WorldWideScience

Sample records for actinium 229

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.

    1977-01-01

    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.

    1979-01-01

    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  3. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  4. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  5. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  6. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W

    1950-06-16

    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  7. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  8. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  9. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  10. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.

    1993-01-01

    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  13. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  14. 22 CFR 229.310 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recruitment. 229.310 Section 229.310 Foreign... and Recruitment Prohibited § 229.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 229.300 through 229.310 apply shall not discriminate on the basis of sex in the recruitment and...

  15. Dicty_cDB: SLH229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH229 (Link to dictyBase) - - - Contig-U15799-1 SLH229Z (Link... to Original site) - - SLH229Z 269 - - - - Show SLH229 Library SL (Link to library) Clone ID SLH229 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH229Q.Seq.d/ Representative seq. ID SLH22...9Z (Link to Original site) Representative DNA sequence >SLH229 (SLH229Q) /CSM/SL/SLH2-B/SLH229Q.Seq.d/ XXXXX...E Sequences producing significant alignments: (bits) Value SLH229 (SLH229Q) /CSM/SL/SLH2-B/SLH2

  16. 22 CFR 229.540 - Advertising.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Advertising. 229.540 Section 229.540 Foreign... in Education Programs or Activities Prohibited § 229.540 Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation, specification, or discrimination based on...

  17. 22 CFR 229.510 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Recruitment. 229.510 Section 229.510 Foreign... in Education Programs or Activities Prohibited § 229.510 Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring...

  18. 22 CFR 229.500 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 229.500 Section 229.500 Foreign... OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 229.500 Employment. (a) General. (1) No person shall...

  19. 32 CFR 229.19 - Report.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Report. 229.19 Section 229.19 National Defense... ARCHAEOLOGICAL RESOURCES: UNIFORM REGULATIONS § 229.19 Report. (a) Each Federal land manager, when requested by... comply with section 13 of the Act and comprehensively report on activities carried out under provisions...

  20. 22 CFR 229.405 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 229.405 Section 229.405 Foreign... Programs or Activities Prohibited § 229.405 Housing. (a) Generally. A recipient shall not, on the basis of... services or benefits related to housing, except as provided in this section (including housing provided...

  1. 20 CFR 229.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... MINIMUM GUARANTEE General § 229.2 Definitions. The following definitions are used in this part: Annuity... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Definitions. 229.2 Section 229.2 Employees... average wages of all wage earners from 1951 although the second year before the year the worker dies or...

  2. Hyperfine structure in 229gTh3+ as a probe of the 229gTh→ 229mTh nuclear excitation energy.

    Science.gov (United States)

    Beloy, K

    2014-02-14

    We identify a potential means to extract the 229gTh→ 229mTh nuclear excitation energy from precision microwave spectroscopy of the 5F(5/2,7/2) hyperfine manifolds in the ion 229gTh3+. The hyperfine interaction mixes this ground fine structure doublet with states of the nuclear isomer, introducing small but observable shifts to the hyperfine sublevels. We demonstrate how accurate atomic structure calculations may be combined with the measurement of the hyperfine intervals to quantify the effects of this mixing. Further knowledge of the magnetic dipole decay rate of the isomer, as recently reported, allows an indirect determination of the nuclear excitation energy.

  3. 20 CFR 229.45 - Employee benefit.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Employee benefit. 229.45 Section 229.45 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT SOCIAL SECURITY OVERALL MINIMUM GUARANTEE Computation of the Overall Minimum Rate § 229.45 Employee benefit. The original...

  4. 49 CFR 229.109 - Safety valves.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Safety valves. 229.109 Section 229.109..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Steam Generators § 229.109 Safety valves. Every steam generator shall be equipped with at least two safety valves that have a...

  5. 22 CFR 229.525 - Fringe benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Fringe benefits. 229.525 Section 229.525... Employment in Education Programs or Activities Prohibited § 229.525 Fringe benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital...

  6. Nuclear structure of $^{229}$Th

    CERN Document Server

    Ruchowska, E; Zylicz, J; Mach, H; Kvasil, J; Algora, A; Amzal, N; Bäck, T; García-Borge, M J; Boutami, R; Butler, P A; Cederkäll, J; Cederwall, Bo; Fogelberg, B; Fraile-Prieto, L M; Fynbo, H O U; Hagebø, E; Hoff, P; Gausemel, H; Jungclaus, A; Kaczarowski, R; Kérek, A; Kurcewicz, W; Lagergren, K; Nacher, E; Rubio, B; Syntfeld, A; Tengblad, O; Wasilewski, A A

    2006-01-01

    Lifetimes of excited states in $^{229}$Th, populated in the $\\beta$-decay of $^{229}$Ac, have been measured using the advanced time-delayed $\\beta\\gamma\\gamma$(t)-method. Half-lives of 14 states have been determined including 11 of them for the first time. Twenty-seven new $\\gamma$-lines have been introduced into the $\\beta$-decay scheme of $^{229}$Ac based on results of $\\gamma\\gamma$-coincidence measurements. Reduced transition probabilities have been determined for more than 70 $\\gamma$-transitions in $^{229}$Th. Average ∣D$_{0}$∣ values of 0.029(1), 0.077(3) and 0.024(5) $e$ fm have been deduced for the lowest K$^{\\pi}$=1/2$^{\\pm}$ , 3/2$^{\\pm}$ and 5/2$^{\\pm}$ parity partner bands, respectively. Excited states in $^{229}$Th and experimental transition rates have been interpreted within the quasiparticle-plus-phonon model. The half-life of the 3.5 eV , 3/2$^{+}$ isomeric state is predicted to be about 10 h. Potential energy surfaces on the ($\\beta_{2}\\,,\\,\\beta_{3}$) plane for the lowest single quasi...

