa Villarreal-Molina

    Full Text Available ABCA1 genetic variation is known to play a role in HDL-C levels and various studies have also implicated ABCA1 variation in cardiovascular risk. The functional ABCA1/R230C variant is frequent in the Mexican population and has been consistently associated with low HDL-C concentrations. Although it has been associated with other cardiovascular risk factors such as obesity and type 2 diabetes mellitus, it is not known whether it is associated with coronary artery disease (CAD.The purpose of the study was to analyze whether the ABCA1/R230C variant is associated with premature CAD in a case-control association study (GEA or Genetics of Atherosclerotic Disease, and to explore whether BMI modulates the effect of the C230 allele on other metabolic traits using a population-based design.The C230 allele was significantly associated with both lower HDL-C levels and a lower risk of premature CAD as compared to controls (OR = 0.566; P(add = 1.499×10(-5. In addition, BMI modulated the effect of R230C on body fat distribution, as the correlation between BMI and visceral to subcutaneous adipose tissue (a metric of the propensity to store fat viscerally as compared to subcutaneously was negative in RR homozygous individuals, but positive in premenopausal women bearing the C230 allele, with a statistically significant interaction (P = 0.005. BMI-R230C interaction was also significant for triglyceride levels in women regardless of their menopausal status (P = 0.036.This is the first study assessing the effect of the R230C/ABCA1 variant in remature CAD. C230 was associated with both decreased HDL-C levels and a lower risk of premature CAD, and gender-specific BMI-R230C interactions were observed for different metabolic traits. These interactions may help explain inconsistencies in associations, and underscore the need to further analyze interactions of this functional and frequent variant with diet, exercise and other environmental factors.

  1. Evaluating the Ability of the Thorium-232 and Thorium-230 Isotopic Couple to Quantify Lithogenic Fluxes to the Ocean

    Science.gov (United States)

    Plancherel, Y.; Henderson, G. M.; Deng, F.; Khatiwala, S.; Hsieh, Y. T.

    2016-02-01

    The transfer of lithogenic material from the land to the ocean plays a key role in the global cycles of many elements. In spite of their importance, these fluxes are still poorly known. Here, we present lithogenic fluxes estimated using a thorium-isotope technique. Thorium-232 (232Th) is supplied to the ocean uniquely by dust and rivers. On the other hand, the dominant source of 230Th is the in situ decay of dissolved 234U at a uniform and well-known rate. Assuming that both isotopes have similar chemistries, the scavenging-induced mixed-layer deficit of dissolved 230Th can in principle be used to infer the removal flux of 232Th if the mixed layer residence times of both isotopes are similar. Assuming a steady-state one-dimensional balance, the vertical lithogenic 232Th flux necessary to support observed 232Th profiles can be calculated and the corresponding lithogenic mass flux inferred if the lithogenic abundance and solubility of 232Th are known. We first present fluxes calculated from a global dataset of 232Th and 230Th measurements and contrast these results with values from other available model-based dust-deposition estimates. We then test the limitations of the thorium-based estimates using 3-d ocean model simulations of 232Th and 230Th. Since the "true" lithogenic fluxes are perfectly known in the simulations, they can be used to quantify the absolute and relative errors associated with the observational estimates and evaluate how the error changes under various scenarios. By modulating the strength of the various sources and the scavenging intensity of each isotope in the model, the regional contribution of river and dust fluxes can also be constrained. Overall, we find that thorium-based fluxes represent dust-fluxes relatively well away from the coasts, that the precision depends strongly on 232Th solubility and that while the accuracy of the fluxes varies spatially, the relative error is often better than a factor of 2.

  2. WWER-440/V-230 Confinement modernization to upgrade the critical safety function 'Containment integrity' in case of severe accident

    International Nuclear Information System (INIS)

    Sartmadjiev, A.

    1999-01-01

    In this lecture the WWER-440/V-230 confinement modernization to upgrade the critical safety function 'Containment integrity' in case of severe accident is presented. There are discussed: design limitations of the location system; consequence from these design limitations; a few confinement reconstruction concepts of this type of units worldwide; and purpose of the confinement reconstruction - to improve significantly the original design, ensuring (1) localization for all possible primary breaks and (2) limitation of the radiological consequences for the personnel, the population and the environment below the regulatory requirements

  3. Performance-based specifications and control of concrete durability state-of-the-art report RILEM TC 230-PSC

    CERN Document Server

    Luco, Luis

    2016-01-01

    This work gives an overview of significant research from recent years concerning performance-based design and quality control for concrete durability and its implementation. In engineering practice, performance approaches are often still used in combination with prescriptive requirements. This is largely because, for most durability test methods, sufficient practical experience still has to be gained before engineers and owners are prepared to fully rely on them.   This book, compiled by RILEM TC 230-PSC, is intended to assist efforts to successfully build the foundation for the full implementation of performance-based approaches through the exchange of relevant knowledge and experience between researchers and practitioners worldwide.  .

  4. AMS 14C and 230Th/U dating on stalagmites from North Altai Mountain, Siberia, Russia

    Science.gov (United States)

    Li, H. C.; Yin, J. J.; Blyakharchuk, T.; Shen, C. C.

    2017-12-01

    Three stalagmites, two from Lunnaya Cave (LUN-1 and LUN-2, 52º40.729'N, 88º43.854' E, 481 m a.s.l.), one from Nadezhda Cave (HOP-1, 52º38.872'N, 88º39.194'E, 550 m a.s.l.) located along Mrassy River in the northern Altai Mountains, Siberia, Russia were collected in the summer of 2016 for paleoclimate reconstruction. HOP-1 is a 21-cm long stalagmite which contains very low U content (238U = 70 ppb) and relatively high Th content (232Th = 2 9.3 ppb), resulting in unsuccessful 230Th/U dating (-262 ± 284 yr BP in the top and -19,935 ± 22,246 yr BP). Thirty one AMS 14C dates from 27 horizons of the stalagmite provide a detailed chronology, showing that the stalagmite grew from 6,350 ± 45 yr BP to 490 ± 10 Calib. yr BP. Both LUN-1 and LUN-2 are about 20-cm long. The growth feature of LUN-2 is similar to that of HOP-1 with continuous growth, clear bands of depositional cycles in white non-transparent calcite, whereas LUN-1 has light yellow transparent calcite in the center part with multiple growth hiatuses. The 230Th/U dates show that LUN-1 from 2725 ± 775 yr BP at 193 mm depth to 823 ± 28 yr BP at 12 mm depth with very fast growth rate during 900 1500 yr BP. The AMS 14C dates of LUN-1 provide similar growth pattern with very fast growth between the first hiatus at 12 mm depth and the second hiatus at 155 cm depth. Six 14C dates from this fast growth period are all around 1500 Calib. yr BP without a correct age sequence. Two 14C dates from the top 12 mm exhibit "nuclear bomb signal" (percentage of modern carbon >100%). Similar ages of AMS 14C and 230Th/U dating results in the lower part indicate that dead carbon influence in radiocarbon ages are negligible. 230Th/U dating is not successful for LUN-2. The preliminary AMS 14C dating on LUN-2 shows that the stalagmite continuously deposited from 13335 ± 150 Calib. yr BP. All three stalagmites do not have growth deposition during the Little Ice Age due to cold and dry climates. Further work on stable isotope

  5. Study of in vivo generators Pb-212/Bi--212 and U-230/Th-226 for alpha radioimmunotherapy

    International Nuclear Information System (INIS)

    Le Du, A.

    2011-01-01

    Alpha-radioimmunotherapy is a promising cancer therapy that uses a-particles vectorized by monoclonal antibody to break down cancerous tumors. The notion of in vivo generator was introduced in 1989 by Leonard Mausner. The concept involves labeling of various molecular carriers (antibodies, peptides, etc) with intermediate half-life generator parents, which after accumulation in the desired tissue generate much shorter half-life daughter radionuclide. This thesis focuses on the study of two in vivo generators potentially interesting for alpha-radioimmunotherapy: Pb-212 / Bi-212 generator and U-230 / Th-226 generator. The first part of this work presents the Pb-212 / Bi-212 generator, two approaches allowing the vectorization. Chelation approach on a protein and an approach by encapsulation in liposomes have been proposed. This last approach appears to be the most interesting. In vitro stability studies have been performed on these labeling. The second part of this work presents the U-230 / Th-226 generator. Studies have first been made to achieve a theoretical model to describe the speciation of Th(IV) in human serum. The efficacy of DTPA as chelating agent for complexation of Th(IV) in human serum could thus be estimated. (author)

  6. Survey of Magnetic Fields Near BPA 230-kV and 500-kV Transmission Lines.

    Energy Technology Data Exchange (ETDEWEB)

    Perrin, Nancy; Aggarwal, Rajinder Pal; Bracken, T. Daniel

    1991-05-20

    The purpose of this study was to characterize typical levels and variability of 60Hz magnetic fields at the centerline and edge of right-of-way of Bonneville Power Administration (BPA) 230-kV and 500-kV transmission lines. This was accomplished by taking magnetic field measurements at over 800 spans in Oregon and Washington. The spans were sampled using a stratified random sampling procedure with region (East vs. West), voltage (230-kV vs 500-kV), and circuit configuration as strata. There were five different circuit configuration groups for each region/voltage category requiring a total of 200 strata. Magnetic field measurements were taken at 13 locations under each span using an EMDEX-C as a survey meter. Additional information recorded for each span included conductor height (at 10 locations), right-of-way width, longitudinal and lateral slope, time of day, vegetation, terrain, weather conditions, temperature, wind speed, span length and presence of other lines in the corridor. 9 refs., 17 figs., 26 tabs.

  7. 230Th/234U dating of the quaternary spring travertines in the Arava Rift Valley of Israel and paleoclimatic implications

    International Nuclear Information System (INIS)

    Kronfeld, J.

    1988-07-01

    Springs and lake deposits (travertines) sampled along the western margins of the Arava segment of the Dead Sea Rift Valley, Israel, were studied as a potential source of palaeoclimatic information. The 230 Th/ 234 U disequilibrium method was used to determine the age of the investigated deposits. The radiometric dating was supplemented by detailed petrographic and chemical analyses of the collected samples. Detailed petrographic observations of the analysed travertine samples suggest their deposition under moderately-arid conditions, alternating with arid to extremely arid periods. This evidence is consistent with the preliminary conclusions drawn from palynological studies in the area. Dating by the 230 Th/ 234 U disequilibrium method indicates that most travertine ages correspond to oceanic 18 O stages 5 and 7. The good correspondence between apparent ages as deduced from the position of the travertines in vertical and lateral successions and the radiometric ages, lends credibility to the radiometric ages. The clustering of ages during the warm 18 O stages bears similarity to the temporal distribution of middle to late Pleistocene sapropelic horizons in the Eastern Mediterranean Basin which further leads to suspicion that during insolation maxima monsoonal cells originating in the Indian Ocean have shifted northwards reaching the latitude of the Arava and Negev Highlands. Refs and figs

  8. sup 230 Th/ sup 234 U dates of late Pleistocene corals from Kita- and Minami-Diato Island, Okinawa, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Omura, Akio; Iwata, Hideki (Kanazawa Univ. (Japan). Faculty of Science); Ota, Yoko; Koba, Motoharu; Kawana, Toshio

    1991-06-01

    Alpha spectrometric Th-230/U-234 dating was applied to 50 Pleistocene corals from Kita- and Minami-Daito Islands, both have been well known as the noteworthy representatives of raised atolls. The Th-230/U-234 dates ranged from 113{+-}6 to 133{+-}6 ka (123{+-}1 ka on average) in the autochthonous corals from Kita-, and from 111{+-}5 to 159{+-}10 ka (123{+-}1 ka on average) in those from Minami-Daito Island, intimating that the fringing reefs have been developed during the high sea level stand of the last interglacial maximum. These dates are correlative to the oxygen isotope stage 5e. The upper limit of occurrence of the dated autochthonous corals was 8.1 m in Kita- and 11 m in Minami-Daito Island. Besides, the somewhat younger dates corresponding to OIS-5a or 5c were obtained from some allochthonous corals in a detrital limestone unit in Kita-Daito Island. However, hermatypic corals were alive, forming small scale reefs in shallow sea around Kita-Daito Island. The former shoreline was proved by the presence of raised surf bench at some localities, where the dated autochthonous corals were collected. (K.I.).

  9. Study of the growth mechanism of some oxide scales on alloy 230 in high temperature vapor electrolysis (HTVE) conditions

    International Nuclear Information System (INIS)

    Guillou, S.; Desgranges, C.; Chevalier, S.

    2012-01-01

    Alloy 230 (also named Haynes (R) 230) was tested as interconnect for production of hydrogen via High Temperature Vapor Electrolysis (HIVE). Samples were oxidized at 800 degrees C in the both atmospheres representative of the HIVE operating conditions: Ar-1%H-2-9%H 2 O (for cathode side) and air (for anode side). The high temperature oxidation behaviour was studied in both atmospheres together with the electrical conductivity of the thermally grown oxide scales. Oxidation kinetics indicated lower oxidation rate in H 2 /H 2 O compared to air (k(p) = 3.8.10 -15 g 2 .cm -4 .s -1 in H 2 /H 2 O and k(p) = 1.6.10 -14 g 2 .cm -4 .s -1 in air). The corrosion products were characterized by scanning electron microscopy associated with X-ray diffraction analyses and energy dispersive X-ray analyses. The sample electrical behaviour was evaluated by determining the Area Specific Resistance (ASR). The ASR was higher in H 2 /H 2 O (ASR = 1 ohm.cm 2 ) than in air (ASR = 0.04 ohm.cm 2 ). The diffusion of proton or hydrogen containing species through the oxide scale is proposed to be responsible for the increase of the electrical conductivity in cathode side. (authors)

  10. In-gas laser ionization and spectroscopy of actinium isotopes near the N =126 closed shell

    Science.gov (United States)

    Granados, C.; Creemers, P.; Ferrer, R.; Gaffney, L. P.; Gins, W.; de Groote, R.; Huyse, M.; Kudryavtsev, Yu.; Martínez, Y.; Raeder, S.; Sels, S.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wrzosek-Lipska, K.; Zadvornaya, A.; Barzakh, A. E.; Bastin, B.; Delahaye, P.; Hijazi, L.; Lecesne, N.; Luton, F.; Piot, J.; Savajols, H.; Thomas, J.-C.; Traykov, E.; Beerwerth, R.; Fritzsche, S.; Block, M.; Fléchard, X.; Franchoo, S.; Ghys, L.; Grawe, H.; Heinke, R.; Kron, T.; Naubereit, P.; Wendt, K.; Laatiaoui, M.; Moore, I.; Sonnenschein, V.; Loiselet, M.; Mogilevskiy, E.; Rothe, S.

    2017-11-01

    The in-gas laser ionization and spectroscopy (IGLIS) technique was applied on the Ac-215212 isotopes, produced at the Leuven Isotope Separator On-Line (LISOL) facility by using the in-gas-cell and the in-gas-jet methods. The first application under on-line conditions of the in-gas-jet laser spectroscopy method showed a superior performance in terms of selectivity, spectral resolution, and efficiency in comparison with the in-gas-cell method. Following the analysis of both experiments, the magnetic-dipole moments for the Ac-215212 isotopes, electric-quadrupole moments and nuclear spins for the Ac,215214 isotopes are presented and discussed. A good agreement is obtained with large-scale nuclear shell-model calculations by using a 208Pb core.

  11. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    Energy Technology Data Exchange (ETDEWEB)

    Aleissa, Khalid A.; Almasoud, Fahad I.; Islam, Mohammed S. [Atomic Energy Research Institute, King Abdul Aziz City for Science and Technology, P.O. Box 6086, Riyadh 11442 (Saudi Arabia); L' Annunziata, Michael F. [IAEA Expert, Montague Group, P.O. Box 5033, Oceanside, CA 92052-5033 (United States)], E-mail: mlannunziata@cox.net

    2008-12-15

    The activities of {sup 228}Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide {sup 228}Ac. The radium was pre-concentrated on MnO{sub 2} and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter {sup 228}Ra({sup 228}Ac), the daughter nuclide {sup 228}Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by {sup 228}Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9{+-}0.1% was measured for {sup 228}Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317{+-}0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of {sup 228}Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for {sup 228}Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure {sup 228}Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  12. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  13. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  15. Measures for ensuring hydrogen fire and explosion safety for VVER-440/230

    International Nuclear Information System (INIS)

    Bezlepkin, V.; Semashko, S.; Svetlov, S.; Sidorov, V.; Ivkov, I.; Krylov, Yu.; Kukhtevich, V.

    2004-01-01

    This paper deals with the findings of calculation analysis as regards the release of mass, energy and hydrogen during beyond-design-basis accident (BDBA) at Kola NPP equipped with VVER-440 reactor (B-230 design) and in respect of distribution of hydrogen throughout NPP tight compartments. The analysis figures out the number and locations of passive catalytic hydrogen recombiners and of the sensors of the hydrogen concentration monitoring system. In order to prove the hydrogen safety of the design, it has been necessary to review accidents accompanied by maximum emissions (both peak and integral ones) of hydrogen into the tight area. During design-basis accident (DBA), no steam/zirconium reactions occur in the reactor core. Out of BDBA, the severe accidents with damage to the core accompanied oxidative reactions between zirconium and steel with emission of hydrogen are regarded as the most dangerous ones. Assessment of additional hydrogen sources shows that the contribution of such sources to the total amount of hydrogen that may emit during a severe accident is insignificant. Calculations have been made for the following scenarios of severe accidents, which seem to be the most important in terms of hydrogen safety analysis: - 20 mm leak from the primary circuit in combination with a failure of the emergency makeup system; - 500 mm PCP rupture in the vicinity of reactor inlet branch with bi-lateral leakage of coolant. Releases of mass and energy during the aforesaid scenarios, changes of medium parameters within the tight compartments and analysis of possible fire conditions have been analyzed by means of Russian computer codes RATEG/SVECHA/HEFEST, KUPOL-M and LIMITS. The said analysis shows that the large break accident (500 mm), i.e. PCP rupture in the vicinity of the reactor branch with bi-lateral leakage of coolant is of the keen interest in terms of hydrogen safety. This accident typifies powerful short-term release of hydrogen at a significantly lesser

  16. Magnetostratigraphy and 230Th dating of a drill core from the southeastern Qaidam Basin: Salt lake evolution and tectonic implications

    Directory of Open Access Journals (Sweden)

    An-Dong Chen

    2018-05-01

    Full Text Available The Qarhan Salt Lake area is the Quaternary depocenter of the Qaidam Basin, and carries thick lacustrine sediments, as well as rich potassium and magnesium salt deposits. The abundant resources and thick sediments in this lake provide an ideal place for the study of biogas formation and preservation, salt lake evolution, and the uplift of the Tibetan Plateau. In this study, we attempt to construct a paleomagnetic and 230Th age model and to obtain information on tectonic activity and salt lake evolution through detailed studies on a 1300-m-long drill core (15DZK01 from the northwestern margin of the Qarhan Salt Lake area (Dongling Lake. Based on gypsum 230Th dating, the age of the uppermost clastic deposit was calculated to be around 0.052 Ma. The polarity sequence consist of 13 pairs of normal and reversed zones, which can be correlated with subchrons C2r.1r-C1n of the geomagnetic polarity timescale (GPTS 2012 (from ∼2.070 Ma to ∼0.052 Ma. Sedimentary characteristics indicate that Dongling Lake witnessed freshwater environment between ∼2.070 Ma and 1.546 Ma. During this period, the sedimentary record reflects primarily lakeshore, shallow-water and swamp environments, representing favourable conditions for the formation of hydrocarbon source rocks. Between 1.546 Ma and ∼0.052 Ma, the Dongling Lake was in sulphate deposition stage, which contrasts with the central Qarhan Salt Lake area, where this stage did not occur in the meantime. During this stage, Dongling Lake was in a shallow saltwater lake environment, but several periods of reduced salinity occurred during this stage. During the late Pleistocene at ∼0.052 Ma, the Dongling Lake experienced uplift due to tectonic activity, and saltwater migrated through the Sanhu Fault to the central Qarhan Salt Lake area, resulting in the absence of halite deposition stage. The residual saline water was concentrated into magnesium-rich brine due to the lack of freshwater, and few

  17. IAEA meeting report of the consultants' meeting on safety improvements of WWER-440 model 230 nuclear power plants

    International Nuclear Information System (INIS)

    1998-05-01

    In 1992 the identification and ranking of safety issues for WWER-440/230 NPPs were completed. Some 100 safety issues have been identified and ranked according to their safety impact on the plant's defence in depth. The IAEA work was based on a conceptual design review and a series of safety review missions to each one of the four sites (Bohunice, Kozloduy, Novovoronezh and Kola) where WWER-440/230 NPPs were in operation. Results were published by the IAEA in February and May 1992. Since the initial publications the IAEA has continued its activities and conducted a number of follow-up missions and technical visits to the NPP sites to review the status of implementation of safety upgradings. In September of 1994 a Consultants Meeting (CM) was held in Vienna to consolidate all the information available to the AEA. The results of that meeting were included in the report WWER-SC-107. During 1995-1997 further information became available from technical visits conducted by the IAEA at the four sites. Therefore, in February 1998 the IAEA convened a CM in Vienna to prepare an up-to-date report on the status of safety improvements at WWER-440/230 NPPs. This report contains the results of that meeting. It reviews the status of remedial actions implemented at each plant in response to the safety issues originally identified in the IAEA reports and the remaining safety concerns. For convenience the issues are presented under broad titles related to: integrity of barriers (Section 2); performance of basic functions (Section 3); performance of supporting functions (Section 4); internal hazards (Section 5); external hazards (Section 6); accident analysis (Section 7); operational functions (Section 8); Section 9 provides an overview of the results of PSA studies performed and under way. Section 10 provides specific information on the status of Armenia NPP. It is presented separately because the IAEA assistance to this plant was provided in the framework of the national technical co

  18. Effects of electrical discharge surface modification of superalloy Haynes 230 with aluminum and molybdenum on oxidation behavior

    International Nuclear Information System (INIS)

    Bai, C.-Y.