  7. 49 CFR 229.73 - Wheel sets.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Wheel sets. 229.73 Section 229.73 Transportation... TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Suspension System § 229.73 Wheel sets. (a...) when applied or turned. (b) The maximum variation in the diameter between any two wheel sets in a three...

  8. 12 CFR 229.21 - Civil liability.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Civil liability. 229.21 Section 229.21 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... Availability Policies § 229.21 Civil liability. (a) Civil liability. A bank that fails to comply with any...

  9. 49 CFR 229.97 - Grounding fuel tanks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Grounding fuel tanks. 229.97 Section 229.97 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 229.97 Grounding fuel tanks. Fuel tanks and related piping shall be electrically grounded. ...

  10. 49 CFR 229.105 - Steam generator number.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam generator number. 229.105 Section 229.105..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Steam Generators § 229.105 Steam generator number. An identification number shall be marked on the steam generator's...

  11. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

    2016-01-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  12. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  13. 48 CFR 229.402-70 - Additional clauses.

    Science.gov (United States)

    2010-10-01

    ... performance will be in Spain. (f) Use the clause at 252.229-7006, Value Added Tax Exclusion (United Kingdom.... (i) Use the clause at 252.229-7009, Relief from Customs Duty and Value Added Tax on Fuel (Passenger... SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS TAXES Contract Clauses 229.402-70...

  14. 49 CFR 229.121 - Locomotive cab noise.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locomotive cab noise. 229.121 Section 229.121... § 229.121 Locomotive cab noise. (a) Performance standards for locomotives. (1) When tested for static noise in accordance with paragraph (a)(3) of this section, all locomotives of each design or model that...

  15. 49 CFR 238.229 - Safety appliances-general.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Safety appliances-general. 238.229 Section 238.229... Equipment § 238.229 Safety appliances—general. (a) Except as provided in this part, all passenger equipment continues to be subject to the safety appliance requirements contained in Federal statute at 49 U.S.C...

  16. 12 CFR 229.39 - lnsolvency of bank.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false lnsolvency of bank. 229.39 Section 229.39 Banks... AVAILABILITY OF FUNDS AND COLLECTION OF CHECKS (REGULATION CC) Collection of Checks § 229.39 lnsolvency of bank..., collecting, depositary, or returning bank that suspends payment, and which is not paid, shall be returned by...

  17. 48 CFR 252.229-7001 - Tax relief.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Tax relief. 252.229-7001... Clauses 252.229-7001 Tax relief. As prescribed in 229.402-70(a), use the following clause: Tax Relief (JUN 1997) (a) Prices set forth in this contract are exclusive of all taxes and duties from which the United...

  18. The decay scheme of 229Ra

    International Nuclear Information System (INIS)

    Yang, W.F.; Yuan, S.G.; Fang, K.M.; Shen, S.F.; Mou, W.T.; Zhang, X.Q.; Li, Z.Q.

    1997-01-01

    By bombarding the natural thorium targets with 14 MeV neutrons, 229 Ra was produced through the reaction 232 Th(n,α) 229 Ra. The radium activities were separated from the irradiated targets by coprecipitation with the BaCl 2 . A total of 18 new weak γ rays with energies of 14.5, 15.6, 18.8, 21.8, 22.5, 44.0, 47.5, 55.0, 63.0, 69.6, 93.6, 94.1, 98.5, 102.2, 104.5, 106.1, 161.1, and 171.5 keV which could be assigned to the decay of 229 Ra were observed in the isolated radium fractions employing high resolution HPGe detectors and γ(X)-γ coincidence methods. A decay scheme of 229 Ra based on these observations is proposed. (orig.). With 2 figs

  19. 49 CFR 229.206 - Design requirements.

    Science.gov (United States)

    2010-10-01

    ...-climber, emergency egress, emergency interior lighting, and interior configuration design requirements set... 49 Transportation 4 2010-10-01 2010-10-01 false Design requirements. 229.206 Section 229.206..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Locomotive Crashworthiness Design...

  20. 49 CFR 229.43 - Exhaust and battery gases.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Exhaust and battery gases. 229.43 Section 229.43... § 229.43 Exhaust and battery gases. (a) Products of combustion shall be released entirely outside the... conditions. (b) Battery containers shall be vented and batteries kept from gassing excessively. ...

  1. 7 CFR 58.229 - Filler and packaging equipment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Filler and packaging equipment. 58.229 Section 58.229....229 Filler and packaging equipment. All filling and packaging equipment shall be of sanitary... equipment should comply with the 3-A Sanitary Standards for equipment for Packaging Dry Milk and Dry Milk...

  2. 49 CFR 229.64 - Plain bearings.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Plain bearings. 229.64 Section 229.64 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION....64 Plain bearings. A plain bearing box shall contain visible free oil and may not be cracked to the...

  3. 49 CFR 229.46 - Brakes: General.

    Science.gov (United States)

    2010-10-01

    ... regulating all pressures, including but not limited to the automatic and independent brake valves, operate as intended and that the water and oil have been drained from the air brake system. ... 49 Transportation 4 2010-10-01 2010-10-01 false Brakes: General. 229.46 Section 229.46...

  4. 48 CFR 229.170-3 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reports. 229.170-3 Section... DEFENSE GENERAL CONTRACTING REQUIREMENTS TAXES General 229.170-3 Reports. The contracting officer shall submit a report to the designated Security Assistance Office when a foreign government or entity imposes...

  5. 49 CFR 229.55 - Piston travel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Piston travel. 229.55 Section 229.55... Piston travel. (a) Brake cylinder piston travel shall be sufficient to provide brake shoe clearance when... piston travel may not exceed 11/2 inches less than the total possible piston travel. The total possible...

  6. 7 CFR 2.29 - Chief Economist.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Chief Economist. 2.29 Section 2.29 Agriculture Office... Economist. (a) The following delegations of authority are made by the Secretary of Agriculture to the Chief Economist: (1) Related to economic analysis. (i) Coordinate economic analyses of, and review Department...

  7. 49 CFR 229.69 - Side bearings.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Side bearings. 229.69 Section 229.69....69 Side bearings. (a) Friction side bearings with springs designed to carry weight may not have more than 25 percent of the springs in any one nest broken. (b) Friction side bearings may not be run in...

  8. 49 CFR 229.217 - Fuel tank.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fuel tank. 229.217 Section 229.217 Transportation... tank. (a) External fuel tanks. Locomotives equipped with external fuel tanks shall, at a minimum... to the fuel tank safety requirements of § 238.223 or § 238.423 of this chapter. The Director of the...

  9. 49 CFR 229.139 - Sanitation, servicing requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, servicing requirements. 229.139... Cab Equipment § 229.139 Sanitation, servicing requirements. (a) The sanitation compartment of each... intended such that: (1) All mechanical systems shall function; (2) Water shall be present in sufficient...

  10. 49 CFR 229.91 - Motors and generators.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Motors and generators. 229.91 Section 229.91 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION....91 Motors and generators. A motor or a generator may not have any of the following conditions: (a) Be...

  11. 17 CFR 229.903 - (Item 903) Summary.

    Science.gov (United States)

    2010-04-01

    ... effect on investors, including, but not limited to: (i) Changes in the business plan, voting rights, cash... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 903) Summary. 229.903 Section 229.903 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD...

  12. On the direct detection of {sup 229m}Th

    Energy Technology Data Exchange (ETDEWEB)

    Wense, Lars von der

    2017-02-03

    The measurement of time has always been an important tool in science and society. Today's most precise time and frequency measurements are performed with optical atomic clocks. However, these clocks could potentially be outperformed by a ''nuclear clock'', which employs a nuclear transition instead of an atomic shell transition for time measurement. Among the 176 000 known nuclear excited states, there is only one nuclear state that would allow for the development of a nuclear clock using currently available technology. This is the isomeric first excited state of {sup 229}Th, denoted as {sup 229m}Th. Despite 40 years of past research, no direct decay detection of this nuclear state has so far been achieved. In this thesis, measurements are described that have led to the first direct detection of the ground-state decay of {sup 229m}Th. Two decay channels (radiative decay and internal conversion) are experimentally investigated. Only the investigation of the internal conversion decay channel has led to the successful observation of the first excited isomeric nuclear state of {sup 229}Th. Based on this direct detection, a new nuclear laser excitation scheme for {sup 229m}Th is proposed. This excitation scheme circumvents the general assumed requirement of a better knowledge of the isomeric energy value, thereby paving the way for nuclear laser spectroscopy of {sup 229m}Th. Many of the presented results have so far been unpublished. This includes results of the investigation of a potential radiative decay channel of {sup 229m}Th, a negative result in the search for an isomeric decay during extraction of {sup 229}Th{sup 1+}, investigation of the isomeric decay in thorium molecules and on an MgF{sub 2}-coated surface, as well as a first report of the isomeric half-life for neutral {sup 229}Th.

  13. 49 CFR 229.57 - Foundation brake gear.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Foundation brake gear. 229.57 Section 229.57 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Foundation brake gear. A lever, rod, brake beam, hanger, or pin may not be worn through more than 30 percent...

  14. 17 CFR 229.1000 - (Item 1000) Definitions.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1000) Definitions. 229.1000 Section 229.1000 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION...

  15. 17 CFR 229.1016 - (Item 1016) Exhibits.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1016) Exhibits. 229.1016 Section 229.1016 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION S-...

  16. 48 CFR 52.229-8 - Taxes-Foreign Cost-Reimbursement Contracts.

    Science.gov (United States)

    2010-10-01

    ...-Reimbursement Contracts. 52.229-8 Section 52.229-8 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.229-8 Taxes—Foreign Cost-Reimbursement Contracts. As prescribed in 29.402-2(a), insert the following clause: Taxes—Foreign Cost-Reimbursement Contracts (MAR 1990) (a) Any tax or duty from which the...

  17. 22 CFR 229.400 - Education programs or activities.

    Science.gov (United States)

    2010-04-01

    ... SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 229.400 Education programs or activities... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Education programs or activities. 229.400...

  18. 48 CFR 252.229-7002 - Customs exemptions (Germany).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Customs exemptions... of Provisions And Clauses 252.229-7002 Customs exemptions (Germany). As prescribed in 229.402-70(b), use the following clause: Customs Exemptions (Germany) (JUN 1997) Imported products required for the...