    2007-01-01

    The effects of the electrical discharge alloying (EDA) process on improving the high temperature oxidation resistance of the Ni-based superalloy Haynes 230 have been investigated. The 85 at.% Al and 15 at.% Mo composite electrode provided the surface alloying materials. An Al-rich layer is produced on the surface of the EDA specimen alloyed with positive electrode polarity, whereas, many discontinuous piled layers are attached to the surface of the EDA superalloy when negative electrode polarity is selected. The oxidation resistance of the specimen alloyed with positive electrode polarity is better than that of the unalloyed superalloy, and the effective temperature of oxidation resistance of the alloyed layer can be achieved to 1100 o C. Conversely, the oxidation resistance of the other EDA specimen alloyed with negative electrode polarity is even worse than that of the unalloyed superalloy

  19. Rapid evolution of ritual architecture in central Polynesia indicated by precise 230Th/U coral dating.

    Science.gov (United States)

    Sharp, Warren D; Kahn, Jennifer G; Polito, Christina M; Kirch, Patrick V

    2010-07-27

    In Polynesia, the complex Society Islands chiefdoms constructed elaborate temples (marae), some of which reached monumental proportions and were associated with human sacrifice in the 'Oro cult. We investigated the development of temples on Mo'orea Island by 230Th/U dating of corals used as architectural elements (facing veneers, cut-and-dressed blocks, and offerings). The three largest coastal marae (associated with the highest-ranked chiefly lineages) and 19 marae in the inland 'Opunohu Valley containing coral architectural elements were dated. Fifteen corals from the coastal temples meet geochemical criteria for accurate 230Th/U dating, yield reproducible ages for each marae, and have a mean uncertainty of 9 y (2sigma). Of 41 corals from wetter inland sites, 12 show some diagenesis and may yield unreliable ages; however, the majority (32) of inland dates are considered accurate. We also obtained six 14C dates on charcoal from four marae. The dates indicate that temple architecture on Mo'orea Island developed rapidly over a period of approximately 140 y (ca. AD 1620-1760), with the largest coastal temples constructed immediately before initial European contact (AD 1767). The result of a seriation of architectural features corresponds closely with this chronology. Acropora coral veneers were superceded by cut-and-dressed Porites coral blocks on altar platforms, followed by development of multitier stepped altar platforms and use of pecked basalt stones associated with the late 'Oro cult. This example demonstrates that elaboration of ritual architecture in complex societies may be surprisingly rapid.

  20. Speleogenesis of the Hermannshöhle cave system (Austria): Constraints from .sup. 230./sup.Th/U-dating and palaeomagnetic analysis

    Czech Academy of Sciences Publication Activity Database

    Plan, L.; Schober, A.; Scholz, D.; Spötl, C.; Pruner, Petr; Bosák, Pavel

    2015-01-01

    Roč. 44, č. 3 (2015), s. 315-326 ISSN 0392-6672 Institutional support: RVO:67985831 Keywords : 230 Th/U-dating * palaeomagnetics * paragenesis * speleogenesis * valley incision Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.559, year: 2015

  1. [Review of:] Theories of Information Behavior, eds.: Karen E. Fisher et al. Medford, NJ: Information Today, 2005. xxii, 431 S., ISBN 1-57387-230-X

    OpenAIRE

    Oberhauser, Otto

    2006-01-01

    Book review of Theories of Information Behavior. Eds.: Karen E. Fisher, Sanda Erdelez, Lynne McKechnie. Medford, NJ: Information Today, 2005. xxii+431p., ISBN 1-57387-230-X (hbk). This volume from the "ASIST Monograph Series" contains 72 articles on various theoretical approaches to the important branch of information science, "human information behaviour". A marvellous book, and truly recommended!

  2. 17 CFR 230.153b - Definition of “preceded by a prospectus”, as used in section 5(b)(2), in connection with certain...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Definition of âpreceded by a... RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.153b Definition of “preceded by a prospectus... are traded, for the purpose of redelivery to options customers upon their request, Provided That: (a...

  3. 39 CFR 230.17 - If an attempt is made to compel production of reports and records during the employee's testimony...

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false If an attempt is made to compel production of reports and records during the employee's testimony, what is an Office of Inspector General employee... Information Act and shall be handled pursuant to 39 CFR 230.5. ...

  4. Influence of form factors and multistep effects on the 232Th(d,t) 231Th and 230Th(d,p) 231Th reactions

    International Nuclear Information System (INIS)

    Wilcke, W.; Felix, W.; Elze, Th.W.; Huizenga, J.R.; Thompson, R.C.; Dreisler, R.M.

    1977-01-01

    Tables of spectroscopic information are given for the nuclei 233 , 235 , 237 Pa, and 229 , 231 Ac studied in the reactions 234 , 236 , 238 U, and 230 , 232 Th(t,α), including spin, parity, differential cross sections, and spectra. These quantities are discussed and plotted

  5. 78 FR 68467 - Notice of Availability of the Record of Decision for the Gateway West 230/345/500-kV Transmission...

    Science.gov (United States)

    2013-11-14

    ... and regulations for the Morley Nelson Snake River Birds of Prey National Conservation Area, the BLM... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLWY920000/51010000.ER0000/LVRWK09K0990/241A; WYW-174598; IDI-35849] Notice of Availability of the Record of Decision for the Gateway West 230/345...

  6. The prevalence of ABCB1:c.227_230delATAG mutation in affected dog breeds from European countries.

    Science.gov (United States)

    Firdova, Zuzana; Turnova, Evelina; Bielikova, Marcela; Turna, Jan; Dudas, Andrej

    2016-06-01

    Deletion of 4-base pairs in the canine ABCB1 (MDR1) gene, responsible for encoding P-glycoprotein, leads to nonsense frame-shift mutation, which causes hypersensitivity to macrocyclic lactones drugs (e.g. ivermectin). To date, at least 12 purebred dog breeds have been found to be affected by this mutation. The aim of this study was to update information about the prevalence of ABCB1 mutation (c.227_230delATAG) in predisposed breeds in multiple European countries. This large scale survey also includes countries which were not involved in previous studies. The samples were collected in the period from 2012 to 2014. The overview is based on genotyping data of 4729 individuals. The observed mutant allele frequencies were 58.5% (Smooth Collie), 48.3% (Rough Collie), 35% (Australian Shepherd), 30.3% (Shetland Sheepdog), 28.1% (Silken Windhound), 26.1% (Miniature Australian Shepherd), 24.3% (Longhaired Whippet), 16.2% (White Swiss Shepherd) and 0% (Border Collie). The possible presence of an ABCB1 mutant allele in Akita-Inu breed has been investigated with negative results. This information could be helpful for breeders in optimization of their breeding strategy and for veterinarians when prescribing drug therapy for dogs of predisposed breeds. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Energy balance, macronutrient intake, and hydration status during a 1,230 km ultra-endurance bike marathon.

    Science.gov (United States)

    Geesmann, Bjoern; Mester, Joachim; Koehler, Karsten

    2014-10-01

    Athletes competing in ultra-endurance events are advised to meet energy requirements, to supply appropriate amounts of carbohydrates (CHO), and to be adequately hydrated before and during exercise. In practice, these recommendations may not be followed because of satiety, gastrointestinal discomfort, and fatigue. The purpose of the study was to assess energy balance, macronutrient intake and hydration status before and during a 1,230-km bike marathon. A group of 14 well-trained participants (VO2max: 63.2 ± 3.3 ml/kg/min) completed the marathon after 42:47 hr. Ad libitum food and fluid intake were monitored throughout the event. Energy expenditure (EE) was derived from power output and urine and blood markers were collected before the start, after 310, 618, and 921 km, after the finish, and 12 hr after the finish. Energy intake (EI; 19,749 ± 4,502 kcal) was lower than EE (25,303 ± 2,436 kcal) in 12 of 14 athletes. EI and CHO intake (average: 57.1 ± 17.7 g/hr) decreased significantly after km 618 (p bike marathon. Individual strategies to overcome satiety and fatigue may be necessary to improve eating and drinking behavior during prolonged ultra-endurance exercise.

  8. Evaluation of high specific-heat ceramic for regenerator use at temperatures between 2-30 K

    Science.gov (United States)

    Lawless, W. N.

    1979-01-01

    Specific heat, thermal conductivity (both in the range 2-30 K), and microhardness data were measured on the ceramics labelled LS-8, LS-8A, and LS-8A doped with CsI, SnCl2, and AgCl. A work hardened sample of LS-8A was also studied in an effort to determine the feasibility of using these types of LS-8 materials to replace Pb spheres in the regenerator of the JPL cryocooler. The LS-8A materials are all more than an order of magnitude harder than Pb, and the dopants do not significantly improve the hardness. However, the SnCl2 dopant has a remarkable effect in improving the specific heat and thermal conductivity of LS-8A. The SnCl2 doping level which maximized the regenerator enthalpy change in going from an unloaded to a loaded condition was found to be 0.2 percent SnCl2 in LS-8A. It was also found that the enthalpy change for a regenerator employing the LS-8A material is more than three times larger than for the Pb spheres case. The use of rods, rather than spheres, of optimally doped LS-8A in regenerators is discussed.

  9. The target preparation of 232Th plated on the nickel with copper as substrate and 230Pa generation

    International Nuclear Information System (INIS)

    Shen Hua; Geng Junxia; Gao Size; Zhang Guoxin; Zhang Lan; Li Wenxin; Li Qingnuan; Wu Guozhong

    2014-01-01

    The electrochemical parameters on nickel plating on the copper have been studied using aqueous electroplating technique. And thorium is plated on the nickel flake using molecular plating technique. The better experimental parameters are obtained. According to these optimized parameters, the 232 Th target which is suitable for Cyclone-30 accelerator is prepared. The proton beam with energy of 21 MeV bombed the 232 Th target (total beam time 20 μAh). The results showed that the better range of plating current density of nickel plated on copper is l.30∼1.68 A/dm 2 . The thickness of nickel plating layer can reach more than 10 μm. The current density is 3∼5 mA/cm 2 , and the thickness of plated thorium layer is up to micrometer scale. The binding force of as-prepared 232 Th target is very well. There is 230 Pa appeared after the target is bombed by the proton beam. (authors)

  10. Report of a consultants' meeting on containment and confinement performance in NPPS with WWER 440/213 and 440/230 reactors

    International Nuclear Information System (INIS)

    1994-01-01

    The reactors WWER 440 model V-230 being operated in several countries of central and eastern Europe were designed in the 1960-ies assuming that the design basis accident can be limited to a break of a pipe of 100 mm diameter fitted with an orifice of 32 mm diameter. This assumption presently judged to be inadequate according to the international safety requirements, was used to determine the Emergency Core Cooling System. For this size of the break, the spray system of the reactor building was designed to prevent uncontrolled releases to the environment. For larger breaks, till full rupture of one of two pressurizer surge lines of 200 mm diameter each, large flaps were designed to open during the initial pressure peak after the accident and release to the environment large amounts of steam escaping from the broken reactor coolant system (RCS). In view of this initial release of radioactive medium and due to its other unsatisfactory features, the building surrounding the WWER 440/230 reactor is not called a containment, but is said to fulfill a confining function, in short it is termed a confinement. The shortcomings of the WWER 440/230 confinements have been long recognized and the newer model of WWER 440 units, called model V-213, has been provided with an improved building of higher leaktightness and higher strength, containing a complicated system of water trays and air traps designed to condense steam and remove a part of the air from the reactor compartments after large break loss of coolant accident (LB LOCA). For such case, the system provides fast pressure decrease in the containment to subatmospheric values and thus prevents any significant releases of radioactivity to the environment. As the main process is that of steam bubble condensation in water, the system is called bubbler condenser containment. The bubbler condenser containment was the answer to the problem of providing the old WWER 440 model 230 units with a reliable containment without excessive

  11. Determination 230Th by ICP-MS for the control of activities of restoration of an area of land contaminated with uranium mining sterile

    International Nuclear Information System (INIS)

    Yague, L.; Conde, E.; Navarro, N.; Fernandez, M.; Ortiz, M. I.; Noguerales, C.; Gasco, C.

    2013-01-01

    In 2012, within the activities for the Project PIMIC (CIEMAT) took out the first stage of restoration of a contaminated area. This is an area which had a residual contamination due to burial tailings uranium mining. The activities have been: elimination of the arboreal mass, excavation of the ground and earthmoving. The methodology applied is described in this work and is based on the combination of gamma spectrometry technique and development of a method of analysis 230 Th by ICP-MS. (Author)

  12. Guidance for the application of the leak before break concept. Report of the IAEA extrabudgetary programme on the safety of WWER-440 model 230 nuclear power plants

    International Nuclear Information System (INIS)

    1994-11-01

    This document provides additional guidance on application of the LBB concept to WWER-440/230 NPPs and complements the IAEA-TECDOC-710. The objective of the report is to describe in detail the elements of the LBB concept, the necessary support as well as the condition to be fulfilled, and the verification programme. It should also provide a clear picture of all the activities and resources needed to implement the LBB successfully as a comprehensive concept

  13. A New Approach to Suppress the Effect of Machining Error for Waveguide Septum Circular Polarizer at 230 GHz Band in Radio Astronomy

    Science.gov (United States)

    Hasegawa, Yutaka; Harada, Ryohei; Tokuda, Kazuki; Kimura, Kimihiro; Ogawa, Hideo; Onishi, Toshikazu; Nishimura, Atsushi; Han, Johnson; Inoue, Makoto

    2017-05-01

    A new stepped septum-type waveguide circular polarizer (SST-CP) was developed to operate in the 230 GHz band for radio astronomy, especially submillimeter-band VLBI observations. For previously reported SST-CP models, the 230 GHz band is too high to achieve the design characteristics in manufactured devices because of unexpected machining errors. To realize a functional SST-CP that can operate in the submillimeter band, a new method was developed, in which the division surface is shifted from the top step of the septum to the second step from the top, and we simulated the expected machining error. The SST-CP using this method can compensate for specified machining errors and suppress serious deterioration. To verify the proposed method, several test pieces were manufactured, and their characteristics were measured using a VNA. These results indicated that the insertion losses were approximately 0.75 dB, and the input return losses and the crosstalk of the left- and right-hand circular polarization were greater than 20 dB at 220-245 GHz on 300 K. Moreover, a 230 GHz SST-CP was developed by the proposed method and installed in a 1.85-m radio telescope receiver systems, and then had used for scientific observations during one observation season without any problems. These achievements demonstrate the successful development of a 230 GHz SST-CP for radio astronomical observations. Furthermore, the proposed method can be applicable for observations in higher frequency bands, such as 345 GHz.

  14. U-238-U-234-Th-230-Th-232 systematics and the precise measurement of time over the past 500,000 years

    Science.gov (United States)

    Edwards, R. Lawrence; Chen, J. H.; Wasserburg, G. J.

    1987-01-01

    A method is presented for the high-precision measurement of the Th-230 abundance in corals by isotope-dilution mass spectrometry using techniques developed by Chen and Wasserburg (1980, 1981) and Chen et al. (1986). It is shown that 6 x 10 to the 8th atoms of Th-230 can be measured to + or - 30 percent (2 sigma) and 2 x 10 to the 10th atoms of Th-230 to + or - 2 percent. The time over which useful age data on corals can be obtained ranges from a few years to about 500 ky, with the uncertainty in age ranging from 5 y for a 180-y-old coral, to 44 y for a 8294-y-old coral, to 1.1 ky for a 123.1-ky-old coral. Ages were determined with high analytical precision for several corals that grew during high sea-level stands about 120 ky ago, supporting the view that the dominant cause of Pleistocene climate change was Milankovitch forcing.

  15. {sup 230}Th, {sup 232}Th and {sup 238}U determinations in phosphoric acid fertilizer and process products by ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Nascimento, Marcos R.L. do; Guerreiro, Luisa M.R.; Bonifacio, Rodrigo L.; Taddei, Maria H.T., E-mail: pmarcos@cnen.gov.br [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas

    2015-07-01

    Through processing of Santa Quiteria-CE mine phosphate rock, Brazil has established a project for production of phosphoric acid fertilizer and uranium as a by-product. Under leaching conditions of phosphate rock with sulfuric acid, which is the common route for preparing phosphoric acid fertilizer, a large part of uranium, thorium and their decay products naturally present in the rock are solubilized. In order to assess the contamination potential in phosphoric acid and others process products, this paper describes a previous precipitation and direct methods for routine analysis of thorium and uranium isotopes by ICP-MS. In all samples, {sup 230}Th, {sup 232}Th and {sup 238}U were directly determined after dilution, except {sup 230}Th in phosphoric acid loaded with uranium sample, which to overcome equipment contamination effect, was determined after its separation by oxalate precipitation using lanthanum as a carrier. The results obtained by the proposed method by ICP-MS, were in good agreement when compared to alpha spectrometry for {sup 230}Th, and ICP-OES and spectrophotometry with arsenazo III for elementary uranium and thorium determinations. (author)

  16. BIOCHEMICAL CONTROL DURING LONG-TERM FOLLOW-UP OF 230 ADULT PATIENTS WITH CUSHING DISEASE: A MULTICENTER RETROSPECTIVE STUDY.

    Science.gov (United States)

    Geer, Eliza B; Shafiq, Ismat; Gordon, Murray B; Bonert, Vivien; Ayala, Alejandro; Swerdloff, Ronald S; Katznelson, Laurence; Lalazar, Yelena; Manuylova, Ekaterina; Pulaski-Liebert, Karen J; Carmichael, John D; Hannoush, Zeina; Surampudi, Vijaya; Broder, Michael S; Cherepanov, Dasha; Eagan, Marianne; Lee, Jackie; Said, Qayyim; Neary, Maureen P; Biller, Beverly M K

    2017-08-01

    Cushing disease (CD) results from excessive exposure to glucocorticoids caused by an adrenocorticotropic hormone-secreting pituitary tumor. Inadequately treated CD is associated with significant morbidity and elevated mortality. Multicenter data on CD patients treated in routine clinical practice are needed to assess treatment outcomes in this rare disorder. The study purpose was to describe the burden of illness and treatment outcomes for CD patients. Eight pituitary centers in four U.S. regions participated in this multicenter retrospective chart review study. Subjects were CD patients diagnosed at ≥18 years of age within the past 20 years. Descriptive statistical analyses were conducted to examine presenting signs, symptoms, comorbidities, and treatment outcomes. Of 230 patients, 79% were female (median age at diagnosis, 39 years; range, 18 to 78 years). Length of follow-up was 0 to 27.5 years (median, 1.9 years). Pituitary adenomas were 0 to 51 mm. The most common presenting comorbidities included hypertension (67.3%), polycystic ovary syndrome (43.5%), and hyperlipidemia (41.5%). Biochemical control was achieved with initial pituitary surgery in 41.4% patients (91 of 220), not achieved in 50.0% of patients (110 of 220), and undetermined in 8.6% of patients (19 of 220). At the end of follow-up, control had been achieved with a variety of treatment methods in 49.1% of patients (110 of 224), not achieved in 29.9% of patients (67 of 224), and undetermined in 21.0% of patients (47 of 224). Despite multiple treatments, at the end of follow-up, biochemical control was still not achieved in up to 30% of patients. These multicenter data demonstrate that in routine clinical practice, initial and long-term control is not achieved in a substantial number of patients with CD. BLA = bilateral adrenalectomy CD = Cushing disease CS = Cushing syndrome eCRF = electronic case report form MRI = magnetic resonance imaging PCOS = polycystic ovary syndrome.

  17. Observational demonstration of a high image rejection SIS mixer receiver using a new waveguide filter at 230 GHz

    Science.gov (United States)

    Hasegawa, Yutaka; Asayama, Shinichiro; Harada, Ryohei; Tokuda, Kazuki; Kimura, Kimihiro; Ogawa, Hideo; Onishi, Toshikazu

    2017-12-01

    A new sideband separation method was developed for use in millimeter-/submillimeter-band radio receivers using a novel waveguide frequency separation filter (FSF), which consists of two branch line hybrid couplers and two waveguide high-pass filters. The FSF was designed to allow the radio frequency (RF) signal to pass through to an output port when the frequency is higher than a certain value (225 GHz), and to reflect the RF signal back to another output port when the frequency is lower. The FSF is connected to two double sideband superconductor-insulator-superconductor (SIS) mixers, and an image rejection ratio (IRR) is determined by the FSF characteristics. With this new sideband separation method, we can achieve good and stable IRR without the balancing two SIS mixers such as is necessary for conventional sideband-separating SIS mixers. To demonstrate the applicability of this method, we designed and developed an FSF for simultaneous observations of the J = 2-1 rotational transition lines of three CO isotopes (12CO, 13CO, and C18O): the 12CO line is in the upper sideband and the others are in the lower sideband with an intermediate-frequency range of 4-8 GHz at the radio frequency of 220/230 GHz. This FSF was then installed in the receiver system of the 1.85 m radio telescope of Osaka Prefecture University, and was used during the 2014 observation season. The observation results indicate that the IRR of the proposed receiver is 25 dB or higher for the 12CO line, and no significant fluctuation larger than 1 dB in the IRR was observed throughout the season. These results demonstrate the practical utility of the FSF receiver for observations like extensive molecular cloud surveys in specified lines with a fixed frequency setting.