  19. Prospects for Searching for Time-Reversal Violation In Pa-229

    Science.gov (United States)

    Singh, Jaideep

    2017-09-01

    Certain pear-shaped nuclei are expected to have enhanced sensitivity to time-reversal and parity-violating interactions originating within the nuclear medium. In particular, Pa-229 is thought to be about 100,000 times more sensitive than Hg-199 which currently sets some of the most stringent limits for these types of interactions. Several challenges would first have to be addressed in order to take advantage of this discovery potential. First, there is not currently a significant source of Pa-229; however, there are plans to harvest Pa-229 from the FRIB beam dump. Second, the spin-5/2 nucleus of Pa-229 limits its coherence time while also making it sensitive to systematic effects related to local field gradients. On the other hand, this also gives Pa-229 an additional source of signal in the form of a magnetic quadrupole moment (MQM) which violates the same symmetries as an EDM but is not observable in spin-1/2 systems. Third, in order to compensate for the small atom numbers and short coherence times, the Pa-229 atoms would have to be probed with exceptionally large electric & magnetic fields that are only possible if Pa-229 is a part of a polar molecule or embedded inside of an optical crystal. I will present an our plans to test some of these concepts using stable Pr-141.

  20. 48 CFR 252.229-7005 - Tax exemptions (Spain).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Tax exemptions (Spain... of Provisions And Clauses 252.229-7005 Tax exemptions (Spain). As prescribed in 229.402-70(e), use the following clause: Tax Exemptions (Spain) (JUN 1997) (a) The Contractor represents that the...

  1. 17 CFR 229.308 - (Item 308) Internal control over financial reporting.

    Science.gov (United States)

    2010-04-01

    ... over financial reporting. 229.308 Section 229.308 Commodity and Securities Exchanges SECURITIES AND... § 229.308 (Item 308) Internal control over financial reporting. (a) Management's annual report on internal control over financial reporting. Provide a report of management on the registrant's internal...

  2. 22 CFR 229.455 - Textbooks and curricular material.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Textbooks and curricular material. 229.455 Section 229.455 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education Programs or Activitie...

  3. 17 CFR 229.1011 - (Item 1011) Additional information.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1011) Additional information. 229.1011 Section 229.1011 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975...

  4. The nuclear structure of [sup 229]Pa from the [sup 231]Pa(p,t)[sup 229]Pa and [sup 230]Th(p,2n[gamma])[sup 229]Pa reactions

    Energy Technology Data Exchange (ETDEWEB)

    Levon, A.I. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); De Boer, J. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Graw, G. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Hertenberger, R. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Hofer, D. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Kvasil, J. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Loesch, A. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Mueller-Zanotti, E. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Wuerkner, M. (Sektion Physik, University of Munich, D-85748 Garching (Germany)); Baltzer, H. (Institut fuer Strahlen- und Kernphysik, University of Bonn, D-53115 Bonn (Germany)); Grafen, V. (Institut fuer Strahlen- und Kernphysik, University of Bonn, D-53115 Bonn (Germany)); Guenther, C. (Institut fuer Strahlen- und Kernphysik, University of

    1994-08-29

    The level structure of the [sup 229]Pa nucleus has been investigated by means of the [sup 231]Pa(p,t)[sup 229]Pa and [sup 230]Th(p,2n[gamma])[sup 229]Pa reactions. Triton angular-distribution measurements were subjected to a CCBA analysis and combined with the results of in-beam conversion electron and [gamma]-ray spectroscopy to establish a level scheme. Two low-lying bands of opposite parity were observed up to spins (23/2)[sup -] and (17/2)[sup +], respectively. Rotational bands built on some 0[sup +] excitations of the even-even core can be assigned. The lowest states of three further low-lying bands are observed. The level scheme is interpreted in terms of an octupole-deformed core with an unpaired proton. From the E1/E2 branching ratio the electric dipole moment can be deduced vertical stroke D[sub 0]vertical stroke =(0.09 [+-]0.04) e .fm. ((orig.))

  5. Evidence for an Ancestral Association of Human Coronavirus 229E with Bats.

    Science.gov (United States)

    Corman, Victor Max; Baldwin, Heather J; Tateno, Adriana Fumie; Zerbinati, Rodrigo Melim; Annan, Augustina; Owusu, Michael; Nkrumah, Evans Ewald; Maganga, Gael Darren; Oppong, Samuel; Adu-Sarkodie, Yaw; Vallo, Peter; da Silva Filho, Luiz Vicente Ribeiro Ferreira; Leroy, Eric M; Thiel, Volker; van der Hoek, Lia; Poon, Leo L M; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix

    2015-12-01

    We previously showed that close relatives of human coronavirus 229E (HCoV-229E) exist in African bats. The small sample and limited genomic characterizations have prevented further analyses so far. Here, we tested 2,087 fecal specimens from 11 bat species sampled in Ghana for HCoV-229E-related viruses by reverse transcription-PCR (RT-PCR). Only hipposiderid bats tested positive. To compare the genetic diversity of bat viruses and HCoV-229E, we tested historical isolates and diagnostic specimens sampled globally over 10 years. Bat viruses were 5- and 6-fold more diversified than HCoV-229E in the RNA-dependent RNA polymerase (RdRp) and spike genes. In phylogenetic analyses, HCoV-229E strains were monophyletic and not intermixed with animal viruses. Bat viruses formed three large clades in close and more distant sister relationships. A recently described 229E-related alpaca virus occupied an intermediate phylogenetic position between bat and human viruses. According to taxonomic criteria, human, alpaca, and bat viruses form a single CoV species showing evidence for multiple recombination events. HCoV-229E and the alpaca virus showed a major deletion in the spike S1 region compared to all bat viruses. Analyses of four full genomes from 229E-related bat CoVs revealed an eighth open reading frame (ORF8) located at the genomic 3' end. ORF8 also existed in the 229E-related alpaca virus. Reanalysis of HCoV-229E sequences showed a conserved transcription regulatory sequence preceding remnants of this ORF, suggesting its loss after acquisition of a 229E-related CoV by humans. These data suggested an evolutionary origin of 229E-related CoVs in hipposiderid bats, hypothetically with camelids as intermediate hosts preceding the establishment of HCoV-229E. The ancestral origins of major human coronaviruses (HCoVs) likely involve bat hosts. Here, we provide conclusive genetic evidence for an evolutionary origin of the common cold virus HCoV-229E in hipposiderid bats by analyzing a