  18. Discriminating assimilants and decoupling deep- vs. shallow-level crystal records at Mount Adams using 238U-230Th disequilibria and Os isotopes

    Science.gov (United States)

    Jicha, B.R.; Johnson, C.M.; Hildreth, Wes; Beard, B.L.; Hart, G.L.; Shirey, S.B.; Singer, B.S.

    2009-01-01

    A suite of 23 basaltic to dacitic lavas erupted over the last 350??kyr from the Mount Adams volcanic field has been analyzed for U-Th isotope compositions to evaluate the roles of mantle versus crustal components during magma genesis. All of the lavas have (230Th/238U) > 1 and span a large range in (230Th/232Th) ratios, and most basalts have higher (230Th/232Th) ratios than andesites and dacites. Several of the lavas contain antecrysts (crystals of pre-existing material), yet internal U-Th mineral isochrons from six of seven lavas are indistinguishable from their eruption ages. This indicates a relatively brief period of time between crystal growth and eruption for most of the phenocrysts (olivine, clinopyroxene, plagioclase, magnetite) prior to eruption. One isochron gave a crystallization age that is ~ 20-25??ka older than its corresponding eruptive age, and is interpreted to reflect mixing of older and juvenile crystals or a protracted period of magma storage in the crust. Much of the eruptive volume since 350??ka consists of lavas that have small to moderate 230Th excesses (2-16%), which are likely inherited from melting of a garnet-bearing intraplate ("OIB-like") mantle source. Following melt generation and subsequent migration through the upper mantle, most Mt. Adams magmas interacted with young, mafic lower crust, as indicated by 187Os/188Os ratios that are substantially more radiogenic than the mantle or those expected via mixing of subducted material and the mantle wedge. Moreover, Os-Th isotope variations suggest that unusually large 230Th excesses (25-48%) and high 187Os/188Os ratios in some peripheral lavas reflect assimilation of small degree partial melts of pre-Quaternary basement that had residual garnet or Al-rich clinopyroxene. Despite the isotopic evidence for lower crustal assimilation, these processes are not generally recorded in the erupted phenocrysts, indicating that the crystal record of the deep-level 'cryptic' processes has been

  19. ORIGINAL ARTICLE 230

    African Journals Online (AJOL)

    boaz

    Table 7 showed that in pregnancy, sodium ion increases (142.75 + 7.26) with malaria parasitaemia while potassium ion (4.55 +. 4.11) Bicarbonate ion (24.76. + 4.30), choride ion (101.51+. 8.16), urea (20.66+ 6.12) and creatinine (2.75 + 1.24) decreases respectively with malaria parasitaemia This was stastically significant.

  20. 230Th and 234Th as coupled tracers of particle cycling in the ocean: A maximum likelihood approach

    Science.gov (United States)

    Wang, Wei-Lei; Armstrong, Robert A.; Cochran, J. Kirk; Heilbrun, Christina

    2016-05-01

    We applied maximum likelihood estimation to measurements of Th isotopes (234,230Th) in Mediterranean Sea sediment traps that separated particles according to settling velocity. This study contains two unique aspects. First, it relies on settling velocities that were measured using sediment traps, rather than on measured particle sizes and an assumed relationship between particle size and sinking velocity. Second, because of the labor and expense involved in obtaining these data, they were obtained at only a few depths, and their analysis required constructing a new type of box-like model, which we refer to as a "two-layer" model, that we then analyzed using likelihood techniques. Likelihood techniques were developed in the 1930s by statisticians, and form the computational core of both Bayesian and non-Bayesian statistics. Their use has recently become very popular in ecology, but they are relatively unknown in geochemistry. Our model was formulated by assuming steady state and first-order reaction kinetics for thorium adsorption and desorption, and for particle aggregation, disaggregation, and remineralization. We adopted a cutoff settling velocity (49 m/d) from Armstrong et al. (2009) to separate particles into fast- and slow-sinking classes. A unique set of parameters with no dependence on prior values was obtained. Adsorption rate constants for both slow- and fast-sinking particles are slightly higher in the upper layer than in the lower layer. Slow-sinking particles have higher adsorption rate constants than fast-sinking particles. Desorption rate constants are higher in the lower layer (slow-sinking particles: 13.17 ± 1.61, fast-sinking particles: 13.96 ± 0.48) than in the upper layer (slow-sinking particles: 7.87 ± 0.60 y-1, fast-sinking particles: 1.81 ± 0.44 y-1). Aggregation rate constants were higher, 1.88 ± 0.04, in the upper layer and just 0.07 ± 0.01 y-1 in the lower layer. Disaggregation rate constants were just 0.30 ± 0.10 y-1 in the upper

  1. In-situ high spatial resolution LA-MC-ICPMS 230Th/U dating enables detection of small-scale age inversions in speleothems

    Directory of Open Access Journals (Sweden)

    Yiming Lin

    2017-03-01

    Full Text Available We present an in-situ method for Th and U isotope measurements by laser ablation multi-collector inductively coupled plasma mass spectrometry (LA-MC-ICPMS to determine possible age inversions of stalagmites, using a 213 nm Nd:YAG laser connected to an MC-ICPMS. Due to the low ion beam intensity of 230Th (20–120 counts per second, cps, we carefully optimized the operating parameters to get highest possible ion beam intensities, i.e., laser fluence (25 J cm−2, spot size (110 μm, pulse repetition rate (20 Hz, scan speed (4 μm s−1, integration time (1000 s, and He and Ar gas flow (∼0.9 L min−1 and ∼0.6 L min−1 respectively. A precision (2 relative standard error, 2RSE of better than 1.8% was obtained for a single 230Th/238U measurement performed on a stalagmite from Hϋttenblӓserschachthöhle, western Germany, having U concentrations of 2–7 μg g−1 and with 230Th beam intensity of less than 100 cps. Compared to previous studies (Hoffmann et al., 2009, this is the about same precision, however at lower U concentrations. The data are corrected and calibrated by two factors (F1 and F2 for 230Th/238U and 234U/238U, respectively, using a carbonate material (flowstone in secular equilibrium. We obtained an age uncertainty (2 SE, 2σ of ca. 9 ka at ca. 215 ka. Most data agree with solution MC-ICPMS results obtained on the same sample within their uncertainties. The reproducibility of the LA-MC-ICPMS age data is within 4.5% (2RSE as determined from 3 to 4 repeated analyses. With a spot size of 110 μm and spatial resolution of about 400 μm or higher, it is possible to see much more details in thin growing layers than conventional solution analysis, where mixed layer sampling cannot be avoided. Potential age inversions in small regions are revealed, which cannot be detected by solution analysis due to the insufficient spatial resolution.

  2. Micromachining and validation of the scanning acoustic microscope spatial resolution and sensitivity calibration block for 20–230 MHz frequency range

    International Nuclear Information System (INIS)

    Tamulevicius, Tomas; Simatonis, Linas; Ulcinas, Orestas; Tamulevicius, Sigitas; Zukauskas, Egidijus; Rekuviene, Regina; Mazeika, Liudas

    2016-01-01

    Scanning acoustic microscopy (SAM) is used as a routine non-destructive test tool for different diagnostic examinations: detection of defects such as microcracks, delamination, disbonding, inclusions, subsurface features in materials such as pores and cracks. SAM can be operated in a wide frequency range from Megahertz to Gigahertz. SAM measurement spatial resolution is diffraction limited by the wavelength of the acoustic wave in particular medium and also depends on individual transducers geometry. Actual SAM spatial resolution can be determined by measuring calibrated lithographically formed microstructures in high acoustic impedance materials. Numerical acoustic signal simulation method, based on the diffraction approach, was employed for the selection of the calibration block pattern geometry and linear dimensions of the elements. Universal calibration block for SAM operating in a 20–230 MHz frequency range was micromachined in high acoustic impedance ceramic substrates. Differently spaced (from 18 to 185 µm) lines of the same width and different widths (from 17 to 113 µm) but similar spacing lines were imposed in alumina ceramics employing one step lithography process, i.e. femtosecond laser ablation. Proposed SAM calibration pattern linear dimensions were characterized employing optical and scanning electron microscopy. Finally the samples were measured with SAM employing different frequency transducers and results were compared with the numerical simulations. It was obtained that resolution of SAM operating with 230 MHz transducer is not worse than 40 µm. (author)

  3. Closure Report for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    D. S. Tobiason

    2001-07-01

    This Closure Report (CR) describes the remediation activities performed and the results of verification sampling conducted at Corrective Action Unit (CAU) 230, Area 22 Sewage Lagoons and CAU 320, Area 22 Desert Rock Airport Strainer Box. The CAU is currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO, 1996). The CAU is located in Area 22 of the Nevada Test Site (NTS) (Figure 1) and consists of the following Corrective Action Sites (CASs): 22-03-01- Sewage Lagoon (CAU 230); and 22-99-01- Strainer Box (CAU 320). Included with CAS 22-99-01 is a buried Imhoff tank and a sludge bed. These CAUs will be collectively referred to in this plan as the Area 22 Sewage Lagoons site. Site characterization activities were done during September 1999. Characterization of the manholes associated with the septic system leading to the Imhoff tank was done during March 2000. The results of the characterization presented in the Corrective Action Decision Document (CADD) indicated that only the sludge bed (CAS 22-99-01) contained constituents of concern (COC) above action levels and required remediation (U.S. Department of Energy, Nevada Operations Office [DOE/NV], 2000a).

  4. Corrosion behavior of Haynes registered 230 registered nickel-based super-alloys for integrated coal gasification combined cycle syngas plants. A plant exposure study

    International Nuclear Information System (INIS)

    Lee, Sungkyu; Lee, Jieun; Kang, Suk-Hwan; Lee, Seung-Jong; Yun, Yongseung; Kim, Min Jung

    2015-01-01

    The corrosion behavior of commercially available Haynes registered 230 registered nickel-based alloy samples was investigated by exposure to coal-gasifying integrated coal gasification combined cycle pilot plant facilities affiliated with the Institute for Advanced Engineering (2.005 MPa and 160-300 C). The morphological and microstructural analyses of the exposed samples were conducted using scanning electron microscopy and energy-dispersive X-ray spectroscopy analysis on the external surface of the recovered corrosion test samples to obtain information of the corrosion scale. These analyses based on the pre- and post-exposure corrosion test samples combined with thermodynamic Ellingham-Pourbaix stability diagrams provided preliminary insight into the mechanism of the observed corrosion behavior prevailing in the piping materials that connected the particulate removal unit and water scrubber of the integrated coal gasification combined cycle pilot plant. Uniform material wastage was observed after 46 hours of operation, and a preliminary corrosion mechanism was suggested: the observed material waste and corrosion behavior of the Haynes registered 230 registered nickel-based alloy samples cut off from the coal syngas integrated coal gasification combined cycle plant were explained by the formation of discontinuous (complex) oxide phases and subsequent chlorine-induced active oxidation under the predominantly reducing environment encountered. This contribution continues the already published studies of the Fe-Ni-Cr-Co alloy Haynes registered 556 registered .

  5. Adsorption of acetic acid on ice studied by ambient-pressure XPS and partial-electron-yield NEXAFS spectroscopy at 230-240 K.

    Science.gov (United States)

    Křepelová, Adéla; Bartels-Rausch, Thorsten; Brown, Matthew A; Bluhm, Hendrik; Ammann, Markus

    2013-01-17

    Ice plays a key role in the environment, and the ice-air interface influences heterogeneous chemical reactions between snowpack or cirrus clouds and the surrounding air. Soluble gases have been suspected to affect the topmost, disordered layer on ice (often referred to as a quasiliquid layer, QLL). Changes are especially expected in the hydrogen-bonding structure of water in the presence of solutes at the ice surface. Here, we used ambient-pressure X-ray photoelectron spectroscopy (XPS) to detect acetic acid at the ice surface at 230-240 K under atmospheric conditions for the first time. Electron-kinetic-energy-dependent C 1s spectra indicate that acetic acid remains confined to the topmost ice surface layers. Spectral analysis provides information about the protonation state of acetate at the ice surface. Surface-sensitive Auger-electron-yield C-edge near-edge X-ray absorption fine structure (NEXAFS) spectra were recorded to probe the molecular state of the adsorbed species. The O-edge NEXAFS spectra show only minor differences between clean ice and ice with adsorbed acetic acid and thus indicate that acetic acid does not lead to an extended disordered layer on the ice surface between 230 and 240 K.

  6. Comparative study of direct and indirect immunofluorescence and of bullous pemphigoid 180 and 230 enzyme-linked immunosorbent assays for diagnosis of bullous pemphigoid.

    Science.gov (United States)

    Sárdy, Miklós; Kostaki, Dimitra; Varga, Rita; Peris, Ketty; Ruzicka, Thomas

    2013-11-01

    Direct immunofluorescence (DIF), indirect immunofluorescence (IIF), and enzyme-linked immunosorbent assay (ELISA) are used for the laboratory diagnosis of bullous pemphigoid (BP). The diagnostic value of DIF and IIF on rabbit and monkey esophagus or human salt-split skin and commercial ELISAs was assessed. This was a single-center retrospective study where 313 patients with BP were compared with 488 control subjects. DIF was the most sensitive test (90.8%) whereas sensitivities for IIF on rabbit esophagus, IIF on monkey esophagus, IIF on salt-split skin, BP180 ELISA, and BP230 ELISA were 76.0%, 73.2%, 73.3%, 72.0%, and 59.0%, respectively. The sensitivity of the serologic tests was 88.8% altogether. The specificities for DIF, IIF on rabbit esophagus, IIF on monkey esophagus, IIF on salt-split skin, BP180 ELISA, and BP230 ELISA were 98%, 96.5%, 97.1%, 100%, 94.1%, and 99.2%, respectively. The retrospective nature of study was a limitation. Correlation of diagnostic data with clinical manifestations or disease course was not possible. In suspected BP, both serologic tests and DIF have to be performed because of a sensitivity issue. Although the ELISAs had a relatively low sensitivity, the serologic tests altogether almost reached the level of sensitivity of DIF. The specificities of all assays were excellent. Copyright © 2013 American Academy of Dermatology, Inc. Published by Mosby, Inc. All rights reserved.

  7. A New Chronology of Late Quaternary Sequences From the Central Arctic Ocean Based on "Extinction Ages" of Their Excesses in 231Pa and 230Th

    Science.gov (United States)

    Hillaire-Marcel, C.; Ghaleb, B.; de Vernal, A.; Maccali, J.; Cuny, K.; Jacobel, A.; Le Duc, C.; McManus, J.

    2017-12-01

    Merging the late Quaternary Arctic paleoceanography into the Earth's global climate history remains challenging due to the lack of robust marine chronostratigraphies. Over ridges notably, low and variable sedimentation rates, scarce biogenic remains ensuing from low productivity and/or poor preservation, and oxygen isotope and paleomagnetic records differing from global stacks represent major impediments. However, as illustrate here based on consistent records from Mendeleev-Alpha and Lomonosov Ridges, disequilibria between U-series isotopes can provide benchmark ages. In such settings, fluxes of the particle-reactive U-daughter isotopes 230Th and 231Pa from the water column, are not unequivocally linked to sedimentation rates, but rather to sea-ice rafting and brine production histories, thus to the development of sea-ice factories over shelves during intervals of high relative sea level. The excesses in 230Th and 231Pa over fractions supported by their parent U-isotopes, collapse down sedimentary sequences, due to radioactive decay, and provide radiometric benchmark ages of approximately 300 and 140 ka, respectively. These "extinction ages" point to mean sedimentation rates of ˜4.3 and ˜1.7 mm/ka, respectively, over the Lomonosov and Mendeleev Ridges, which are significantly lower than assumed in most recent studies, thus highlighting the need for revisiting current interpretations of Arctic lithostratigraphies in relation to the global-scale late Quaternary climatostratigraphy.

  8. Dominance of multidrug-resistant Denmark(14)-32 (ST230) clone among Streptococcus pneumoniae serotype 19A isolates causing pneumococcal disease in Bulgaria from 1992 to 2013.

    Science.gov (United States)

    Setchanova, Lena Petrova; Alexandrova, Alexandra; Dacheva, Daniela; Mitov, Ivan; Kaneva, Radka; Mitev, Vanio

    2015-02-01

    A pneumococcal conjugate vaccine (PCV10) was introduced in Bulgarian national immunization program since April 2010. Clonal composition based on pulsed-field gel electrophoresis and multilocus sequence typing genotyping of 52 serotype 19A Streptococcus pneumoniae isolates was analyzed. These were invasive and respiratory isolates collected between 1992 and 2013 from both children (78.8% clone. The most frequent sequence type (ST) was ST230 (48.1%) and together with four other closely related STs (15.4%), belonging to ST1611, ST276, ST7466, and ST2013, which were single- and double-locus variants; they were included in the main CC230. The disappearance of highly drug-resistant ST663 clone and emergence of new clones as CC320 and CC199 was also observed among the rest 19A isolates. A comparison of clonal composition between invasive and noninvasive isolates did not show a great genetic diversity among both kinds of isolates. Continuous surveillance of serotype 19A population following the introduction of PCV10 is essential to evaluate the impact of the vaccine on the epidemiology of this serotype.

  9. Transfer of {sup 238}U, {sup 230}Th, {sup 226}Ra, and {sup 210}Pb from soils to tree and shrub species in a Mediterranean area

    Energy Technology Data Exchange (ETDEWEB)

    Blanco Rodriguez, P. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain); Vera Tome, F. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain)], E-mail: fvt@unex.es; Lozano, J.C. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain); Laboratorio de Radiaciones Ionizantes, Facultad de Ciencias, Universidad de Salamanca, 37008 Salamanca (Spain); Perez Fernandez, M.A. [Natural Radioactivity Group, Facultad de Ciencias, Universidad de Extremadura, Avda. de Elvas s/n, 06071 Badajoz (Spain); Area de Ecologia, Universidad Pablo Olavide, Carretera de Utrera km. 1, 41013 Sevilla (Spain)

    2010-06-15

    The soil-to-plant transfer factors of natural uranium isotopes ({sup 238}U and {sup 234}U), {sup 230}Th, {sup 226}Ra, and {sup 210}Pb were studied in a disused uranium mine located in the Extremadura region in the south-west of Spain. The plant samples included trees (Quercus ilex, Quercus suber, and Eucalyptus cameldulensis) and one shrub (Cytisus multiflorus). All of them are characteristic of Mediterranean environments. The activity concentrations in leaves and fruit were determined for the tree species at different stages of growth. For the shrub, the total above-ground fraction was considered in three seasons. For old leaves and fruit, the highest activity concentrations were found in Eucalyptus cameldulensis for all the radionuclides studied, except in the case of {sup 230}Th that presented similar activity concentrations in all of the tree species studied. In every case, the transfer to fruit was less than the transfer to leaves. In the shrub, the results depended on the season of sampling, with the highest value obtained in spring and the lowest in autumn. Important correlations were obtained for {sup 238}U and {sup 226}Ra between the activity ratio in soils with that in leaves or fruit.

  10. Positive Direct Immunofluorescence Is of Better Value than ELISA-BP180 and ELISA-BP230 Values for the Prediction of Relapse after Treatment Cessation in Bullous Pemphigoid: A Retrospective Study of 97 Patients.

    Science.gov (United States)

    Ingen-Housz-Oro, Saskia; Plée, Julie; Belmondo, Thibaut; Maizières, Michaël; Pham, Bach-Nga; Hüe, Sophie; Ortonne, Nicolas; Durlach, Anne; Wolkenstein, Pierre; Chosidow, Olivier; Bernard, Philippe

    2015-01-01

    ELISA-BP180 values and direct immunofluorescence (DIF) are prognostic factors for relapse after treatment cessation in bullous pemphigoid (BP). To determine the relevance of ELISA-BP230 antibodies for predicting relapse 6 months after treatment cessation. We retrospectively selected patients with BP and available data from ELISA-BP180 and -BP230 and DIF performed at treatment cessation. The rate of relapse was calculated at 6 months. We compared ELISA-BP180 and -BP230 values and DIF in patients with relapse and remission. We included 97 patients. At 6 months, 25.6% of patients showed relapse. The proportion of patients with an ELISA-BP230 value ≥27 UA/ml was higher, but not significantly, for those with relapse than for those with remission (p = 0.11). The frequency of positive DIF findings was significantly higher for patients with relapse (p = 0.005). DIF is of better value than ELISA-BP180 and -230 tests to predict relapse after treatment cessation in BP. © 2015 S. Karger AG, Basel.

  11. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  12. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  13. Bismuth-213 and actinium-225 -- generator performance and evolving therapeutic applications of two generator-derived alpha-emitting radioisotopes.