  6. 49 CFR 229.75 - Wheels and tire defects.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 229.75 Section 229.75....75 Wheels and tire defects. Wheels and tires may not have any of the following conditions: (a) A... two adjoining spots that are each two or more inches in length. (e) A seam running lengthwise that is...

  7. 17 CFR 229.914 - (Item 914) Pro forma financial statements: selected financial data.

    Science.gov (United States)

    2010-04-01

    ... statements: selected financial data. 229.914 Section 229.914 Commodity and Securities Exchanges SECURITIES... Transactions § 229.914 (Item 914) Pro forma financial statements: selected financial data. (a) In addition to... statements are required. (c) The pro forma financial statements required by paragraph (b) of this Item (§ 229...

  8. 17 CFR 229.1115 - (Item 1115) Certain derivatives instruments.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1115) Certain derivatives instruments. 229.1115 Section 229.1115 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF...

  9. 17 CFR 229.902 - (Item 902) Individual partnership supplements.

    Science.gov (United States)

    2010-04-01

    ... transaction, including, but not limited to, federal income tax consequences, for investors in the partnership... partnership; (iv) Other assets held by the partnership; (v) Other liabilities of the partnership; (vi) The... partnership supplements. 229.902 Section 229.902 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

  10. 42 CFR 436.229 - Optional targeted low-income children.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Optional targeted low-income children. 436.229... Options for Coverage as Categorically Needy Options for Coverage of Families and Children and Aged, Blind, and Disabled Individuals, Including Pregnant Women § 436.229 Optional targeted low-income children...

  11. 49 CFR 229.9 - Movement of non-complying locomotives.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of non-complying locomotives. 229.9... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS General § 229.9 Movement of non... restrictions necessary for safely conducting the movement; (2)(i) The engineer in charge of the movement of the...

  12. Decay schemes of the radioactive nuclei A = 225 to 229. Skhemy raspada radioaktivnykh yader A = 225 - 229

    Energy Technology Data Exchange (ETDEWEB)

    Dzhelepov, B S; Ivanov, R B; Mikhailova, M A

    1976-01-01

    This monograph is devoted to properties of atomic nuclei with mass numbers A = 225 to 229. The book collects and systematizes all of the experimental data characterizing properties of radioactive isotopes: information concerning masses of nuclei, magnetic and electric moments, lifetimes of nuclear states, the most reliable information on characteristics of radiations, quantum characteristics of levels and other properties of the studied nuclei. On basis of a critical analysis of the totality of information, decay schemes of radioactive nuclei with mass numbers A = 225 to 229 were constructed, as well as the series of excited states of the isotopes which lie in this region of nuclei.

  13. Production of Thorium-229 at the ORNL High Flux Isotope Reactor

    International Nuclear Information System (INIS)

    Boll, Rose Ann; Garland, Marc A.; Mirzadeh, Saed

    2008-01-01

    The investigation of targeted cancer therapy using -emitters has developed considerably in recent years and clinical trials have generated promising results. In particular, the initial clinical trials for treatment of acute myeloid leukemia have demonstrated the effectiveness of the -emitter 213Bi in killing cancer cells. Pre-clinical studies have also shown the potential application of both 213Bi and its 225Ac parent radionuclide in a variety of cancer systems and targeted radiotherapy. Bismuth-213 is obtained from a radionuclide generator system from decay of the 10-d 225Ac parent, a member of the 7340-y 229Th chain. Currently, 233U is the only viable source for high purity 229Th; however, due to increasing difficulties associated with 233U safeguards, processing additional 233U is presently unfeasible. The recent decision to downblend and dispose of enriched 233U further diminished the prospects for extracting 229Th from 233U stock. Nevertheless, the anticipated growth in demand for 225Ac may soon exceed the levels of 229Th (∼40 g or ∼8 Ci; ∼80 times the current ORNL 229Th stock) present in the aged 233U stockpile. The alternative routes for the production of 229Th, 225Ra and 225Ac include both reactor and accelerator approaches. Here, we describe production of 229Th via neutron transmutation of 226Ra targets in the ORNL High Flux Isotope Reactor (HFIR).

  14. 42 CFR 435.229 - Optional targeted low-income children.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Optional targeted low-income children. 435.229... Coverage of Families and Children § 435.229 Optional targeted low-income children. The agency may provide Medicaid to— (a) All individuals under age 19 who are optional targeted low-income children as defined in...

  15. 12 CFR 229.36 - Presentment and issuance of checks.

    Science.gov (United States)

    2010-01-01

    ... Section 229.36 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM AVAILABILITY OF FUNDS AND COLLECTION OF CHECKS (REGULATION CC) Collection of Checks § 229... on the check, whether in magnetic ink or in fractional form; (3) At any branch or head office, if the...

  16. Evidence for an Ancestral Association of Human Coronavirus 229E with Bats

    NARCIS (Netherlands)

    Corman, Victor Max; Baldwin, Heather J.; Tateno, Adriana Fumie; Zerbinati, Rodrigo Melim; Annan, Augustina; Owusu, Michael; Nkrumah, Evans Ewald; Maganga, Gael Darren; Oppong, Samuel; Adu-Sarkodie, Yaw; Vallo, Peter; da Silva Filho, Luiz Vicente Ribeiro Ferreira; Leroy, Eric M.; Thiel, Volker; van der Hoek, Lia; Poon, Leo L. M.; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix

    2015-01-01

    We previously showed that close relatives of human coronavirus 229E (HCoV-229E) exist in African bats. The small sample and limited genomic characterizations have prevented further analyses so far. Here, we tested 2,087 fecal specimens from 11 bat species sampled in Ghana for HCoV-229E-related

  17. 48 CFR 229.170 - Reporting of foreign taxation on U.S. assistance programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reporting of foreign taxation on U.S. assistance programs. 229.170 Section 229.170 Federal Acquisition Regulations System... General 229.170 Reporting of foreign taxation on U.S. assistance programs. ...

  18. 48 CFR 229.170-2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... acquisition of services; (3) Generally is implemented through letters of offer and acceptance, other country... DEFENSE GENERAL CONTRACTING REQUIREMENTS TAXES General 229.170-2 Policy. (a) By law, bilateral agreements...

  19. 22 CFR 229.105 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 229.105 Definitions. As used in... awards Federal financial assistance, or by a recipient, as a condition to becoming a recipient... institution of vocational education, as defined in this section. Federal financial assistance means any of the...

  20. 48 CFR 252.229-7004 - Status of contractors as a direct contractor (Spain).

    Science.gov (United States)

    2010-10-01

    ... direct contractor (Spain). 252.229-7004 Section 252.229-7004 Federal Acquisition Regulations System... contractor (Spain). As prescribed in 229.402-70(d), use the following clause: Status of Contractor as a Director Contractor (Spain) (JUN 1997) (a) “Direct Contractor,” as used in this clause, means an individual...

  1. 17 CFR 229.308T - (Item 308T) Internal control over financial reporting.

    Science.gov (United States)

    2010-04-01

    ... over financial reporting. 229.308T Section 229.308T Commodity and Securities Exchanges SECURITIES AND... § 229.308T (Item 308T) Internal control over financial reporting. Note to Item 308T: This is a special... internal control over financial reporting. Provide a report of management on the registrant's internal...

  2. 22 CFR 229.450 - Athletics.

    Science.gov (United States)

    2010-04-01

    ... Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS... Programs or Activities Prohibited § 229.450 Athletics. (a) General. No person shall, on the basis of sex...) Opportunity to receive coaching and academic tutoring; (vi) Assignment and compensation of coaches and tutors...

  3. 20 CFR 229.3 - Other regulations related to this part.

    Science.gov (United States)

    2010-04-01

    ... family relationships which may cause an annuity to be increased under this part. Part 225 explains how... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 229.3 Section 229.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT...

  4. 22 CFR 229.440 - Health and insurance benefits and services.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Health and insurance benefits and services. 229... on the Basis of Sex in Education Programs or Activities Prohibited § 229.440 Health and insurance... insurance benefit, service, policy, or plan to any of its students, a recipient shall not discriminate on...

  5. 17 CFR 229.1012 - (Item 1012) The solicitation or recommendation.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1012) The solicitation or recommendation. 229.1012 Section 229.1012 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND CONSERVATION...

  6. 17 CFR 229.403 - (Item 403) Security ownership of certain beneficial owners and management.

    Science.gov (United States)

    2010-04-01

    ... of certain beneficial owners and management. 229.403 Section 229.403 Commodity and Securities... Management and Certain Security Holders § 229.403 (Item 403) Security ownership of certain beneficial owners and management. (a) Security ownership of certain beneficial owners. Furnish the following information...

  7. 40 CFR 264.229 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 264.229 Section 264.229 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE...

  8. Peptide-Based Membrane Fusion Inhibitors Targeting HCoV-229E Spike Protein HR1 and HR2 Domains

    Directory of Open Access Journals (Sweden)

    Shuai Xia

    2018-02-01

    Full Text Available Human coronavirus 229E (HCoV-229E infection in infants, elderly people, and immunocompromised patients can cause severe disease, thus calling for the development of effective and safe therapeutics to treat it. Here we reported the design, synthesis and characterization of two peptide-based membrane fusion inhibitors targeting HCoV-229E spike protein heptad repeat 1 (HR1 and heptad repeat 2 (HR2 domains, 229E-HR1P and 229E-HR2P, respectively. We found that 229E-HR1P and 229E-HR2P could interact to form a stable six-helix bundle and inhibit HCoV-229E spike protein-mediated cell-cell fusion with IC50 of 5.7 and 0.3 µM, respectively. 229E-HR2P effectively inhibited pseudotyped and live HCoV-229E infection with IC50 of 0.5 and 1.7 µM, respectively. In a mouse model, 229E-HR2P administered intranasally could widely distribute in the upper and lower respiratory tracts and maintain its fusion-inhibitory activity. Therefore, 229E-HR2P is a promising candidate for further development as an antiviral agent for the treatment and prevention of HCoV-229E infection.

  9. 40 CFR 265.229 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.229 Section 265.229 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... qualified chemist or engineer that, to the best of his knowledge and opinion, the design features or...

  10. 12 CFR 229.38 - Liability.