    Science.gov (United States)

    Morgenstern, Alfred; Bruchertseifer, Frank; Apostolidis, Christos

    2012-07-01

    The alpha emitters (225)Ac and (213)Bi are promising therapeutic radionuclides for application in targeted alpha therapy of cancer and infectious diseases. Both alpha emitters are available with high specific activity from established radionuclide generators. Their favourable chemical and physical properties have led to the conduction of a large number of preclinical studies and several clinical trials, demonstrating the feasibility, safety and therapeutic efficacy of targeted alpha therapy with (225)Ac and (213)Bi. This review describes methods for the production of (225)Ac and (213)Bi and gives an overview of (225)Ac/(213)Bi radionuclide generator systems. Selected preclinical studies are highlighted and the current clinical experience with (225)Ac and (213)Bi is summarized.

  14. Measurement of the Magnetic Fields from High-Voltage (230 kV Substations in Tehran and Assessment of Their Effects

    Directory of Open Access Journals (Sweden)

    Mahdieh Sharifi Fard

    2010-06-01

    Full Text Available Introduction: Recent industrial developments in human societies have caused rapid advancements in technologies of production and distribution of electricity, which in turn result in enhancement of power networks and utilization of high voltages. These networks and the high voltages in transfer lines cause the exposure to electric and magnetic fields. In this study, the situation regarding the magnetic fields from high-voltage (230 kV substations in Tehran was investigated. Material and Methods: In this study, 8 high-voltage (230 kV substations were selected (Shous, Shahid Firouzi, Ozgol, Kan, Tehranpars, Azadegan, Ghorkhane and Besat substations. The premises of each substation was divided into some stations and measurements were done in each one. Measurements were done according to the IEEE std 644-1994 Standard in a way that the device, specifically its probe, was kept at a height of 1 meter above the ground surface. Then, we tried to examine the probable effects of exposure to magnetic fields through the Essex questionnaire, with Cronbach coefficient of 94%, completed by the employees of the substations. These questionnaires were completed by substation operators as an exposed group (36 persons and the employees of the office section of the Tehran regional electric company as a witness group (32 persons. Results: The measured density in none of the stations exceeded the standard limits of the International Commission on Non-Ionizing Radiation Protection. With regard to the questionnaire results about mental and neurological, cardiac and respiratory, and gastrointestinal and auditory disorders, we observed significant differences between witness and exposed groups, however, regarding skin allergies, there was no significant difference. Conclusion: Among all control rooms, the highest measured magnetic field was 6.9 mG in the Ozgol Substation Control Room and the lowest was 2 mG in the post of Shahid Firouzi. The control room of Ozgol

  15. Synchronizing Greenland ice-core records and the Meerfelder maar sediment record via the global cosmogenic radionuclide signature and insights on climate around 11,230 years BP

    Science.gov (United States)

    Mekhaldi, F.; Czymzik, M.; Brauer, A.; Martin-Puertas, C.; Aldahan, A.; Possnert, G.; Muscheler, R.

    2017-12-01

    The causal investigation of multiple paleoclimate records relies on the accuracy of their respective chronostratigraphy. To achieve relative synchronization, cosmogenic radionuclides are an excellent tool because their common signature is global and can be retrieved and measured in different paleoclimate archives. For instance, 10Be can be measured in both ice cores and lake sediments (Berggren et al., 2013; Czymzik et al., 2016) which allows for both archives to be anchored onto radiocarbon timescales by synchronizing 10Be with 14C. We investigate the period 11,500-11,000 years BP when a short cold climate spell is known, from ice-core proxy records, to have occurred in Greenland shortly after the onset of the Holocene - the Preboreal Oscillation (PBO). This period also coincides with one of the largest and longest-lived increase in 14C production rate during the Holocene, which most likely corresponds to a grand solar minimum (around 11,230-11,000 years BP). In consequence, this period ideally illustrates the potential of using a known and clear signal in the production rate of cosmogenic radionuclides as a synchronizing tool, such as caused by large variations in solar activity. Here we measure 10Be in Meerfelder Maar (a well-dated and widely used sediment record from Germany) around 11,230 years BP which allows us to align the 10Be signal in both the Meerfelder Maar (MFM) sediment record and the GRIP ice core to IntCal13. Doing so, we report that i) the structure of the grand solar minimum is well-preserved in the 10Be signal of MFM sediments, ii) the PBO in Greenland occurs during high levels of solar activity and is not clearly observed in MFM, and iii) the PBO in Greenland ends precisely at the onset of the grand solar minimum at 11,230 years BP which also corresponds to a depositional change in MFM sediments (Martin-Puertas et al., 2017). These results thus suggest that changes in solar activity could have been a forcing at play eventually resulting in the

  16. Dynamics of anti-MSP3 and Pfs230 antibody responses and multiplicity of infection in asymptomatic children from southern Ghana

    DEFF Research Database (Denmark)

    Amoah, Linda E; Acquah, Festus K; Ayanful-Torgby, Ruth

    2018-01-01

    the transmission of malaria to an uninfected person. This study aimed at examining the dynamics of naturally acquired immune responses against the asexual and sexual forms of Plasmodium falciparum as well as assessing differences in the multiplicity of infection (MOI) in asymptomatic Ghanaian children living...... in two communities with varying malaria transmission intensities. METHODS: School children aged between 6 and 12 years were recruited from Obom, a high malaria prevalence setting and Abura, a low malaria prevalence setting and enrolled in monthly multiple cross sectional surveys between February and May...... 2015. Filter paper blood blots (DBS) as well as thick and thin blood smears were made from finger-pricked blood at each visit. Plasmodium falciparum parasite prevalence was determined by microscopy and PCR. Serum eluted from the DBS were used to assess anti-Pfs230 (sexual stage) and anti-MSP3 (asexual...

  17. Implementation of the thermal-hydraulic transient analysis code RELAP4/MOD5 and MOD6 on the FACOM 230/75 computer system

    International Nuclear Information System (INIS)

    Kohsaka, Atsuo; Ishigai, Takahiro; Kumakura, Toshimasa; Naraoka, Ken-itsu

    1979-03-01

    Development efforts have continued on the extensively used LOCA analysis code RELAP-4, as seen in its history; that is, from the prototype version MOD2 to the latest one MOD6 which is capable of one-through calculations from blowdown to reflood phase of PWR-LOCA. Many improvements and refinements of the models have enlarged the scopes and extents of phenomena to treat. Correspondingly the size of program has increased version to version, and special programming techniques have continuously been introduced to manage the program within limited capacity of core memory. For example, the Dynamic Storage Allocation of MOD5 and the PRELOAD Preprocessor newly incorporated in MOD6 are those designed for the CDC computer with relatively small core size. Described are these programming techniques in detail and experiences on implementation of the codes on FACOM 230/75, together with some results of confirmatory calculations. (author)

  18. Two new field measurements for D ampersand D: rapid Th-230 determinations and detection of rad waste in and surrounding sewer or process lines

    International Nuclear Information System (INIS)

    Duray, J.R.

    1988-01-01

    The Technical Measurements Center has developed a rapid thorium-230 field measurement method. The field method is much faster than the conventional practice of sending soil samples to a laboratory for analysis. Including the time to take a soil sample, the method yields a result in about one hour. Miniature gamma-ray and beta detectors have been coupled to a portable scaler through a long, flexible adaptation of a plumber's snake. Both detector assemblies and, in particular the gamma detector, are state-of-the-art in miniaturization and durability. The detector assemblies are small enough to easily pass through a three-inch sewer trap. Future proposed work will add a surface unit to locate the detector in the buried line. Other applications of the gamma unit are logging shallow boreholes and probing for radiometric contamination under slabs instead of drilling through the slab

  19. Environmental Assessment and Finding of No Significant Impact: Curecanti-Lost Canyon 230-kV Transmission Line Reroute Project, Montrose County, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2000-03-20

    The Department of Energy (DOE), Western Area Power Administration (Western) is proposing to reroute a section of the Curecanti-Lost Canyon 230-kilovolt (kV) transmission line, in Montrose County, Colorado. A portion of the transmission line, situated 11 miles southeast of Montrose, Colorado, crosses Waterdog Peak, an area of significant geologic surface activity, which is causing the transmission line's lattice steel towers to shift. This increases stress to structure hardware and conductors, and poses a threat to the integrity of the transmission system. Western proposes to relocate the lattice steel towers and line to a more geologically stable area. The existing section of transmission line and the proposed relocation route cross Bureau of Land Management and private land holdings.

  20. Clinical presentation, natural history, and cumulative death rates of 230 adults with primary cryptococcal meningitis in Zambian AIDS patients treated under local conditions.

    Science.gov (United States)

    Mwaba, P; Mwansa, J; Chintu, C; Pobee, J; Scarborough, M; Portsmouth, S; Zumla, A

    2001-12-01

    Inpatient medical wards, Department of Medicine, University Teaching Hospital, Lusaka, Zambia. To define the natural history, clinical presentation, and management outcome of microbiologically confirmed cryptococcal meningitis in adult AIDS patients treated under local conditions where antifungal and antiretroviral therapies are not routinely available. A descriptive, longitudinal, observational study. All adult patients admitted to the medical wards of the University Teaching Hospital, Lusaka, Zambia with cerebrospinal fluid culture proved, primary cryptococcal meningitis, during a 12 month period were enrolled into the study. The following details were acquired: clinical features, HIV status, laboratory data, treatment accorded, and survival. A total of 230 patients with primary cryptococcal meningitis were studied (median age 32 years; range 15-65 years; 112 males, 118 females). Cryptococcal meningitis was the first AIDS defining illness in 210 (91%) patients. One hundred and thirty of the 230 (56%) patients had received treatment with fluconazole monotherapy and 100 (43%) patients received palliative care only without any antifungal therapy. A 100% case fatality rate was observed in both groups at follow up: by seven weeks in the untreated group and at six months in the fluconazole treated group. The cumulative median survival from time of diagnosis was 19 days (range 1-164 days) for the fluconazole treated group and 10 days (range 0-42 days) for the untreated group. Cryptococcal meningitis, under current treatment accorded at the University Teaching Hospital, Lusaka, has a 100% mortality in young Zambian adults with AIDS. The current treatment accorded to Zambian adults with cryptococcal meningitis is inappropriate. An urgent need exists to improve strategies for the clinical management of AIDS patients in poor African countries. The wider ethical and operational issues of making available antifungals to African AIDS patients are discussed.

  1. Origin of the {sup 238}U-{sup 230}Th disequilibrium in magmas from subduction zones: the Arenal example; Origine du desequilibre {sup 238}U-{sup 230}TH dans les magmas des zones de subduction: exemple de l`Arenal

    Energy Technology Data Exchange (ETDEWEB)

    Villemant, B. [Paris-6 Univ., 75 (France)

    1996-12-31

    The existence in some volcanic products of strong excess of {sup 238}U with respect to {sup 230}Th is one of the characteristics of volcanic arc magmas. These excesses are generally attributed to fluid additions inside mantellic sources before magma segregation, differentiation and eruption. These fluids should be linked to the dehydration of the subducted rocks. These hypotheses are essentially based on correlations between {sup 10}Be, {sup 87}Sr anomalies, Ba/La ratios and on the distribution of volcanic centers with respect to the subduction zone. Recent studies suggest an evolution of the composition of volcanic sources in Central America from a depleted mantle type (MORB) in the North (Nicaragua) to a less transformed enriched type (OIB) in the South (Costa Rica). The Arenal volcano belongs to a transition zone between these two types. The preliminary study of trace elements and {sup 238}U-{sup 230}Th disequilibria in recent volcanic products (1968-1993) indicates a more complex situation. At least two different mantle sources were successively involved characterized by different Th/La and La/Yb ratios and very different to the OIB type. Also most lavas are in equilibrium with {sup 238}U/{sup 232}Th ratios of about 1.2 to 1.3. However, in eruptive cycle, some lavas are characterized by a strong {sup 238}U excess with respect to {sup 230}Th with cannot be linked to the sources, even when modified by fluids in depth. These results are interpreted in terms of heterogeneities of mantle sources and low depths late interactions with hydrothermal fluids during eruptions. Abstract only. (J.S.). 2 refs.

  2. Determination {sup 230}Th by ICP-MS for the control of activities of restoration of an area of land contaminated with uranium mining sterile; Determinacion de {sup 230}Th mediante ICP-MS durante el control de las actividades de restauracion de un area de terreno contaminada con esteriles de mineria de uranio

    Energy Technology Data Exchange (ETDEWEB)

    Yague, L.; Conde, E.; Navarro, N.; Fernandez, M.; Ortiz, M. I.; Noguerales, C.; Gasco, C.

    2013-07-01

    In 2012, within the activities for the Project PIMIC (CIEMAT) took out the first stage of restoration of a contaminated area. This is an area which had a residual contamination due to burial tailings uranium mining. The activities have been: elimination of the arboreal mass, excavation of the ground and earthmoving. The methodology applied is described in this work and is based on the combination of gamma spectrometry technique and development of a method of analysis {sup 230}Th by ICP-MS. (Author)

  3. Antibody responses to two new Lactococcus lactis-produced recombinant Pfs48/45 and Pfs230 proteins increase with age in malaria patients living in the Central Region of Ghana.

    Science.gov (United States)

    Acquah, Festus K; Obboh, Evans K; Asare, Kwame; Boampong, Johnson N; Nuvor, Samuel Victor; Singh, Susheel K; Theisen, Michael; Williamson, Kim C; Amoah, Linda Eva

    2017-08-01

    Recent advances in malaria control efforts have led to an increased number of national malaria control programmes implementing pre-elimination measures and demonstrated the need to develop new tools to track and control malaria transmission. Key to understanding transmission is monitoring the prevalence and immune response against the sexual stages of the parasite, known as gametocytes, which are responsible for transmission. Sexual-stage specific antigens, Pfs230 and Pfs48/45, have been identified and shown to be targets for transmission blocking antibodies, but they have been difficult to produce recombinantly in the absence of a fusion partner. Regions of Pfs48/45 and Pfs230 known to contain transmission blocking epitopes, 6C and C0, respectively, were produced in a Lactococcus lactis expression system and used in enzyme linked immunosorbent assays to determine the seroreactivity of 95 malaria patients living in the Central Region of Ghana. Pfs48/45.6C and Pfs230.C0 were successfully produced in L. lactis in the absence of a fusion partner using a simplified purification scheme. Seroprevalence for L. lactis-produced Pfs48/45.6C and Pfs230.C0 in the study population was 74.7 and 72.8%, respectively. A significant age-dependent increase in antibody titers was observed, which suggests a vaccine targeting these antigens could be boosted during a natural infection in the field.

  4. Distinguishing lower and upper crustal processes in magmas erupted during the buildup to the 7.7 ka climactic eruption of Mount Mazama, Crater Lake, Oregon, using 238U-230Th disequilibria

    Science.gov (United States)

    Ankney, Meagan E.; Johnson, Clark M.; Bacon, Charles R.; Beard, Brian L.; Jicha, Brian R.

    2013-08-01

    Uranium-series isotope ratios determined for 35 volcanic rocks and 4 glass separates erupted from ~36 to 4.8 ka at Mt. Mazama, Crater Lake, Oregon, identify both 230Th-excess and 238U-excess components. U-Th isotope compositions cover a wide range, exceeding those previously measured for the Cascade arc. Age-corrected (230Th/232Th) and (238U/232Th) activity ratios range from 1.113 to 1.464 and from 0.878 to 1.572 (44.4 % 230Th-excess to 8.8 % 238U-excess), respectively. The most distinctive aspect of the data set is the contrast in U-Th isotope ratios between low and high Sr (LSr, HSr) components that have been previously identified in products of the 7.7 ka caldera-forming climactic eruption and preclimactic rhyodacite lavas. The LSr component exclusively contains 238U-excess, but the HSr component, as well as more primitive lavas, are marked by 230Th-excess. 230Th-excesses such as those recorded at Mt. Mazama are commonly observed in the Cascades. Melting models suggest that high 230Th-excesses observed in the more primitive lavas evolved through mixing of a mantle melt with a partial melt of a mafic lower crustal composition that contained garnet in the residuum that was produced through dehydration melting of amphibolite that was initially garnet free. Dehydration melting in the lower crust offers a solution to the "hot-slab paradox" of the Cascades, where low volatile contents are predicted due to high slab temperatures, yet higher water contents than expected have been documented in erupted lavas. The 238U-excess observed at Mt. Mazama is rare in Cascade lavas, but occurs in more than half of the samples analyzed in this study. Traditionally, 238U-excess in arc magmas is interpreted to reflect slab fluid fluxing. Indeed, 238U-excess in arcs is common and likely masks 230Th-excess resulting from lower crustal interaction. Isotopic and trace element data, however, suggest a relatively minor role for slab fluid fluxing in the Cascades. We propose that 238U

  5. 238U–230Th–226Ra–210Pb–210Po disequilibria constraints on magma generation, ascent, and degassing during the ongoing eruption of Kīlauea

    Science.gov (United States)

    Girard, Guillaume; Reagan, Mark K.; Sims, Kenneth W. W.; Thornber, Carl; Waters, Christopher L.; Phillips, Erin H.

    2017-01-01

    The timescales of magma genesis, ascent, storage and degassing at Kīlauea volcano, Hawai‘i are addressed by measuring 238U-series radionuclide abundances in lava and tephra erupted between 1982 and 2008. Most analyzed samples represent lavas erupted by steady effusion from Pu‘u ‘Ō‘ō and Kūpahianaha from 1983 to 2008. Also included are samples erupted at the summit in April 1982 and March 2008, along the East Rift Zone at the onset of the ongoing eruption in January 1983, and during vent shifting episodes 54 and 56, at Nāpau crater in January 1997, and Kane Nui O Hamo in June 2007. In general, samples have small (∼4%) excesses of (230Th) over (238U) and ∼3 to ∼17% excesses of (226Ra) over (230Th), consistent with melting of a garnet peridotite source at melting rates between 1 × 10–3 and 5 × 10–3 kg m–3 a–1, and melting region porosity between ∼2 and ∼10%, in agreement with previous studies of the ongoing eruption and historical eruptions. A small subset of samples has near-equilibrium (230Th/238U) values, and thus were generated at higher melting rates. Based on U–Th–Ra disequilibria and Th isotopic data from this and earlier studies, melting processes and sources have been relatively stable over at least the past two centuries or more, including during the ongoing unusually long (>30 years) and voluminous (4 km3) eruption. Lavas recently erupted from the East Rift Zone have average initial (210Pb/226Ra) values of 0·80 ± 0·11 (1σ), which we interpret to be the result of partitioning of 222Rn into a persistently generated CO2-rich gas phase over a minimum of 8 years. This (210Pb) deficit implies an average magma ascent rate of ≤3·7 km a–1 from ∼30 km depth to the surface. Spatter and lava associated with vent-opening episodes erupt with variable (210Pb) deficits ranging from 0·7 to near-equilibrium values in some samples. The samples with near-equilibrium (210Pb/226Ra) are typically more

  6. Clinical presentation, natural history, and cumulative death rates of 230 adults with primary cryptococcal meningitis in Zambian AIDS patients treated under local conditions

    Science.gov (United States)

    Mwaba, P; Mwansa, J; Chintu, C; Pobee, J; Scarborough, M; Portsmouth, S; Zumla, A

    2001-01-01

    SETTING—Inpatient medical wards, Department of Medicine, University Teaching Hospital, Lusaka, Zambia.
OBJECTIVE—To define the natural history, clinical presentation, and management outcome of microbiologically confirmed cryptococcal meningitis in adult AIDS patients treated under local conditions where antifungal and antiretroviral therapies are not routinely available.
DESIGN—A descriptive, longitudinal, observational study.
METHODS—All adult patients admitted to the medical wards of the University Teaching Hospital, Lusaka, Zambia with cerebrospinal fluid culture proved, primary cryptococcal meningitis, during a 12 month period were enrolled into the study. The following details were acquired: clinical features, HIV status, laboratory data, treatment accorded, and survival.
RESULTS—A total of 230 patients with primary cryptococcal meningitis were studied (median age 32 years; range 15-65 years; 112 males, 118 females). Cryptococcal meningitis was the first AIDS defining illness in 210 (91%) patients. One hundred and thirty of the 230 (56%) patients had received treatment with fluconazole monotherapy and 100 (43%) patients received palliative care only without any antifungal therapy. A 100% case fatality rate was observed in both groups at follow up: by seven weeks in the untreated group and at six months in the fluconazole treated group. The cumulative median survival from time of diagnosis was 19 days (range 1-164 days) for the fluconazole treated group and 10 days (range 0-42 days) for the untreated group.
CONCLUSION—Cryptococcal meningitis, under current treatment accorded at the University Teaching Hospital, Lusaka, has a 100% mortality in young Zambian adults with AIDS. The current treatment accorded to Zambian adults with cryptococcal meningitis is inappropriate. An urgent need exists to improve strategies for the clinical management of AIDS patients in poor African countries. The wider ethical and operational issues of

  7. The 230Th correction is the 1st priority for accurate dates of young zircons: U/Th partitioning experiments and measurements

    Science.gov (United States)

    Krawczynski, M.; McLean, N.