    Science.gov (United States)

    2010-01-01

    ... affect a paying bank's liability to its customer under the U.C.C. or other law. (b) Paying bank's failure... provision, but not both. (c) Comparative negligence. If a person, including a bank, fails to exercise... person under § 229.38(a) shall be diminished in proportion to the amount of negligence or bad faith...

  11. 25 CFR 900.229 - What role will the awarding official play during an appeal?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false What role will the awarding official play during an appeal? 900.229 Section 900.229 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND INDIAN... EDUCATION ASSISTANCE ACT Post-Award Contract Disputes § 900.229 What role will the awarding official play...

  12. 22 CFR 229.120 - Transfers of property.

    Science.gov (United States)

    2010-04-01

    ... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 229.120 Transfers of property... financial assistance to a transferee that operates any education program or activity, and the Federal share...

  13. 48 CFR 252.229-7006 - Value added tax exclusion (United Kingdom).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Value added tax exclusion... CLAUSES Text of Provisions And Clauses 252.229-7006 Value added tax exclusion (United Kingdom). As prescribed in 229.402-70(f), use the following clause: Value Added Tax Exclusion (United Kingdom) (JUN 1997...

  14. Optical spectroscopy of an atomic nucleus: Progress toward direct observation of the {sup 229}Th isomer transition

    Energy Technology Data Exchange (ETDEWEB)

    Hehlen, Markus P., E-mail: hehlen@lanl.gov [Los Alamos National Laboratory, Mailstop E549, Los Alamos, NM 87545 (United States); Greco, Richard R. [Los Alamos National Laboratory, Mailstop E549, Los Alamos, NM 87545 (United States); Rellergert, Wade G.; Sullivan, Scott T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); DeMille, David [Department of Physics, Yale University, New Haven, CT 06511 (United States); Jackson, Robert A. [School of Physical and Geographical Sciences, Keele University, Keele, Staffordshire ST5 5BG (United Kingdom); Hudson, Eric R. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Torgerson, Justin R. [Los Alamos National Laboratory, Mailstop E549, Los Alamos, NM 87545 (United States)

    2013-01-15

    The nucleus of the thorium-229 isotope possesses a first excited nuclear state ({sup 229m}Th) at an exceptionally low energy of 7.8{+-}0.5 eV above the nuclear ground state ({sup 229g}Th), as determined by earlier indirect measurements. This is the only nuclear excited state known that is within the range of optical spectroscopy. This paper reports progress toward detecting the {sup 229m}Th state directly by luminescence spectroscopy in the vacuum ultraviolet spectral region. The estimated natural linewidth of the {sup 229g}Th{r_reversible}{sup 229m}Th isomer transition of 2{pi} Multiplication-Sign 0.1 to 2{pi} Multiplication-Sign 10 mHz is expected to broaden to {approx}10 kHz for {sup 229}Th{sup 4+} doped into a suitable crystal. The factors governing the choice of crystal system and the substantial challenges in acquiring a sufficiently large quantity of {sup 229}Th are discussed. We show that the {sup 229g}Th{r_reversible}{sup 229m}Th transition energy can be identified to within 0.1 nm by luminescence excitation and luminescence spectroscopy using the Advanced Light Source (ALS) at Lawrence Berkeley National Laboratory. This would open the door for subsequent laser-based measurements of the isomer transition and future applications of {sup 229}Th in nuclear clocks. We also show that {sup 233}U-doped materials should produce an intrinsic, continuous, and sufficiently high rate of {sup 229m}Th{yields}{sup 229g}Th luminescence and could be a useful aid in the initial direct search of the isomer transition. - Highlights: Black-Right-Pointing-Pointer Thorium-229 has a long-lived nuclear excited state. Black-Right-Pointing-Pointer It is the only known nuclear isomer within the reach of optical spectroscopy. Black-Right-Pointing-Pointer Thorium-229 doped fluoride crystals may offer sufficiently high luminescence rates. Black-Right-Pointing-Pointer Luminescence excitation spectroscopy in the vacuum ultraviolet spectral region may enable the first direct observation of

  15. 17 CFR 229.1015 - (Item 1015) Reports, opinions, appraisals and negotiations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1015) Reports, opinions, appraisals and negotiations. 229.1015 Section 229.1015 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND...

  16. 22 CFR 229.115 - Assurance required.

    Science.gov (United States)

    2010-04-01

    ... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 229.115 Assurance required. (a... applications for Federal financial assistance or awards of Federal financial assistance contain, be accompanied... assurance. (b) Duration of obligation. (1) In the case of Federal financial assistance extended to provide...

  17. 40 CFR 86.229-94 - Road load force, test weight, and inertia weight class determination.

    Science.gov (United States)

    2010-07-01

    ... inertia weight class determination. 86.229-94 Section 86.229-94 Protection of Environment ENVIRONMENTAL... § 86.229-94 Road load force, test weight, and inertia weight class determination. (a) Flywheels... vehicle weight (pounds) Equivalent test weight (pounds) Inertia weight class (pounds) Up-1,062 1,000 1,000...

  18. 17 CFR 229.1014 - (Item 1014) Fairness of the going-private transaction.

    Science.gov (United States)

    2010-04-01

    ... market prices; (iii) Net book value; (iv) Going concern value; (v) Liquidation value; (vi) Purchase..., going concern value and future prospects of the issuer” will not be considered sufficient disclosure in... going-private transaction. 229.1014 Section 229.1014 Commodity and Securities Exchanges SECURITIES AND...