    2017-12-01

    One of the most accurate and useful ways of determining the age of rocks that formed more than about 500,000 years ago is uranium-lead (U-Pb) geochronology. Earth scientists use U-Pb geochronology to put together the geologic history of entire regions and of specific events, like the mass extinction of all non-avian dinosaurs about 66 million years ago or the catastrophic eruptions of supervolcanoes like the one currently centered at Yellowstone. The mineral zircon is often utilized because it is abundant, durable, and readily incorporates uranium into its crystal structure. But it excludes thorium, whose isotope 230Th is part of the naturally occurring isotopic decay chain from 238U to 206Pb. Calculating a date from the relative abundances of 206Pb and 238U therefore requires a correction for the missing 230Th. Existing experimental and observational constraints on the way U and Th behave when zircon crystallizes from a melt are not known precisely enough, and thus currently the uncertainty in dates introduced by they `Th correction' is one of the largest sources of systematic error in determining dates. Here we present preliminary results on our study of actinide partitioning between zircon and melt. Experiments have been conducted to grow zircon from melts doped with U and Th that mimic natural magmas at a range of temperatures, and compositions. Synthetic zircons are separated from their coexisting glass and using high precision and high-spatial-resolution techniques, the abundance and distribution of U and Th in each phase is determined. These preliminary experiments are the beginning of a study that will result in precise determination of the zircon/melt uranium and thorium partition coefficients under a wide variety of naturally occurring conditions. This data will be fit to a multidimensional surface using maximum likelihood regression techniques, so that the ratio of partition coefficients can be calculated for any set of known parameters. The results of

  8. Flank eruptions of Mt Etna during the Greek-Roman and Early Medieval periods: New data from 226Ra-230Th dating and archaeomagnetism

    Science.gov (United States)

    Branca, Stefano; Condomines, Michel; Tanguy, Jean-Claude

    2015-10-01

    In this paper, we present new data from 226Ra-230Th dating and archaeomagnetism with the aim of improving the knowledge of the flank eruptions that occurred at Mt Etna during the Greek-Roman and Early Medieval periods, as defined in the new geological map of the volcano. The combination of the two dating techniques demonstrates that three major flank eruptions occurred on the lower north and west flanks during Greek-Roman epochs, producing large scoria cones and extensive lava flows. In particular, the Mt Ruvolo and Mt Minardo events highly impacted the territory of the west flank, notably by damming the Simeto River. The new data of the Millicucco and Due Monti lava flows, on the lower north-east flank, indicate a younger age than their stratigraphic ages quoted in the 2011 geological map, since they occurred around 700 and 500 AD, respectively. None of the large flank eruptions occurring on the lower slopes of Etna during the Early Medieval age are reported in the historical sources. Overall, our paper shows that a comprehensive assessment of eruptions at Mount Etna in the last three millennia can only be achieved through a multidisciplinary approach.

  9. High-resolution tephrochronology of the Wilson Creek Formation (Mono Lake, California) and Laschamp event using 238U-230Th SIMS dating of accessory mineral rims

    Science.gov (United States)

    Vazquez, Jorge A.; Lidzbarski, Marsha I.

    2012-01-01

    Sediments of the Wilson Creek Formation surrounding Mono Lake preserve a high-resolution archive of glacial and pluvial responses along the eastern Sierra Nevada due to late Pleistocene climate change. An absolute chronology for the Wilson Creek stratigraphy is critical for correlating the paleoclimate record to other archives in the western U.S. and the North Atlantic region. However, multiple attempts to date the Wilson Creek stratigraphy using carbonates and tephras yield discordant results due to open-system effects and radiocarbon reservoir uncertainties as well as abundant xenocrysts. New ion microprobe 238U-230Th dating of the final increments of crystallization recorded by allanite and zircon autocrysts from juvenile pyroclasts yield ages that effectively date eruption of key tephra beds and delimit the timing of basal Wilson Creek sedimentation to the interval between 26.8±2.1 and 61.7±1.9 ka. Tephra (Ash 15) erupted during the geomagnetic excursion originally designated the Mono Lake excursion yields an age of 40.8±1.9 ka, indicating that the event is instead the Laschamp excursion. The new ages support a depositional chronology from magnetostratigraphy that indicates quasi-synchronous glacial and hydrologic responses in the Sierra Nevada and Mono Basin to regional climate change, with intervals of lake filling and glacial-snowpack melting that are in phase with peaks in spring insolation.

  10. Determination of {sup 2}30Th (Ionium) in uranium ores and wastes from uranium reprocessing. IV. Calculation of ionium separation yield; Determinacion de {sup 2}39Th (Ionio) en minerales y residuos del procesado de Uranio. IV: Determinacion del rendimiento en la separacion del {sup 2}30 Th

    Energy Technology Data Exchange (ETDEWEB)

    Galiano Sedano, J. A.; Acena Barrenechea, M. L.

    1974-07-01

    For determining ionium ({sup 2}30Th) in minerals and uranium processing wastes by precipitation with fluorhidric acid, using lanthanum as carrier, and selective extraction with tenoytrifluoroacetone (TTA) followed by radiometric determination of the isolated nuclide, it is necessary the use of a tracer since the chemical yield of the separation ranges between wide limits. In this paper, the use of the beta-emitter {sup 2}34Th as the most convenient tracer is discussed. Equations are derived for correcting for counting errors introduced by other thorium isotopes which are present either in the sample or in the tracer, as well as for calculating the chemical yield of the separation. These equations have been experimentally checked by ionium determinations carried out with different types of samples. (Author) 18 refs.

  11. Development of sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 and its application in mineral waters

    International Nuclear Information System (INIS)

    Costa Lauria, D. da.

    1986-01-01

    A sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 in environmental samples and applied to the analysis of mineral waters is studied. Thorium isotopes are coprecipitated with lanthanium fluoride before counting in alpha spectrometer, the uranium isotopes are determined by alpha spectrometry following extraction with TOPO onto a polymenic membrane. Radium-226 is determined with the radom emanation technique. (M.J.C.) [pt

  12. Structure and optical function of amorphous photonic nanostructures from avian feather barbs: a comparative small angle X-ray scattering (SAXS) analysis of 230 bird species.

    Science.gov (United States)

    Saranathan, Vinodkumar; Forster, Jason D; Noh, Heeso; Liew, Seng-Fatt; Mochrie, Simon G J; Cao, Hui; Dufresne, Eric R; Prum, Richard O

    2012-10-07

    Non-iridescent structural colours of feathers are a diverse and an important part of the phenotype of many birds. These colours are generally produced by three-dimensional, amorphous (or quasi-ordered) spongy β-keratin and air nanostructures found in the medullary cells of feather barbs. Two main classes of three-dimensional barb nanostructures are known, characterized by a tortuous network of air channels or a close packing of spheroidal air cavities. Using synchrotron small angle X-ray scattering (SAXS) and optical spectrophotometry, we characterized the nanostructure and optical function of 297 distinctly coloured feathers from 230 species belonging to 163 genera in 51 avian families. The SAXS data provided quantitative diagnoses of the channel- and sphere-type nanostructures, and confirmed the presence of a predominant, isotropic length scale of variation in refractive index that produces strong reinforcement of a narrow band of scattered wavelengths. The SAXS structural data identified a new class of rudimentary or weakly nanostructured feathers responsible for slate-grey, and blue-grey structural colours. SAXS structural data provided good predictions of the single-scattering peak of the optical reflectance of the feathers. The SAXS structural measurements of channel- and sphere-type nanostructures are also similar to experimental scattering data from synthetic soft matter systems that self-assemble by phase separation. These results further support the hypothesis that colour-producing protein and air nanostructures in feather barbs are probably self-assembled by arrested phase separation of polymerizing β-keratin from the cytoplasm of medullary cells. Such avian amorphous photonic nanostructures with isotropic optical properties may provide biomimetic inspiration for photonic technology.

  13. Lung volume quantified by MRI reflects extracellular-matrix deposition and altered pulmonary function in bleomycin models of fibrosis: effects of SOM230.

    Science.gov (United States)

    Egger, Christine; Gérard, Christelle; Vidotto, Nella; Accart, Nathalie; Cannet, Catherine; Dunbar, Andrew; Tigani, Bruno; Piaia, Alessandro; Jarai, Gabor; Jarman, Elizabeth; Schmid, Herbert A; Beckmann, Nicolau

    2014-06-15

    Idiopathic pulmonary fibrosis is a progressive and lethal disease, characterized by loss of lung elasticity and alveolar surface area, secondary to alveolar epithelial cell injury, reactive inflammation, proliferation of fibroblasts, and deposition of extracellular matrix. The effects of oropharyngeal aspiration of bleomycin in Sprague-Dawley rats and C57BL/6 mice, as well as of intratracheal administration of ovalbumin to actively sensitized Brown Norway rats on total lung volume as assessed noninvasively by magnetic resonance imaging (MRI) were investigated here. Lung injury and volume were quantified by using nongated or respiratory-gated MRI acquisitions [ultrashort echo time (UTE) or gradient-echo techniques]. Lung function of bleomycin-challenged rats was examined additionally using a flexiVent system. Postmortem analyses included histology of collagen and hydroxyproline assays. Bleomycin induced an increase of MRI-assessed total lung volume, lung dry and wet weights, and hydroxyproline content as well as collagen amount. In bleomycin-treated rats, gated MRI showed an increased volume of the lung in the inspiratory and expiratory phases of the respiratory cycle and a temporary decrease of tidal volume. Decreased dynamic lung compliance was found in bleomycin-challenged rats. Bleomycin-induced increase of MRI-detected lung volume was consistent with tissue deposition during fibrotic processes resulting in decreased lung elasticity, whereas influences by edema or emphysema could be excluded. In ovalbumin-challenged rats, total lung volume quantified by MRI remained unchanged. The somatostatin analog, SOM230, was shown to have therapeutic effects on established bleomycin-induced fibrosis in rats. This work suggests MRI-detected total lung volume as readout for tissue-deposition in small rodent bleomycin models of pulmonary fibrosis. Copyright © 2014 the American Physiological Society.

  14. Hydrography, HydroLabels-The data set is a text feature containing labels of all hydro features. It consists of more than 230 text nodes of the hydro_line and hydro_poly features for display purposes., Published in 2005, Davis County Government.

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Hydrography dataset current as of 2005. HydroLabels-The data set is a text feature containing labels of all hydro features. It consists of more than 230 text nodes...

  15. 17 CFR 230.800 - Definitions for §§ 230.800, 230.801 and 230.802.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 Exemptions for Cross-Border... gives the holder the option of buying or selling a security but does not require the holder to do so. (c...

  16. 40_ _230 - 233__Hassan _Structural

    African Journals Online (AJOL)

    User

    (O) atoms surround each smaller silicon (Si) atom. The silicon atoms occupy the openings (interstitials) between the oxygen atoms and share four valence electrons with the oxygen atoms through covalent bonding (Konesni, 2010). The silicate structures can link together by sharing the atoms in two corners of the SiO2, ...

  17. A microsatellite-based consensus linkage map for species of Eucalyptus and a novel set of 230 microsatellite markers for the genus

    Directory of Open Access Journals (Sweden)

    Williams Emlyn R

    2006-09-01

    Full Text Available Abstract Background Eucalypts are the most widely planted hardwood trees in the world occupying globally more than 18 million hectares as an important source of carbon neutral renewable energy and raw material for pulp, paper and solid wood. Quantitative Trait Loci (QTLs in Eucalyptus have been localized on pedigree-specific RAPD or AFLP maps seriously limiting the value of such QTL mapping efforts for molecular breeding. The availability of a genus-wide genetic map with transferable microsatellite markers has become a must for the effective advancement of genomic undertakings. This report describes the development of a novel set of 230 EMBRA microsatellites, the construction of the first comprehensive microsatellite-based consensus linkage map for Eucalyptus and the consolidation of existing linkage information for other microsatellites and candidate genes mapped in other species of the genus. Results The consensus map covers ~90% of the recombining genome of Eucalyptus, involves 234 mapped EMBRA loci on 11 linkage groups, an observed length of 1,568 cM and a mean distance between markers of 8.4 cM. A compilation of all microsatellite linkage information published in Eucalyptus allowed us to establish the homology among linkage groups between this consensus map and other maps published for E. globulus. Comparative mapping analyses also resulted in the linkage group assignment of other 41 microsatellites derived from other Eucalyptus species as well as candidate genes and QTLs for wood and flowering traits published in the literature. This report significantly increases the availability of microsatellite markers and mapping information for species of Eucalyptus and corroborates the high conservation of microsatellite flanking sequences and locus ordering between species of the genus. Conclusion This work represents an important step forward for Eucalyptus comparative genomics, opening stimulating perspectives for evolutionary studies and

  18. Geophysical Investigation using Two Dimensional Electrical Resistivity Tomography method to delineate Subsurface Geological Structures at Dudhkoshi-II (230 MW) Hydroelectric Project, Solukhumbu District, Eastern Nepal

    Science.gov (United States)

    Ghimire, H.; Bhusal, U. C.; Khatiwada, B.; Pandey, D.

    2017-12-01

    Geophysical investigation using two dimensional electrical resistivity tomography (2D-ERT) method plays a significant role in determining the subsurface resistivity distribution by making measurement on the ground surface. This method was carried out at Dudhkoshi-II (230 MW) Hydroelectric Project, lies on Lesser Himalayan region of the Eastern Nepal to delineate the nature of the subsurface geology to assess its suitability for the construction of dam, desanding basin and powerhouse. The main objective of the proposed study consists of mapping vertical as well as horizontal variations of electrical resistivity to enable detection of the boundaries between unconsolidated materials and rocks of the different resistivity, possible geologic structures, such as possible presence of faults, fractures, and voids in intake and powerhouse area. For this purpose, the (WDJD-4 Multi-function Digital DC Resistivity/IP) equipment was used with Wenner array (60 electrodes). To fulfill these objectives of the study, the site area was mapped by Nine ERT profiles with different profile length and space between electrodes was 5 m. The depth of the investigation was 50 m. The acquired data were inverted to tomogram sections using tomographic inversion with RES2DINV commercial software. The Tomography sections show that the subsurface is classified into distinct geo-electric layers of dry unconsolidated overburden, saturated overburden, fractured rock and fresh bedrock of phyllites with quartzite and gneiss with different resistivity values. There were no voids and faults in the study area. Thickness of overburden at different region found to be different. Most of the survey area has bedrock of phyllites with quartzite; gneiss is also present in some location at intake area. Bedrock is found at the varies depth of 5-8 m at dam axis, 20-32 m at desanding basin and 3-10 m at powerhouse area. These results are confirmed and verified by using several boreholes data were drilled on the

  19. Eruption and magma crystallization ages of Las Tres Vírgenes (Baja California) constrained by combined 230Th/ 238U and (U-Th)/He dating of zircon

    Science.gov (United States)

    Schmitt, Axel K.; Stockli, Daniel F.; Hausback, Brian P.

    2006-11-01

    Las Tres Vírgenes volcano is a calc-alkaline composite cone located near the main Gulf of California escarpment on the E coast of the Baja California peninsula. High-sensitivity ion microprobe U-series ( 230Th/ 238U) ages for zircon from La Vírgen tephra average 121 - 10 + 12 ka (1σ; MSWD = 2.7), with discrete age peaks at ˜ 100 and 160 ka. The noble gas mass spectrometric (U-Th)/He zircon age, corrected for disequilibrium and pre-eruptive storage, is 36 ± 3 ka. This result for the eruption age of La Vírgen tephra is significantly older than previously postulated historic or Holocene ages that were based on an 18th century map reference and 14C dating of accidental charcoal, respectively. The new (U-Th)/He zircon age is consistent with a > 26 ± 4 ka age derived from cosmogenic He exposure dating of an overlying basaltic lava flow [Hausback, B.P. and Abrams, M.J., 1996. Plinian eruption of La Virgen Tephra, Volcán Las Tres Virgenes, Baja California Sur, Mexico. Eos, Transactions, American Geophysical Union, 77(46, Suppl.): 813-814.]. U-Pb zircon analysis of ignimbrites erupted from the adjacent Early Pleistocene La Reforma and El Aguajito calderas yielded ages of 1.38 ± 0.03 Ma ( n = 12; MSWD = 1.0) and 1.17 ± 0.07 Ma ( n = 23; MSWD = 1.3), respectively. No evidence for these ages is found among La Vírgen zircons, whereas pre-Quaternary zircon xenocrysts are common. The La Vírgen magma, therefore, evolved unrelated to Early Pleistocene magmatism in adjacent calderas, but assimilated local basement rocks. A gap between average Th-U and (U-Th)/He zircon ages suggests that zircon crystallization was discontinuous in the La Vírgen magma chamber. In addition, partial resorption of zircon suggests episodic thermal rejuvenation, most likely by basaltic recharge. Based on the zircon record, the > 100 ka lifetime of the thermal anomaly that sustained repeated intrusive pulses significantly exceeds the age of the last eruption. This strengthens the view that Tres

  20. Corrective Action Investigation Plan for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    1999-01-01

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, Nevada Operation Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 230/320 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 230 consists of Corrective Action Site (CAS) 22-03-01, Sewage Lagoon; while CAU 320 consists of CAS 22-99-01, Strainer Box. These CAUs are referred to as CAU 230/320 or the Sewage Lagoons Site. The Sewage Lagoons Site also includes an Imhoff tank, sludge bed, and associated buried sewer piping. Located in Area 22, the site was used between 1951 to 1958 for disposal of sanitary sewage effluent from the historic Camp Desert Rock Facility at the Nevada Test Site in Nevada. Based on site history, the contaminants of potential concern include volatile organic compounds (VOCs), semivolatile organic compounds, total petroleum hydrocarbons (TPH), and radionuclides. Vertical migration is estimated to be less than 12 feet below ground surface, and lateral migration is limited to the soil immediately adjacent to or within areas of concern. The proposed investigation will involve a combination of field screening for VOCs and TPH using the direct-push method and excavation using a backhoe to gather soil samples for analysis. Gamma spectroscopy will also be conducted for waste management purposes. Sampling locations will be biased to suspected worst-case areas including the nearby sludge bed, sewage lagoon inlet(s) and outlet(s), disturbed soil surrounding the lagoons, surface drainage channel south of the lagoons, and the area near the Imhoff tank. The results of this field investigation will support a defensible evaluation of corrective action alternatives in the corrective action decision document

  1. Corrective Action Investigation Plan for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Air port Strainer Box, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Nevada Operations Office

    1999-06-10

    This Corrective Action Investigation Plan contains the US Department of Energy, Nevada Operation Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 230/320 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 230 consists of Corrective Action Site (CAS) 22-03-01, Sewage Lagoon; while CAU 320 consists of CAS 22-99-01, Strainer Box. These CAUs are referred to as CAU 230/320 or the Sewage Lagoons Site. The Sewage Lagoons Site also includes an Imhoff tank, sludge bed, and associated buried sewer piping. Located in Area 22, the site was used between 1951 to 1958 for disposal of sanitary sewage effluent from the historic Camp Desert Rock Facility at the Nevada Test Site in Nevada. Based on site history, the contaminants of potential concern include volatile organic compounds (VOCs), semivolatile organic compounds, total petroleum hydrocarbons (TPH), and radionuclides. Vertical migration is estimated to be less than 12 feet below ground surface, and lateral migration is limited to the soil immediately adjacent to or within areas of concern. The proposed investigation will involve a combination of field screening for VOCs and TPH using the direct-push method and excavation using a backhoe to gather soil samples for analysis. Gamma spectroscopy will also be conducted for waste management purposes. Sampling locations will be biased to suspected worst-case areas including the nearby sludge bed, sewage lagoon inlet(s) and outlet(s), disturbed soil surrounding the lagoons, surface drainage channel south of the lagoons, and the area near the Imhoff tank. The results of this field investigation will support a defensible evaluation of corrective action alternatives in the corrective action decision document.

  2. Corrective Action Investigation Plan for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    US DOE/Nevada Operations Office

    1999-06-10

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, Nevada Operation Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 230/320 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 230 consists of Corrective Action Site (CAS) 22-03-01, Sewage Lagoon; while CAU 320 consists of CAS 22-99-01, Strainer Box. These CAUs are referred to as CAU 230/320 or the Sewage Lagoons Site. The Sewage Lagoons Site also includes an Imhoff tank, sludge bed, and associated buried sewer piping. Located in Area 22, the site was used between 1951 to 1958 for disposal of sanitary sewage effluent from the historic Camp Desert Rock Facility at the Nevada Test Site in Nevada. Based on site history, the contaminants of potential concern include volatile organic compounds (VOCs), semivolatile organic compounds, total petroleum hydrocarbons (TPH), and radionuclides. Vertical migration is estimated to be less than 12 feet below ground surface, and lateral migration is limited to the soil immediately adjacent to or within areas of concern. The proposed investigation will involve a combination of field screening for VOCs and TPH using the direct-push method and excavation using a backhoe to gather soil samples for analysis. Gamma spectroscopy will also be conducted for waste management purposes. Sampling locations will be biased to suspected worst-case areas including the nearby sludge bed, sewage lagoon inlet(s) and outlet(s), disturbed soil surrounding the lagoons, surface drainage channel south of the lagoons, and the area near the Imhoff tank. The results of this field investigation will support a defensible evaluation of corrective action alternatives in the corrective action decision document.

  3. Corrective Action Decision Document for Corrective Action Unit 230: Area 22 Sewage Lagoons and Corrective Action Unit 320: Area 22 Desert Rock Airport Strainer Box, Nevada Test Site, Nevada, Rev. 0

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Nevada Operations Office

    2000-04-20

    This Corrective Action Decision Document identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 230, Area 22 Sewage Lagoons, and CAU 320, Area 22 Desert Rock Airport Strainer Box, under the Federal Facility Agreement and Consent Order. Referred to as CAU 230/320, both CAUs are located at the Nevada Test Site (NTS) and comprise two Corrective Action Sites (CASs), 22-03-01 (Sewage Lagoons) and 22-99-01 (Strainer Box). The Area 22 Sewage Lagoons site also includes a buried Imhoff Tank, sludge bed, and associated sewer piping. A September 1999 corrective action investigation identified the only contaminant of concern above preliminary action levels at this CAU (i.e., total petroleum hydrocarbons as diesel-range organics). During this same investigation, three Corrective Action Objectives (CAOs) were identified to prevent or mitigate exposure to subsurface debris and contaminated soil. Based on these CAOs, a review of existing data, future use, and current operations in Area 22 of the NTS, three CAAs were developed for consideration: Alternative 1 - No Further Action, Alternative 2 - Closure in Place with Administrative Controls, and Alternative 3 - Excavation and Removal. These alternatives were evaluated based on four general corrective action standards and five remedy selection decision factors. Alternative 3 was chosen on technical merit as the preferred alternative for CAU 230/320. This alternative was judged to meet all applicable state and federal regulations for closure of the site and will eliminate potential future exposure pathways to the buried debris and contaminated soils at both of the CASs within Area 22.

  4. Antibody responses to two new Lactococcus lactis-produced recombinant Pfs48/45 and Pfs230 proteins increase with age in malaria patients living in the Central Region of Ghana

    DEFF Research Database (Denmark)

    Acquah, Festus K.; Obboh, Evans K.; Asare, Kwame

    2017-01-01

    is monitoring the prevalence and immune response against the sexual stages of the parasite, known as gametocytes, which are responsible for transmission. Sexual-stage specific antigens, Pfs230 and Pfs48/45, have been identified and shown to be targets for transmission blocking antibodies, but they have been...... was 74.7 and 72.8%, respectively. Conclusions A significant age-dependent increase in antibody titers was observed, which suggests a vaccine targeting these antigens could be boosted during a natural infection in the field....

  5. High time resolution observations of the polar stratosphere and mesosphere using a ground-based 230-250 GHz microwave radiometer

    Science.gov (United States)

    Newnham, D. A.; Espy, P. J.; Clilverd, M. A.; Maxfield, D. J.; Hartogh, P.; Holmén, K.; Blindheim, S.; Horne, R. B.

    2012-04-01

    Microwave radiometry is used to measure thermal emission by the Doppler- and pressure-broadened molecular rotational lines of atmospheric gases, from which vertical abundance profiles can be determined. Since solar radiation is not required for the measurement, the technique has the advantage that continuous observations are possible including throughout the polar winter. We describe the development of a passive microwave radiometer [Espy, P. J., P. Hartogh, and K. Holmen (2006), Proc. SPIE, 6362, 63620P, doi:10.1117/12.688953] for ground-based remote sensing of the polar middle atmosphere. The instrument measures nitric oxide (NO), ozone (O3), and carbon monoxide (CO) vertical profiles over the altitude range 35-90 km with time resolution as high as 15 minutes, allowing the diurnal variability of trace chemical species to be investigated. Heterodyne detection of atmospheric emission at 230 GHz and 250 GHz (wavelength ~1.25 mm) with a receiver noise temperature of 300 K is achieved using a superconductor-insulator-superconductor (SIS) mixer cooled to 4 K. The down-converted signals at 1.35 GHz and 2.10 GHz are analysed using both a moderate-resolution (28 kHz, 220 MHz bandwidth) and a high-resolution (14 kHz, 40 MHz bandwidth) chirp-transform spectrometer (CTS). The instrument was operated semi-autonomously at Troll station (72° 01'S 02° 32'E, 1270 m above sea level), Antarctica during 2008-10 and at the Arctic LIDAR Observatory for Middle Atmosphere Research (ALOMAR, 69° 16'N, 16° 00'E, 380 m above sea level), northern Norway during 2011-12. NO volume mixing ratio (VMR) profiles have been inverted from calibrated brightness temperature spectra of the NO line centred at 250.796 GHz, observed above Troll station, using the Microwave Observation Line Estimation and Retrieval (MOLIERE) version 5 code. A priori pressure, temperature, ozone, water vapour, and NO profiles above 30 km were calculated using the Sodankylä Ion and Neutral Chemistry (SIC, version 6

  6. Results of trial operation of new generation assemblies with improved vibration stability for WWER-440 reactors of V-230 and V-213 plants

    International Nuclear Information System (INIS)

    Vasilchenko, I.; Lushin, V.; Shumeev, A.

    2006-01-01

    FAs, in the region of FA-and-absorber rod butt joint due to arrangement of hafnium plates in the upper part of FA casing was also solved. The correctness of solutions, laid down in the design of the new generation fuel assemblies, is successfully confirmed by the results of trial operation. It is planned to apply the new generation fuel for WWER-440 reactors of V-213 type at power units of Dukovany NPP in 2005, and in 2006 at Mochovce NPP and at Bohunice NPP V-2 units 3 and 4. In 2007 it is planned to extend an application of vibration-proof working assemblies of new generation for power units of V-230 type at Kola NPP Unit 1

  7. Technical basis for instrumentation and control design improvements in WWER-440/230 nuclear power plants. A publication of the extrabudgetary programme on the safety of WWER and RBMK nuclear power plants

    International Nuclear Information System (INIS)

    1996-01-01

    Instrumentation and control (I and C) has been recognized as an area which requires substantial improvements in WWER NNPs, particularly for model 230 plants. Under contract with the IAEA the Spanish company Empresarios Agrupados (EA) developed a basic document proposing a technical basis for improvements related to the following most significant aspects of I and C: criteria for safety classification; remote shutdown panel; I and C support to operation and control room design; instrumentation set point margins; accident monitoring instrumentation. This publication is derived from the original report of EA which was circulated by the IAEA for review by staff members and experts from various Member States. It was finally agreed upon at a Consultants' meeting convened by the IAEA in Vienna in May 1994 with the participation of experts from France, Germany and Spain. The guidance expressed in this report is based on the IAEA/NUSS standards, safety guides and practices, and on regulations in use in various Member States. It is proposed as a way of carrying out the necessary studies to improve safety by upgrading the vital part of instrumentation an control in WWER-440 model 230 nuclear power plants. 28 refs, 3 figs

  8. Proposal to amend existing operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, Routt, Jackson and Larimer Counties, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-08-01

    The Western Area Power Administration, Rocky Mountain Region, is proposing to amend an existing US Forest Service operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, which are located in Routt, jackson, and Larimer counties, Colorado. These transmission lines cross portions of the Roosevelt and Routt National Forests. The long-term use authorization Western is requesting from the Forest Service would be for the life of the Ault-Craig and Hayden-Archer transmission lines. This environmental assessment addresses those access road and right-of-way maintenance activities identified by Western that would be performed on Forest Service managed lands during the next approximately five years.

  9. Proposal to amend existing operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, Routt, Jackson and Larimer Counties, Colorado

    International Nuclear Information System (INIS)

    1997-08-01

    The Western Area Power Administration, Rocky Mountain Region, is proposing to amend an existing US Forest Service operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, which are located in Routt, jackson, and Larimer counties, Colorado. These transmission lines cross portions of the Roosevelt and Routt National Forests. The long-term use authorization Western is requesting from the Forest Service would be for the life of the Ault-Craig and Hayden-Archer transmission lines. This environmental assessment addresses those access road and right-of-way maintenance activities identified by Western that would be performed on Forest Service managed lands during the next approximately five years

  10. Britain's delegation to CERN, the European Centre for Nuclear Research near Geneva, voted in favour of a project which take seven years to build, involve a 27 kilometre long tunnel, and cost 230 million pounds. Now LEP receives the go-ahead later this month

    CERN Multimedia

    Llewellyn Smith, Christopher Hubert

    1981-01-01

    Britain's delegation to CERN, the European Centre for Nuclear Research near Geneva, voted in favour of a project which take seven years to build, involve a 27 kilometre long tunnel, and cost 230 million pounds. Now LEP receives the go-ahead later this month

  11. Earliest direct evidence of monument building at the archaeological site of Nan Madol (Pohnpei, Micronesia) identified using 230Th/U coral dating and geochemical sourcing of megalithic architectural stone

    Science.gov (United States)

    McCoy, Mark D.; Alderson, Helen A.; Hemi, Richard; Cheng, Hai; Edwards, R. Lawrence

    2016-11-01

    Archaeologists commonly use the onset of the construction of large burial monuments as a material indicator of a fundamental shift in authority in prehistoric human societies during the Holocene. High- quality direct evidence of this transition is rare. We report new interdisciplinary research at the archaeological site of Nan Madol that allows us to specify where and when people began to construct monumental architecture in the remote islands of the Pacific. Nan Madol is an ancient administrative and mortuary center and the former capital of the island of Pohnpei. It was constructed over 83 ha of lagoon with artificial islets and other architecture built using columnar basalt and coral. We employed geochemical sourcing of basalt used as architectural stone and high-precision uranium-thorium series dates (230Th/U) on coral from the tomb of the first chief of the entire island to identify the beginning of monument building at Nan Madol in AD 1180-1200. Over the next several centuries (AD 1300-1600) monument building began on other islands across Oceania. Future research should be aimed at resolving the causes of these social transformations through higher quality data on monument building.

  12. In Silico Molecular Modeling and Docking Studies on Novel Mutants (E229V, H225P and D230C) of the Nucleotide-Binding Domain of Homo sapiens Hsp70.

    Science.gov (United States)

    Elengoe, Asita; Hamdan, Salehhuddin

    2017-12-01

    In this study, we explored the possibility of determining the synergistic interactions between nucleotide-binding domain (NBD) of Homo sapiens heat-shock 70 kDa protein (Hsp70) and E1A 32 kDa of adenovirus serotype 5 motif (PNLVP) in the efficiency of killing of tumor cells in cancer treatment. At present, the protein interaction between NBD and PNLVP motif is still unknown, but believed to enhance the rate of virus replication in tumor cells. Three mutant models (E229V, H225P and D230C) were built and simulated, and their interactions with PNLVP motif were studied. The PNLVP motif showed the binding energy and intermolecular energy values with the novel E229V mutant at -7.32 and -11.2 kcal/mol. The E229V mutant had the highest number of hydrogen bonds (7). Based on the root mean square deviation, root mean square fluctuation, hydrogen bonds, salt bridge, secondary structure, surface-accessible solvent area, potential energy and distance matrices analyses, it was proved that the E229V had the strongest and most stable interaction with the PNLVP motif among all the four protein-ligand complex structures. The knowledge of this protein-ligand complex model would help in designing Hsp70 structure-based drug for cancer therapy.

  13. Magma mixing and the generation of isotopically juvenile silicic magma at Yellowstone caldera inferred from coupling 238U–230Th ages with trace elements and Hf and O isotopes in zircon and Pb isotopes in sanidine

    Science.gov (United States)

    Stelten, Mark E.; Cooper, Kari M.; Vazquez, Jorge A.; Reid, Mary R.; Barfod, Gry H.; Wimpenny, Josh; Yin, Qing-Zhu

    2013-01-01

    The nature of compositional heterogeneity within large silicic magma bodies has important implications for how silicic reservoirs are assembled and evolve through time. We examine compositional heterogeneity in the youngest (~170 to 70 ka) post-caldera volcanism at Yellowstone caldera, the Central Plateau Member (CPM) rhyolites, as a case study. We compare 238U–230Th age, trace-element, and Hf isotopic data from zircons, and major-element, Ba, and Pb isotopic data from sanidines hosted in two CPM rhyolites (Hayden Valley and Solfatara Plateau flows) and one extracaldera rhyolite (Gibbon River flow), all of which erupted near the caldera margin ca. 100 ka. The Hayden Valley flow hosts two zircon populations and one sanidine population that are consistent with residence in the CPM reservoir. The Gibbon River flow hosts one zircon population that is compositionally distinct from Hayden Valley flow zircons. The Solfatara Plateau flow contains multiple sanidine populations and all three zircon populations found in the Hayden Valley and Gibbon River flows, demonstrating that the Solfatara Plateau flow formed by mixing extracaldera magma with the margin of the CPM reservoir. This process highlights the dynamic nature of magmatic interactions at the margins of large silicic reservoirs. More generally, Hf isotopic data from the CPM zircons provide the first direct evidence for isotopically juvenile magmas contributing mass to the youngest post-caldera magmatic system and demonstrate that the sources contributing magma to the CPM reservoir were heterogeneous in 176Hf/177Hf at ca. 100 ka. Thus, the limited compositional variability of CPM glasses reflects homogenization occurring within the CPM reservoir, not a homogeneous source.

  14. Cogenetic late Pleistocene rhyolite and cumulate diorites from Augustine Volcano revealed by SIMS 238U-230Th dating of zircon, and implications for silicic magma generation by extraction from mush

    Science.gov (United States)

    Coombs, Michelle L.; Vazquez, Jorge A.

    2014-01-01

    Augustine Volcano, a frequently active andesitic island stratocone, erupted a late Pleistocene rhyolite pumice fall that is temporally linked through zircon geochronology to cumulate dioritic blocks brought to the surface in Augustine's 2006 eruption. Zircon from the rhyolite yield a 238U-230Th age of ∼25 ka for their unpolished rims, and their interiors yield a bimodal age populations at ∼26 ka and a minority at ∼41 ka. Zircon from dioritic blocks, ripped from Augustine's shallow magmatic plumbing system and ejected during the 2006 eruption, have interiors defining a ∼26 ka age population that is indistinguishable from that for the rhyolite; unpolished rims on the dioritic zircon are dominantly younger (≤12 ka) indicating subsequent crystallization. Zircon from rhyolite and diorite overlap in U, Hf, Ti, and REE concentrations although diorites also contain a second population of high-U, high temperature grains. Andesites that brought dioritic blocks to the surface in 2006 contain zircon with young (≤9 ka) rims and a scattering of older ages, but few zircon that crystallized during the 26 ka interval. Both the Pleistocene-age rhyolite and the 2006 dioritic inclusions plot along a whole-rock compositional trend distinct from mid-Holocene–present andesites and dacites, and the diorites, rhyolite, and two early Holocene dacites define linear unmixing trends often oblique to the main andesite array and consistent with melt (rhyolite) extraction from a mush (dacites), leaving behind a cumulate amphibole-bearing residue (diorites). Rare zircon antecrysts up to ∼300 ka from all rock types indicate that a Quaternary center has been present longer than preserved surficial deposits.

  15. 36 CFR 230.31 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... the form of money, including grants, agreements, contracts, and other arrangements. Fiscal year. The... carried out as part of the Forest Land Enhancement Program (FLEP) cost-share element. Catastrophic natural... contains all of the key elements required by law and the rules of this subpart. Cost-share. A program...

  16. Publications | Page 230 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tobacco use in Sub-Saharan Africa is growing rapidly as a result of strong economic growth and the aggressive marketing tactics of tobacco multinationals. Although ... Migrant women domestic workers and freedom of communication in Taiwan : a case for barrier-free access to mobile phones as a basic right (open access).

  17. 12 CFR 230.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., the District of Columbia, the commonwealth of Puerto Rico, and any territory or possession of the... calendar day other than a Saturday, a Sunday, or any of the legal public holidays specified in 5 U.S.C...

  18. 49 CFR 230.109 - Tender trucks.

    Science.gov (United States)

    2010-10-01

    ... five leaves in the entire spring pack broken; (2) A broken coil spring or saddle; (3) A coil spring... maximum clearance shall be 3/8 inch on each side for rear trucks and 3/4 inch on each side for front...

  19. 33 CFR 230.9 - Categorical exclusions.

    Science.gov (United States)

    2010-07-01

    ... alert for extraordinary circumstances which may dictate the need to prepare an EA or an EIS. Even though... circumstances triggered the need for an EA and finding of no significant impact (FONSI) or an EIS. If a district..., streets and boat ramps. (2) Minor utility distribution and collection lines, including irrigation. (3...

  20. Publications | Page 230 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  1. 40 CFR 230.92 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... or other suitable metric) representing the loss of aquatic functions at an impact or project site... are defined: Adaptive management means the development of a management strategy that anticipates likely challenges associated with compensatory mitigation projects and provides for the implementation of...

  2. 22 CFR 230.02 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., corporation, partnership, joint venture, association, joint stock company, trust, unincorporated organization... reason of the Borrower's failure to comply on a timely basis with any obligation it may have under an...

  3. 36 CFR 230.35 - FLEP elements.

    Science.gov (United States)

    2010-07-01

    ... through the following elements: (1) Development and implementation of educational programs; (2) Resource management expertise and technical assistance; and (3) Financial assistance through cost-share programs. (b) All participating States may use a portion of allocated funds for FLEP administration costs. (c...

  4. 36 CFR 230.7 - Program practices.

    Science.gov (United States)

    2010-07-01

    ... productivity, vigor, and health, and the value and quality of wood products. (4) Windbreak and Hedgerow... of windbreaks and hedgerows to conserve energy, protect farmsteads, livestock, and crops, and reduce...

  5. 23 CFR 230.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Plan means an affirmative action plan to increase minority utilization of crafts in a specified...” plan. Bid conditions means contract requirements which have been issued by OFCC for purposes of... of specifying training positions on selected Federal-aid highway construction projects. Supportive...

  6. Upsurge of X-ray astronomy 230-

    International Nuclear Information System (INIS)

    Hudec, D.R.

    1978-01-01

    Instruments are described used for X-ray astronomy, namely X-ray detectors and X-ray telescopes. Unlike telescopes, the detectors do not comprise X-ray optics. A survey is given of the results obtained in solar and stellar X-ray astronomy and hypotheses are submitted on the origin of X radiation in the interstellar space. (J.B.)

  7. 49 CFR 230.3 - Implementation.

    Science.gov (United States)

    2010-10-01

    ... with the regulations in effect prior to January 18, 2000 (See 49 CFR parts 200-999, revised October 1... regulations in effect prior to January 18, 2000 (See 49 CFR parts 200-999, revised October 1, 1978) until... in effect prior to January 18, 2000 (See 49 CFR parts 200-999, revised October 1, 1978) will be...

  8. 23 CFR 230.305 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... other Spanish culture or origin, regardless of race. (4) The category Asian or Pacific Islanders: All..., minority group persons in the U.S. are identified as Blacks (not of Hispanic origin), Hispanics, Asian or...

  9. 32 CFR 230.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... business lines (e.g., in-store banking) where a determination has been made by the respective DoD Component... franchise and, where applicable, as authorized by the pertinent status of forces agreements, other...

  10. 49 CFR 230.2 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... following exists on its line: (i) A public highway-rail crossing that is in use; (ii) An at-grade rail...) A common corridor with another railroad, i.e., its operations are conducted within 30 feet of those...

  11. 22 CFR 229.230 - Transition plans.

    Science.gov (United States)

    2010-04-01

    ... overcome the effects of past exclusion of students on the basis of sex, each educational institution to... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION...) Submission of plans. An institution to which § 229.225 applies and that is composed of more than one...

  12. 40 CFR 230.6 - Adaptability.

    Science.gov (United States)

    2010-07-01

    ... entirety to any one activity, no matter how complex. It is anticipated that substantial numbers of permit... essential component of guideline application. These Guidelines allow evaluation and documentation for a variety of activities, ranging from those with large, complex impacts on the aquatic environment to those...

  13. 23 CFR 230.407 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... include preliminary engineering work in project development or engineering services performed by or for a...) Discrimination means a distinction in treatment based on race, color, religion, sex, or national origin; (l...

  14. 49 CFR 230.70 - Safe condition.

    Science.gov (United States)

    2010-10-01

    ... brake valves work properly in all positions; and (5) The water has been drained from the air-brake system. (b) Brake pipe valve required. Each steam locomotive shall have a brake pipe valve attached to.... The words “Emergency Brake Valve” shall be clearly displayed near the valve. ...

  15. 33 CFR 334.230 - Potomac River.

    Science.gov (United States)

    2010-07-01

    ... infrequent intervals. (ii) Middle zone. Beginning at the intersection of the Potomac River Bridge with the... using dredged channels and propelled by mechanical power at a speed greater than five miles per hour may... Potomac River during firing hours shall proceed outside of the northeastern boundary of the Middle Danger...

  16. 2 CFR 230.15 - Policy.

    Science.gov (United States)

    2010-01-01

    ... Government bear its fair share of costs except where restricted or prohibited by law. The principles do not attempt to prescribe the extent of cost sharing or matching on grants, contracts, or other agreements... individual cost elements by Federal agencies. ...

  17. Gender | Page 230 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In this book, Naila Kabeer brings together a diverse set of arguments, findings, and lessons from the development literature that help to explain why gender equality merits specific attention from policy-makers, practitioners, researchers, and other stakeholders committed to the pursuit of pro-poor and human-centred ...

  18. 40 CFR 230.43 - Vegetated shallows.

    Science.gov (United States)

    2010-07-01

    ...) releasing chemicals that adversely affect plants and animals; (4) increasing turbidity levels, thereby... material may reduce the value of vegetated shallows as nesting, spawning, nursery, cover, and forage areas...

  19. 23 CFR 230.413 - Review reports.

    Science.gov (United States)

    2010-04-01

    ... documentary evidence to support the determination of a contractor's or subcontractor's compliance status. (3... documentary evidence. (4) The compliance review report shall contain at least the following information. 1... from the General Accounting Office, Office of Management and Budget, Senate Subcommittee on Public...

  20. 23 CFR 230.202 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... in this subpart as a simplified way of defining the firms eligible to benefit from this supportive... official of any State charged by its laws with the responsibility for highway construction. The term State is considered equivalent to State highway agency if the context so implies. ...

  1. 40 CFR 230.11 - Factual determinations.

    Science.gov (United States)

    2010-07-01

    ... the physical, chemical, and biological components of the aquatic environment in light of subparts C... contaminants. This determination shall consider the material to be discharged, the aquatic environment at the... individual permit applications, the issuance of a General permit, and monitoring and enforcement of existing...

  2. 49 CFR 230.8 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... boiler which affects its pressure retention capability. Rating changes are considered alterations. ANSI....) NBIC. National Board Inspection Code published by the National Board of Boiler and Pressure Vessel... the boiler has steam pressure above atmospheric pressure with fire in the firebox. In the case of a...

  3. 17 CFR 230.253 - Offering circular.

    Science.gov (United States)

    2010-04-01

    .... Repetition of information should be avoided; cross-referencing of information within the document is... COMPLETENESS OF ANY OFFERING CIRCULAR OR OTHER SELLING LITERATURE. THESE SECURITIES ARE OFFERED PURSUANT TO AN...

  4. 40 CFR 230.7 - General permits.

    Science.gov (United States)

    2010-07-01

    ... for specific human uses or by specific land or water management plans (e.g., areas regulated under an... in such category are similar in nature and similar in their impact upon water quality and the aquatic... water quality and the aquatic environment. (b) Evaluation process. To reach the determinations required...

  5. Cross section of 70-230 MeV proton production in the p + A → p + X reactions at 1-9 GeV/c, π+ + A → p + X at 1-6 GeV/c and in the π- + A → p + X at 1.4 and 5 GeV/c

    International Nuclear Information System (INIS)

    Bayukov, Yu.D.; Gavrilov, V.B.; Goryainov, N.A.

    1983-01-01

    The tables of cross sections of proton production with energies 70-230 KeV for reactions p+A→p+X at 1-9 GeV/c, π + +A→p+X at 1-6 GeV/c and π - +A→p+X at 1.4 and 5 GeV/c are presented. The dependences on initial particle momentum are measured (for protons at 1, 1.4, 2, 5, 6, 6.25, 6.5, 7, 7.5, 8.25, 8.5 and and 9 GeV/c, for π + at 1, 1.4, 2, 3, 4, 5 and 6 GeV/c and for π - at 1.4 and 5 GeV/c) for C, Cu, Pb and U targets at the angles of 59 deg, 89 deg, 119 deg and 160 deg. At these angles A-dependence was also measured in detail (for Be, C, Al, Ti, Fe, Cu, Nb, Cd, Sn, Ta, Pb and U targets) for initial protons with 7.5 GeV/c. Detailed angular dependences at the range from 10 deg to 177 deg are presented for C, Cu, Pb and U targets for initial protons of 7.5 GeV/c and π - mesons of 5 GeV/c

  6. 230-IJBCS-Article-Dr P N Ndoutoumou

    African Journals Online (AJOL)

    RHUMSIKI

    Methacrylate (HEMA) allows the analysis of the evolution of self-pollinated embryos and 3-14 days old hybrids after pollination. The growth rate does differ between the two types of embryos. On the basis of developmental stages, the form of embryo on one hand, and the ovary tissues on the other hand, present several.

  7. Page | 230 ACTIVE PARTICIPATION OF NIGERIAN WOMEN IN THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    1993-06-29

    Jun 29, 1993 ... Clearly defined, a right is the freedom, power or privilege, due by agreement, birth, claim, guaranty, or ... beings, irrespective of nationality, place of residence, sex, national or ethnic origin, colour, religion, ... Convention on the Political Rights of Women of 1952: This Convention came into effect in 1954. So.

  8. 12 CFR Supplement I to Part 230 - Official Staff Interpretations

    Science.gov (United States)

    2010-01-01

    ... newspaper, periodical, or trade journal (unless the depository institution, or a deposit broker offering... may be given to consumers. In making this determination, institutions aggregate per account only the..., institutions may note that a particular fee has been changed (also specifying the new amount) or use an...

  9. 17 CFR 230.420 - Legibility of prospectus.

    Science.gov (United States)

    2010-04-01

    ... to draw investor attention to specific information. [53 FR 3878, Feb. 10, 1988, as amended at 61 FR... prospectus. (a) The body of all printed prospectuses and all notes to financial statements and other tabular.... However, (a) to the extent necessary for convenient presentation, financial statements and other tabular...

  10. 17 CFR 230.155 - Integration of abandoned offerings.

    Science.gov (United States)

    2010-04-01

    ... offering disclose information about the abandoned private offering, including: (i) The size and nature of... were (or who the issuer reasonably believes were): (i) Accredited investors (as that term is defined in... document used in the private offering discloses any changes in the issuer's business or financial condition...

  11. 23 CFR 230.409 - Contract compliance review procedures.

    Science.gov (United States)

    2010-04-01

    ... sample basis, determine the union membership status of union employees on the site (e.g. whether they have permits, membership cards, or books, and in what category they are classified [e.g., A, B, or C... determine whether or not problems exist by reviewing information relative to: (1) The contractor's current...

  12. Upgrading the safety of VVER-440/V-230

    International Nuclear Information System (INIS)

    Kelm, P.; Wenk, W.

    1995-01-01

    Besides measures seeking to restore the status as laid down in the project design, especially backfitting measures must be mentioned which serve to ensure component and pipe integrity. Ensuring component integrity is a problem not only of RPV embrittlement, but also of failure prevention. This aspect was not always taken into account properly. Further activities in the field of component integrity will focus on backing the brittle fracture evaluation of the RPV; qualifying the leak-before-breack criterion for the main pipes and in areas with screwed connections; qualifying the program of in-service inspections. Several operators are currently in the process of drafting backfitting programs. The upgrading measures envisaged must be checked as to their balanced nature. In certain plants, the integrity of the RPV coud turn out to be the weak spot in upgrading measures. As a consquence, concepts seeking to achieve upgrading for long periods of time may differ from one location to the next and even between units. Extensive modifications in systems engineering and building structures generally must be evaluated against the expected improvement in safety of the whole plant. (orig.) [de

  13. 40 CFR 230.10 - Restrictions on discharge.

    Science.gov (United States)

    2010-07-01

    ... after taking into consideration cost, existing technology, and logistics in light of overall project... alternatives have been identified and evaluated under a Coastal Zone Management program, a section 208 program... sites. (2) Significantly adverse effects of the discharge of pollutants on life stages of aquatic life...

  14. Calculation of induced activity in the V-230 reactor

    International Nuclear Information System (INIS)

    Bouhahhane, A.; Farkas, G.

    2013-01-01

    In this paper, we focused on the calculation of the neutron induced activity of nuclear reactor components for decommissioning purposes. The results confirm, that the most important radionuclides in the reactor components dismantling process are 55 Fe (1 st decade), 60 Co (10 - 50 y) and 63 Ni (during the whole process). Another aim of this paper was to refer to the possibility to improve the accuracy of the calculations using continuous energy Monte Carlo methods. (authors)

  15. 40 CFR 170.230 - Pesticide safety training for handlers.

    Science.gov (United States)

    2010-07-01

    ... enter the body. (iv) Signs and symptoms of common types of pesticide poisoning. (v) Emergency first aid.... (ix) Prevention, recognition, and first aid treatment of heat-related illness. (x) Safety requirements... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticide safety training for handlers...

  16. 10 CFR 603.230 - Fee or profit.

    Science.gov (United States)

    2010-01-01

    ... participant is to receive fee or profit. Note that this policy extends to all performers of the project... subrecipients' payment of reasonable fee or profit when making purchases from suppliers of goods (e.g., supplies...

  17. 17 CFR 230.419 - Offerings by blank check companies.

    Science.gov (United States)

    2010-04-01

    ...) Deposit of securities and proceeds in escrow or trust account—(1) General. (i) Except as otherwise...: (A) An escrow account maintained by an “insured depository institution,” as that term is defined in.... (ii) If funds and securities are deposited into an escrow account maintained by an insured depository...

  18. 9 CFR 354.230 - Equipment and utensils.

    Science.gov (United States)

    2010-01-01

    ... drop chain or shackle, which shall be of noncorrosive metal. (3) Nonmetallic belt-type conveyors used... and key and the key shall not leave the custody of the inspector in charge of the plant. Such trucks...

  19. 40 CFR 1065.230 - Raw exhaust flow meter.

    Science.gov (United States)

    2010-07-01

    ... a chemical-balance calculation to determine work from brake-specific fuel consumption and fuel... exhaust's thermodynamic, fluid, and compositional states. (c) Flow conditioning. For any type of raw...

  20. 17 CFR 230.437a - Written consents.

    Science.gov (United States)

    2010-04-01

    ...) Are filing a registration statement containing financial statements in which Arthur Andersen LLP (or a...) The registrant discloses clearly any limitations on recovery by investors posed by the lack of consent...

  1. 50 CFR 648.230 - Catch quotas and other restrictions.

    Science.gov (United States)

    2010-10-01

    ... estimates of recruitment; virtual population analysis results; levels of noncompliance by fishermen or individual states; impact of size/mesh regulations; sea sampling data; impact of gear other than otter trawls..., but are not limited to: (1) Minimum or maximum fish sizes; (2) Seasons; (3) Mesh size restrictions; (4...

  2. 36 CFR 2.30 - Misappropriation of property and services.

    Science.gov (United States)

    2010-07-01

    ... the knowledge or consent of the seller or paying less than purchase price by deception. (5) Acquiring or possessing the property of another, with knowledge or reason to believe that the property is...

  3. 40 CFR 230.30 - Threatened and endangered species.

    Science.gov (United States)

    2010-07-01

    ....11). The Department of Commerce has authority over some threatened and endangered marine mammals, fish and reptiles. (b) Possible loss of values: The major potential impacts on threatened or endangered...

  4. 36 CFR 230.11 - Recapture of payment.

    Science.gov (United States)

    2010-07-01

    ... that person shall be secured. A scheme or device includes, but is not limited to, coercion, fraud or misrepresentation, false claims, or any business dissolution, reorganization, revival, or other legal mechanism...

  5. 17 CFR 230.607 - Sales material to be filed.

    Science.gov (United States)

    2010-04-01

    ... RULES AND REGULATIONS, SECURITIES ACT OF 1933 Regulation E-Exemption for Securities of Small Business... communications prepared or authorized by the issuer or anyone associated with the issuer, any of its affiliates..., may authorize: (a) Every advertisement, article or other communication proposed to be published in any...

  6. 49 CFR Appendix A to Part 230 - Inspection Requirements

    Science.gov (United States)

    2010-10-01

    ... compressor(s) and governor to ascertain proper operation.* 9. Inspection of brake and signal equipment.* 10. Inspection of brake cylinders for piston travel. 11. Inspection of foundation brake gear. 12. Inspection of... crossheads and guides. 16. Inspection of piston rods and fasteners. 17. Inspection of main, side, and valve...

  7. 40 CFR 230.91 - Purpose and general considerations.

    Science.gov (United States)

    2010-07-01

    ... done after taking into consideration cost, existing technology, and logistics in light of overall... complies with the Section 404(b)(1) Guidelines. During the 404(b)(1) Guidelines compliance analysis, the...

  8. 49 CFR 238.230 - Safety appliances-new equipment.

    Science.gov (United States)

    2010-10-01

    ... form of an industry-wide standard and at a minimum shall: (1) Identify the type(s) of car to which the... or supports considered part of the car body. Safety appliance brackets or supports will be considered part of the car body and will not be required to be mechanically fastened to the piece of passenger...

  9. 12 CFR 230.9 - Enforcement and record retention.

    Science.gov (United States)

    2010-01-01

    ... listed in that section. (b) Civil liability. Section 271 of the Act contains the provisions relating to civil liability for failure to comply with the requirements of the act and this part; Section 271 is...

  10. JB 230.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  11. 17 CFR 230.134 - Communications not deemed a prospectus.

    Science.gov (United States)

    2010-04-01

    ... marketing events (including the dates, times, locations, and procedures for attending or otherwise accessing... participating dealer (including procedures regarding account-opening and submitting indications of interest and... need not be included in such a communication to a dealer. (e) A section 10 prospectus included in any...

  12. 40 CFR 86.230-11 - Test sequence: general requirements.

    Science.gov (United States)

    2010-07-01

    ... compartment cooling. (1) Fixed speed air cooling of the engine compartment with the compartment cover open... fuel economy testing, alternative engine compartment cooling fans or systems, including those which... test. Additionally, the Administrator may conduct certification, fuel economy and in-use testing using...

  13. 40 CFR 86.230-94 - Test sequence: general requirements.

    Science.gov (United States)

    2010-07-01

    ... compartment cooling. (1) Fixed speed air cooling of the engine compartment with the compartment cover open... fuel economy testing, alternative engine compartment cooling fans or systems, including those which... Administrator may conduct certification, fuel economy and in-use testing using the additional cooling set-up...

  14. 17 CFR 230.156 - Investment company sales literature.

    Science.gov (United States)

    2010-04-01

    ... statement involving a material fact about the characteristics or attributes of an investment company could... skill or techniques, characteristics of the investment company or an investment in securities issued by... communication (whether in writing, by radio, or by television) used by any person to offer to sell or induce the...

  15. 40 CFR 230.93 - General compensatory mitigation requirements.

    Science.gov (United States)

    2010-07-01

    ...) Considerations. (i) A watershed approach to compensatory mitigation considers the importance of landscape... higher. (i) Buffers. District engineers may require the restoration, establishment, enhancement, and preservation, as well as the maintenance, of riparian areas and/or buffers around aquatic resources where...

  16. 17 CFR 230.405 - Definitions of terms.

    Science.gov (United States)

    2010-04-01

    ..., videotapes, facsimiles, CD-ROM, electronic mail, Internet Web sites, substantially similar messages widely...' equity in the income from continuing operations before income taxes, extraordinary items and cumulative effect of a change in accounting principle of the subsidiary exceeds 10 percent of such income of the...

  17. 49 CFR 230.72 - Testing main reservoirs.

    Science.gov (United States)

    2010-10-01

    ... the tensile strength of steel is unknown; and R = Inside radius of the reservoir in inches. (2... = certified working pressure in psi; S = 1/5 of the minimum specified tensile strength of the material in psi... strength of the material in psi, or 10,000 psi if the tensile strength is unknown; and R = Inside radius of...

  18. 33 CFR 230.25 - Environmental review and consultation requirements.

    Science.gov (United States)

    2010-07-01

    ... listing of environmental laws and orders is contained in table 3.4.3 of Economic and Environmental... Major Federal Actions, 4 January 1979. For general policy guidance, see Federal Register of April 12... Commission (IJC) or the International Boundary and Water Commission, United States and Mexico (IBWC) is...

  19. 17 CFR 230.457 - Computation of fee.

    Science.gov (United States)

    2010-04-01

    ... portion, if any, not taken by such security holders is to be reoffered to the general public, the... the proposed reoffering price to the general public, whichever is higher. (f) Where securities are to... receivership, or has an accumulated capital deficit, in which case one-third of the principal amount, par value...

  20. 33 CFR 110.230 - Puget Sound Area, Wash.

    Science.gov (United States)

    2010-07-01

    ...) Cap Sante Tug and Barge General Anchorage. The Cap Sante Tug and Barge General Anchorage includes all... approximately the northeast tip of Cap Sante; then southeast to 48°30′53″ N, 122°35′28″ W; then west southwest to 48°30′45″ N, 122°35′52″ W, approximately the south tip of Cap Sante; then north along the...

  1. 49 CFR 230.32 - Time and method of inspection.

    Science.gov (United States)

    2010-10-01

    ... boiler while under hydrostatic pressure. ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and... boiler shall completely be inspected at the 1472 service day inspection. The jacket, lagging and any...

  2. 49 CFR 230.45 - Method of testing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances... dead weight tester. While under test load at the MAWP of the boiler to which the gauge will be applied, the gauge shall be set to read that pressure as accurately as the physical limitations of the gauge...

  3. All projects related to | Page 230 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-18

    However, youth in poor and violent neighbourhoods of Rio de Janeiro are using new technologies to make their voices heard. Start Date: January 18, 2012 ... Topic: NUTRITION, FOOD POLICY, FOOD RESOURCES, DISADVANTAGED GROUPS, HEALTH POLICY, DISEASES, LOW INCOME GROUPS. Region: Pakistan ...

  4. 6 CFR 27.230 - Risk-based performance standards.

    Science.gov (United States)

    2010-01-01

    ... storage of hazardous materials for the facility; (6) Theft and Diversion. Deter theft or diversion of potentially dangerous chemicals; (7) Sabotage. Deter insider sabotage; (8) Cyber. Deter cyber sabotage...

  5. 23 CFR 230.113 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... which will increase the effectiveness of approved training programs. State highway agencies shall give..., formal advertising is not required by the FHWA, however, the State highway agency shall solicit proposals... effectiveness of approved on-the-job training programs, particularly their effectiveness in providing meaningful...

  6. 23 CFR 230.204 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... immediate and long-term business management, recordkeeping, and financial accounting capabilities; (4... all State highway agencies. (5) The establishment of a definite period of contract performance...

  7. 23 CFR 230.411 - Guidance for conducting reviews.

    Science.gov (United States)

    2010-04-01

    ... National Labor Relations Act and Title VII of the Civil Rights Act of 1964, as amended. (iii) Contractors... excuse that the union, with which the contractor has a collective bargaining agreement providing for..., these contractors must be found in noncompliance. (2) If the contractor indicates that union action or...

  8. 40 CFR 230.94 - Planning and documentation.

    Science.gov (United States)

    2010-07-01

    ... management is needed. A schedule for monitoring and reporting on monitoring results to the district engineer... sustainability of the resource, including long-term financing mechanisms and the party responsible for long-term... will guide decisions for revising compensatory mitigation plans and implementing measures to address...

  9. Publications | Page 230 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  10. Dicty_cDB: VFB230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QKGLLYIIKNKDKNSYKSGKLIEKTKKDNEIILNFELVHEKNKIIE KKFNGIIYSLYYSCMVCIPIQGQLHLDQEYPIEFYKVLIQILDQFPLKLHFYNHPFHKYD V*xkxnhyhxkcnns...EFYKVLIQILDQFPLKLHFYNHPFHKYD V*xkxnhyhxkcnnsstiil Frame B: *nlflf*nflffvsilsiy*ng*fkyf*k*ll*srn*cwrnny*rhskc

  11. 24 CFR 1006.230 - Administrative and planning costs.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Administrative and planning costs... Administrative and planning costs. Up to such amount as HUD may authorize, or such other limit as may be... planning expenses of the DHHL relating to carrying out the Act and this part and activities assisted with...

  12. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  13. 17 CFR 230.426 - Filing of certain prospectuses under § 230.167 in connection with certain offerings of asset...

    Science.gov (United States)

    2010-04-01

    ... intention to purchase the asset-backed securities. (2) Any ABS informational and computational material if a... issuer or an underwriter that it will purchase all or a portion of the class of asset-backed securities...

  14. 16 CFR 1500.230 - Guidance for lead (Pb) in consumer products.

    Science.gov (United States)

    2010-01-01

    ... marketing, patterns of use, and life cycle of the product. (2) Paint and similar surface coatings containing... intended for use by children that bear lead-containing paint, and furniture articles for consumer use that bear lead-containing paint. 16 CFR Part 1303. In recent years, however, the Commission staff has...

  15. 40 CFR 52.230 - Control strategy and regulations: Nitrogen dioxide.

    Science.gov (United States)

    2010-07-01

    ... since adequate replacement rules have not been submitted and no analysis has been presented to show that...) Orange County APCD, Regulation IV, Rule 474, Fuel Burning Equipment—Oxides of Nitrogen, submitted on..., Regulation IV, Rule 68, Fuel Burning Equipment—NOx. (2) Orange County APCD, Regulation IV, Rule 67.1, Fuel...

  16. 40 CFR 230.60 - General evaluation of dredged or fill material.

    Science.gov (United States)

    2010-07-01

    ... is most likely to be free from chemical, biological, or other pollutants where it is composed... indications that contaminants may be present, further inquiry should be made. (b) The extraction site shall be...

  17. Development of UO2-30 WT per cent PuO2 fuel for FBTR

    International Nuclear Information System (INIS)

    Majumdar, S.; Kumar, Arun; Kamath, H.S.; Ramachandran, R.; Purushotham, D.S.C.; Roy, P.R.

    1983-01-01

    The specifications on Fast Breeder Reactor (FBTR) fuel pellets have two apparently contradictory requirements viz. (1) formation of homogeneous solid between UO 2 and PuO 2 which can only be achieved by high temperature sintering and (2) density of sintered pellets in the range of 92 ± 1 per cent T.D. which is normally achieved by low temperature sintering. Deactivation of starting powders under CO 2 or addition of volatile pore formers to the powders are the two methods which have been developed for lowering the denity of the pellets without reducing the sintering temperature. Two alternative fabrication routes utilizing these processes for manufacturing of FBTR pellets are described in this report. (author)

  18. 46 CFR 8.230 - Minimum standards for a recognized classification society.

    Science.gov (United States)

    2010-10-01

    ... and maintain class rules in the English language for the design, construction and certification of ships and their associated essential engineering systems; (8) Maintain written survey procedures in the English language; (9) Have adequate resources, including research, technical, and managerial staff, to...

  19. 12 CFR Appendix A to Part 230 - Annual Percentage Yield Calculation

    Science.gov (United States)

    2010-01-01

    ... percentage yield calculations for account disclosures and advertisements, while Part II discusses annual... number of days that would occur for any actual sequence of that many calendar months. If institutions...

  20. 40 CFR 158.230 - Experimental use permit data requirements for toxicology.

    Science.gov (United States)

    2010-07-01

    ... crop use, terrestrial feed crop use, aquatic food crop use, greenhouse food crop use, and indoor food... neurotoxicity (acute) - hen CR CR TGAI TGAI 5 Subchronic Testing 870.3100 90-day Oral - rodent R NR TGAI TGAI...

  1. 33 CFR 155.230 - Emergency control systems for tank barges.

    Science.gov (United States)

    2010-07-01

    ... HOMELAND SECURITY (CONTINUED) POLLUTION OIL OR HAZARDOUS MATERIAL POLLUTION PREVENTION REGULATIONS FOR... Inspection, may define “fair weather” on the COI. (3) On Long Island Sound. For the purposes of this section, Long Island Sound comprises the waters between the baseline of the territorial sea on the eastern end...

  2. 22 CFR 230.05 - Non-impairment of the Guarantee.

    Science.gov (United States)

    2010-04-01

    ... agreement or other document executed by a Noteholder, USAID, the Fiscal Agent or the Borrower in connection... guarantee provision shall not, however, be operative with respect to any loss arising out of fraud or...

  3. 17 CFR 230.135c - Notice of certain proposed unregistered offerings.

    Science.gov (United States)

    2010-04-01

    ... a foreign issuer that is exempt from registration under the Securities Exchange Act of 1934 pursuant... the NASDAQ inter-dealer quotation system information with respect to the interest rate, conversion... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Notice of certain proposed...

  4. 2 CFR Appendix C to Part 230 - Non-Profit Organizations Not Subject to This Part

    Science.gov (United States)

    2010-01-01

    ... Astronomy Observatory, Green Bank, West Virginia 20. National Renewable Energy Laboratory, Golden, Colorado..., California 23. Research Triangle Institute, Research Triangle Park, North Carolina 24. Riverside Research...

  5. 36 CFR 230.37 - State priority plan-educational assistance.

    Science.gov (United States)

    2010-07-01

    ...) Activities; (2) Events; (3) Programs; (4) Curriculum; (5) Written materials; (6) Workshops; (7) Training... plan must describe the types of activities that will be covered, participating entities, expected...

  6. 33 CFR 156.230 - Factors considered in designating lightering zones.

    Science.gov (United States)

    2010-07-01

    ... Rivers System, National Wilderness Preservation System, properties included on the National Register of... traditional use of areas for lightering operations; (d) The normal weather and sea conditions in the areas...

  7. S. Afr. Tydskr. Veek. I , 225 -230 ( l97l ) 'N OORSIG VAN DIE ...

    African Journals Online (AJOL)

    hormone (Murphy, Engelberg & Pattee, 1963), (Murphy. & Pattee, 1964). Uit die kennis sover ingesamel het die twee hoof- metodes vir die bepaling van die geslagshormone ontwik- kel, naamlik: A. Die radioimmunologiese metode vir die bepaling van die polipeptied-hornlone van die voorste lob van die hipofise (FSH, LH ...

  8. Liu et al., Afr J Tradit Complement Altern Med. (2016) 13(3):230-242 ...

    African Journals Online (AJOL)

    immunomodulatory by promoting splenic lymphocyte proliferation and stimulating the secretion of cytokines IL-2 and IFN-γ, as well as free radical (DPPH) ... As a clinical preparation, it has been used to treat lung cancer, liver cancer and gastric cancer, and also used to relieve the pain caused by chemotherapy (Liu et al., ...

  9. 17 CFR 230.144A - Private resales of securities to institutions.

    Science.gov (United States)

    2010-04-01

    ... securities holdings in its financial statements on the basis of their market value, and no current... most recent publicly available financial statements, Provided That such statements present the... annual financial statements, as of a date not more than 16 months preceding the date of sale under the...

  10. Hydrogen countermeasures and activity retention by filtered venting for WWER-440/V230 NPP confinement

    International Nuclear Information System (INIS)

    Feuerbach, R.

    2001-01-01

    In order to prevent loss of confinement integrity caused by steam and hydrogen generation nuclear power plants in the Federal Republic of Germany as well as in most other European countries have been or will be back-fitted with a system for filtering the confinement atmosphere prior to release to the environment and a system for reducing and measuring the H 2 concentration inside the confinement. For these tasks systems for confinement atmosphere control are presented, capable of: handling high H 2 production rates and cleaning of high contaminated confinement atmosphere. (author)

  11. 25 CFR 39.230 - How will the provisions of this subpart be phased in?

    Science.gov (United States)

    2010-04-01

    ... the 2 prior years' count weeks (c) Each succeeding school year after May 31, 2005 Add one year of ADM or count period and drop one year of prior count weeks until both systems are operating on a 3-year...

  12. 17 CFR 230.433 - Conditions to permissible post-filing free writing prospectuses.

    Science.gov (United States)

    2010-04-01

    ... format) of any free writing prospectus (including any published article, publication, or advertisement... affiliate: (i) Is the publisher of a bona fide newspaper, magazine, or business or financial publication of...

  13. High resolution observations of compact H II regions at 230 GHz

    International Nuclear Information System (INIS)

    Wink, J.E.; Mezger, P.G.; Zylka, R.

    1989-01-01

    Based on the idea that star formation goes on progressively in molecular clouds, a search was conducted for protostars by mapping compact H II regions at a frequency of 250 GHz. The IRAM 30 m radio telescope was used with a (3)He cooled bolometer. Twenty compact H II regions usually obtaining twice the expected free-free flux density, positionally coincident with the H II region, were observed. Even fine structure within the H II regions can be traced in the maps as in the case of G75.84+0.40 near ON-2. The high degree of coincidence between the 250 and 5 GHz map of Harris shows that the excess flux density observed must come from dust mixed with the ionized gas. Part of the dust must however be accumulated in the outer part of the H II region, since in some cases the contours are shifted outwards relative to the radio maps. This is consistent with the fact that in those cases where enough information is available to make a model fit, temperatures were derived of 80 + or - 30 K

  14. supplementary material taford, s. afr. j. chem., 2013, 66, 221–230 ...

    African Journals Online (AJOL)

    NICO

    microwave. 16,17. CH3CN microwave. 28. HCN infrared. 18. CH3OH. UV-PES b. 14,15. CO2. MBER a. 19. C5H5N. UV-PES b. 29. CS2. UV-PES b. 15. (CH3)3N microwave. 17,30. N2O microwave. 19. (C2H5)2O. UV-PES b. 14,15 a. MBER – molecular beam electric resonance spectroscopy. b. UV-PES – ultraviolet ...

  15. Breed distribution of the nt230(del4) MDR1 mutation in dogs.

    Science.gov (United States)

    Gramer, Irina; Leidolf, Regina; Döring, Barbara; Klintzsch, Stefanie; Krämer, Eva-Maria; Yalcin, Ebru; Petzinger, Ernst; Geyer, Joachim

    2011-07-01

    A 4-bp deletion mutation associated with multiple drug sensitivity exists in the canine multidrug resistance (MDR1) gene. This mutation has been detected in more than 10 purebred dog breeds as well as in mixed breed dogs. To evaluate the breed distribution of this mutation in Germany, 7378 dogs were screened, including 6999 purebred and 379 mixed breed dogs. The study included dog breeds that show close genetic relationship or share breeding history with one of the predisposed breeds but in which the occurrence of the MDR1 mutation has not been reported. The breeds comprised Bearded Collies, Anatolian Shepherd Dog, Greyhound, Belgian Tervuren, Kelpie, Borzoi, Australian Cattle Dog and the Irish Wolfhound. The MDR1 mutation was not detected is any of these breeds, although it was found as expected in the Collie, Longhaired Whippet, Shetland Sheepdog, Miniature Australian Shepherd, Australian Shepherd, Wäller, White Swiss Shepherd, Old English Sheepdog and Border Collie with varying allelic frequencies for the mutant MDR1 allele of 59%, 45%, 30%, 24%, 22%, 17%, 14%, 4% and 1%, respectively. Allelic frequencies of 8% and 2% were determined in herding breed mixes and unclassified mixed breeds, respectively. Because of its widespread breed distribution and occurrence in many mixed breed dogs, it is difficult for veterinarians and dog owners to recognise whether MDR1-related drug sensitivity is relevant for an individual animal. This study provides a comprehensive overview of all affected dog breeds and many dog breeds that are probably unaffected on the basis of ∼15,000 worldwide MDR1 genotyping data. Copyright © 2010 Elsevier Ltd. All rights reserved.

  16. 17 CFR 230.165 - Offers made in connection with a business combination transaction.

    Science.gov (United States)

    2010-04-01

    ... legend that urges investors to read the relevant documents filed or to be filed with the Commission because they contain important information. The legend also must explain to investors that they can get...., prospectus) after the filing of a registration statement related to the transaction need not satisfy the...

  17. Review of potential 230-kV cable installation by horizontal directional drilling : Tsawwassen, British Columbia

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-02-29

    As part of the Vancouver Island transmission reinforcement (VITR) project, British Columbia Transmission Corporation (BCTC) is proposing a 4 km long section of overhead line between the existing Tsawwassen substation and the English Bluff terminal. Mill Creek Management Technologies, Inc. proposed that the 4-km installation be performed using underground cables installed by horizontal directional drilling. The Ministry of Energy, Mines and Petroleum Resources of British Columbia commissioned an independent assessment of the potential installation, addressing directional drilling feasibility as well as cable system design. This report presented the results of that assessment. It considered alignment and horizontal directional drills. Cable considerations such as cable design, installation, operation, repair and maintenance were discussed. The report also presented a cost estimate and time schedule. A review of the potential horizontal directional drills showed that the drills should be feasible. In addition, it was found that although the cable system was feasible, there were many effects on power system operation and maintenance that should be evaluated. 4 tabs., 1 fig., 2 appendices.

  18. Page 1 230 A Mary Selvam et al Malkus J S 1952 Tellus 4 71 ...

    Indian Academy of Sciences (India)

    Miller FR and Keshava Murthy R N 1967 Structure of an Arabian sea summer monsoon system,. (Honolulu, University of Hawaii; East–West Press) pp. 94. Ruskin A E and ... Wallace J M and Hobbs P V 1973 Atmospheric science : an introductory survey (New York: Academic Press Inc.) pp. 467. Warner J 1969 J. Aimos, Sci.

  19. 2 CFR Appendix B to Part 230 - Selected Items of Cost

    Science.gov (United States)

    2010-01-01

    ... pension costs caused by a delay in funding the actuarial liability beyond 30 days after each quarter of... the facility was actually used to meet demands during the accounting period. A multi-shift basis...

  20. 49 CFR 230.96 - Main, side, and valve motion rods.

    Science.gov (United States)

    2010-10-01

    ... bore of main rod bearings shall not exceed pin diameters more than 3/32 inch at front or back end. The total lost motion at both ends shall not exceed 5/32 inch. (g) Side rod bearings. The bore of side rod.... The total amount of side motion of each rod on its crank pin shall not exceed 1/4 inch. (e) Oil and...

  1. 36 CFR 230.45 - Recapture of cost-share assistance.

    Science.gov (United States)

    2010-07-01

    ... FLEP. A scheme or device includes, but is not limited to, coercion, fraud or misrepresentation, false claims, or any business dissolution, reorganization, revival, or other legal mechanism designed for or...

  2. 7 CFR 1951.230 - Transfer of security and assumption of loans.

    Science.gov (United States)

    2010-01-01

    ... successor agency under Public Law 103-354 debt(s) exceed the present market value of the security as determined by the State Director, the transferee will assume an amount at least equal to the present value... Public Law 103-354 442-3, “Balance Sheet,” and budget and cash flow information using Form FmHA or its...

  3. Afolabi et al., Afr J Tradit Complement Altern Med. (2013) 10(5):230 ...

    African Journals Online (AJOL)

    AJTCAM

    Moringa oleifera leaves (Asma et al., 2005) and seeds (Lalas and Tsaknis, 2002) are excellent sources of antioxidants. Its extract exerts protective effects by decreasing liver lipid peroxides and enhancing antioxidants (Ashok and. Pari, 2003). Moringa preparations have been cited in the scientific literatures as having ...

  4. 49 CFR 1544.230 - Fingerprint-based criminal history records checks (CHRC): Flightcrew members.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Fingerprint-based criminal history records checks... Fingerprint-based criminal history records checks (CHRC): Flightcrew members. (a) Scope. This section applies... each flightcrew member has undergone a fingerprint-based CHRC that does not disclose that he or she has...

  5. 40 CFR 230.61 - Chemical, biological, and physical evaluation and testing.

    Science.gov (United States)

    2010-07-01

    ... appropriate physical and chemical environmental characteristics. (d) Physical tests and evaluation. The effect... physical tests and evaluations as are justified and deemed necessary. Such tests may include sieve tests... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Chemical, biological, and physical...

  6. 17 CFR 230.498 - Summary Prospectuses for open-end management investment companies.

    Science.gov (United States)

    2010-04-01

    ... electronic filing system; toll free (or collect) telephone number; and e-mail address that investors can use... other information are available from a financial intermediary (such as a broker-dealer or bank) through....S.C. 817(d)), as applicable, and is not intended for use by other investors. (2) Contents of the...

  7. Page 1 Bull. Mater, Sci, Vol. 20, No. 2, April 1997, pp. 141-230. (C ...

    Indian Academy of Sciences (India)

    fullerenes (figure 1) formed entirely of carbon in sp-hybridized state. The fullerenes are considered as the third allotrope of carbon after diamond and graphite. The stability of C molecule is due to the structure in which the carbon atoms are arranged at the 60 vertices of a truncated icosahedron composed of 32 faces, a.

  8. Sud du Sahara | Page 230 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Read more about Appartenance ethnique, terres et conflits en Afrique de l'Est : études de cas menées au Kenya, en Ouganda, au Rwanda et en Tanzanie. Langue French. Read more about Ethnicity, Land and Conflict in Eastern Africa : Case Studies from Kenya, Rwanda, Tanzania and Uganda. Langue English.

  9. 40 CFR 230.98 - Mitigation banks and in-lieu fee programs.

    Science.gov (United States)

    2010-07-01

    ... district engineer must consider the relative importance of both the impacted and the preserved aquatic resources in sustaining watershed functions. (7) Credits provided by riparian areas, buffers, and uplands..., buffer, and uplands respectively. Non-aquatic resources can only be used as compensatory mitigation for...

  10. 40 CFR 1051.230 - How do I select engine families?

    Science.gov (United States)

    2010-07-01

    ... additives such as pigments, plasticizers, and UV inhibitors). (2) Emission-control strategy. (3) Production methods. This does not apply to differences in production methods that would not affect emission...

  11. 40 CFR 1060.230 - How do I select emission families?

    Science.gov (United States)

    2010-07-01

    ...) Production method. (3) Types of connectors and fittings (material, approximate wall thickness, etc.) for fuel..., including any pigments, plasticizers, UV inhibitors, or other additives that are expected to affect control of emissions. (2) Production method. (3) Relevant characteristics of fuel cap design for fuel systems...

  12. Sexospécificités | Page 230 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Theoretical Perspectives on Gender and Development démystifie la théorie des questions d'égalité entre les sexes et du développement et montre comment elle joue un rôle important dans la vie quotidienne. On y explore l'évolution de l'égalité entre les sexes et de la théorie du développement, présente ...

  13. Blood Transfusions in Dogs and Cats Receiving Hemodialysis: 230 Cases (June 1997-September 2012).

    Science.gov (United States)

    Langston, C; Cook, A; Eatroff, A; Mitelberg, E; Chalhoub, S

    2017-03-01

    Multiple factors exist that contribute to anemia in dogs and cats receiving hemodialysis, can necessitate transfusion. To describe blood product usage in dogs and cats with acute and chronic kidney disease that were treated with intermittent hemodialysis to determine risk factors associated with the requirement for blood product transfusion. 83 cats and 147 dogs undergoing renal replacement therapy at the Animal Medical Center for acute or chronic kidney disease. Retrospective medical record review of all dogs and cats receiving renal replacement therapy for kidney disease, from June 1997 through September 2012. Blood products (whole blood, packed RBCs, or stromal-free hemoglobin) were administered to 87% of cats and 32% of dogs. The number of dialysis treatments was associated with the requirement for transfusion in cats (adjusted OR 2.21, 95% CI 1.13, 4.32), but not in dogs (adjusted OR 0.98, 95% CI 0.95, 1.03). Administration of a blood product was associated with a higher likelihood of death in dogs (OR 3.198, 95% CI 1.352, 7.565; P = .0098), but not in cats (OR 1.527, 95% CI 0.5404, 4.317, P = .2). Veterinary hospitals with a hemodialysis unit should have reliable and rapid access to safe blood products in order to meet the needs of dogs and cats receiving dialysis. Copyright © 2017 The Authors. Journal of Veterinary Internal Medicine published by Wiley Periodicals, Inc. on behalf of the American College of Veterinary Internal Medicine.

  14. 12 CFR Appendix B to Part 230 - Model Clauses and Sample Forms

    Science.gov (United States)

    2010-01-01

    ... percentage yield of __%. (b) Compounding and crediting (i) Frequency Interest will be compounded . Interest... (i) Fixed-rate accounts The interest rate on your account is __% with an annual percentage yield of __%. You will be paid this rate . (ii) Variable-rate accounts The interest rate on your account is __% with...

  15. 12 CFR 230.11 - Additional disclosure requirements for overdraft services.

    Science.gov (United States)

    2010-01-01

    ...), using a format substantially similar to Sample Form B-10 in Appendix B to this part. (b) Advertising... advertising disclosures. Paragraph (b)(1) of this section does not apply to: (i) An advertisement promoting a..., such as a telephone response machine, ATM, or an institution's Internet site, is not a response to a...

  16. 40 CFR 280.230 - Operating an underground storage tank or underground storage tank system.

    Science.gov (United States)

    2010-07-01

    ... underground storage tank or underground storage tank system. (a) Operating an UST or UST system prior to...) Operating an UST or UST system after foreclosure. The following provisions apply to a holder who, through..., the purchaser must decide whether to operate or close the UST or UST system in accordance with...

  17. 40 CFR 1054.230 - How do I select emission families?

    Science.gov (United States)

    2010-07-01

    ... POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW, SMALL NONROAD SPARK-IGNITION ENGINES AND EQUIPMENT... control for engine operation, other than governing (mechanical or electronic). (9) The numerical level of... family. You may include dedicated-fuel versions of this same engine model in the same engine family, as...

  18. 40 CFR 1045.230 - How do I select engine families?

    Science.gov (United States)

    2010-07-01

    ... POLLUTION CONTROLS CONTROL OF EMISSIONS FROM SPARK-IGNITION PROPULSION MARINE ENGINES AND VESSELS Certifying... control for engine operation, other than governing (i.e., mechanical or electronic). (6) The numerical... engine family. You may include dedicated-fuel versions of this same engine model in the same engine...

  19. Accident localization system with jet condensers for VVER 440-V 230 NPP at Jaslovske Bohunice

    International Nuclear Information System (INIS)

    Murani, J.

    1995-01-01

    The operational safety of the V1 nuclear power plant (NPP) is unsatisfactory and does not correspond to present requirements as to nuclear safety. Further NPP operation after 1995 is conditional on nuclear safety enhancement to a level comparable with that in West European countries. This aim should be achieved by a principal reconstruction involving in addition to others also backfitting the V1 NPP with technical facilities aimed at coping with a design basis accident (DBA).To cope with such an accident the Power Equipment Research Institute (VUEZ) designed an accident localization system with jet condensers. This system consists of (a) an air trap (one for each unit, mutually interconnected) with an expansion bell enclosed within, placed on a plate with 200 pipes of jet condensers passing through, and (b) a connecting duct between the hermetic zone and the air trap. The vertical jet condenser is an essential element of the system designed for steam condensation. Apart from condensation it serves as a water seal separating units 1 and 2.Demonstration tests of the jet condenser (model 1:1) condensing function were carried out at the testing unit of the All-Union Research Institute for NPP Operation (VNIIAES), Moscow in Kashir, 11-22 September 1992. These experiments proved the jet condenser ability to ensure complete condensation of the steam produced. Experimental verification of the sealing function (model 1:1) was carried out at the testing unit of the VUEZ Tlmace. These experiments concerning the dynamics and overpressure in the free space above the pool were close to the conditions in the air trap during DBA. The jet condenser height was proved to be sufficient to ensure the sealing function. Design and experimental work has been implemented in close cooperation with Russian experts Mr. V.N. Bulynin from the VNIIAES, Moscow, and Mr. M.V. Kuznecov from the Scientific and Engineering Center for Nuclear and Radiological Safety, Moscow. (orig.)

  20. 33 CFR Appendix A to Part 230 - Processing Corps NEPA Documents

    Science.gov (United States)

    2010-07-01

    ... Director of Civil Works or Chief, Planning Division will approve the project and sign the record of... Corps NEPA Documents NEFA documents for Civil Works activities other than permits will be processed in... construction of a project prior to receiving ASA(CW) recommendations, the Director of Civil Works is the...