  19. Characterization of HCoV-229E fusion core: Implications for structure basis of coronavirus membrane fusion

    International Nuclear Information System (INIS)

    Liu Cheng; Feng Youjun; Gao Feng; Zhang Qiangmin; Wang Ming

    2006-01-01

    Human coronavirus 229E (HCoV-229E), a member of group I coronaviruses, has been identified as one of the major viral agents causing respiratory tract diseases in humans for nearly 40 years. However, the detailed molecular mechanism of the membrane fusion mediated by the spike (S) protein of HCoV-229E remains elusive. Here, we report, for the first time, a rationally designed fusion core of HCoV-229E (HR1-SGGRGG-HR2), which was in vitro produced in GST prokaryotic expression system. Multiple lines of experimental data including gel-filtration, chemical cross-linking, and circular diagram (CD) demonstrated that the HCoV-229E fusion core possesses the typical properties of the trimer of coiled-coil heterodimer (six α-helix bundle). 3D structure modeling presents its most-likely structure, similar to those of coronaviruses that have been well-documented. Collectively, HCoV-229E S protein belongs to the type I fusion protein, which is characterized by the existence of two heptad-repeat regions (HR1 and HR2), furthermore, the available knowledge concerning HCoV-229E fusion core may make it possible to design small molecule or polypeptide drugs targeting the membrane fusion, a crucial step of HCoV-229E infection

  20. Coronavirus 229E-related pneumonia in immunocompromised patients.

    Science.gov (United States)

    Pene, Frédéric; Merlat, Annabelle; Vabret, Astrid; Rozenberg, Flore; Buzyn, Agnès; Dreyfus, François; Cariou, Alain; Freymuth, François; Lebon, Pierre

    2003-10-01

    Coronaviruses strains 229E and OC43 have been associated with various respiratory illnesses ranging from the self-resolving common cold to severe pneumonia. Although chronic underlying conditions are major determinants of severe respiratory virus infections, few data about coronavirus-related pneumonia in immunocompromised patients are available. Here we report 2 well-documented cases of pneumonia related to coronavirus 229E, each with a different clinical presentation. Diagnosis was made on the basis of viral culture and electron microscopy findings that exhibited typical crown-like particles and through amplification of the viral genome by reverse transcriptase-polymerase chain reaction. On the basis of this report, coronaviruses should be considered as potential causative microorganisms of pneumonia in immunocompromised patients.

  1. 29 CFR 779.229 - Other arrangements.

    Science.gov (United States)

    2010-07-01

    ..., Franchise and Other Business Arrangements § 779.229 Other arrangements. With respect to those arrangements...” establishment will be considered a part of the same “enterprise.” For example, whether a franchise, lease, or... the enterprise which grants the franchise, right, or concession. (S. Rept. 145, 87th Cong., 1st Sess...

  2. 17 CFR 229.1003 - (Item 1003) Identity and background of filing person.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1003) Identity and background of filing person. 229.1003 Section 229.1003 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND...

  3. 22 CFR 229.100 - Purpose and effective date.

    Science.gov (United States)

    2010-04-01

    ... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 229.100 Purpose and... basis of sex in any education program or activity receiving Federal financial assistance, whether or not...

  4. The extraction of "2"2"9Th"3"+ from a buffer-gas stopping cell

    International Nuclear Information System (INIS)

    Wense, L. von der; Seiferle, B.; Laatiaoui, M.; Thirolf, P.G.

    2016-01-01

    In the whole landscape of atomic nuclei, "2"2"9Th is currently the only known nucleus which could allow for the development of a nuclear-based frequency standard, as it possesses an isomeric state of just 7.6 eV energy above the ground state. The 3+ charge state is of special importance in this context, as Th"3"+ allows for a simple laser-cooling scheme. Here we emphasize the direct extraction of triply-charged "2"2"9Th from a buffer-gas stopping cell. This finding will not only simplify any future approach of "2"2"9Th ion cooling, but is also used for thorium-beam purification and in this way provides a powerful tool for the direct identification of the "2"2"9Th isomer to ground state nuclear transition.

  5. 49 CFR 192.229 - Limitations on welders.

    Science.gov (United States)

    2010-10-01

    ... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.229 Limitations on welders. (a) No welder whose qualification is based on nondestructive testing may weld compressor station pipe and components. (b) No welder may weld with a particular welding process unless, within the...

  6. 49 CFR 229.49 - Main reservoir system.

    Science.gov (United States)

    2010-10-01

    ... automatic air brake system shall be adjusted so that the compressor will start when the main reservoir..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Brake System § 229.49... least one safety valve that shall prevent an accumulation of pressure of more than 15 pounds per square...

  7. 17 CFR 229.303 - (Item 303) Management's discussion and analysis of financial condition and results of operations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 303) Management's discussion and analysis of financial condition and results of operations. 229.303 Section 229.303 Commodity... 1975-REGULATION S-K Financial Information § 229.303 (Item 303) Management's discussion and analysis of...

  8. Effects of a new motilide, ABT-229, on gastric emptying and postprandial antroduodenal motility in healthy volunteers

    NARCIS (Netherlands)

    Verhagen, M. A.; Samsom, M.; Maes, B.; Geypens, B. J.; Ghoos, Y. F.; Smout, A. J.

    1997-01-01

    BACKGROUND: ABT-229 is a recently developed derivative of erythromycin, devoid of antibiotic activity. We studied the effect of ABT-229 on gastric emptying and postprandial antroduodenal motility in healthy volunteers. METHODS: Placebo, 4 and 16 mg ABT-229 were given as a single oral dose to nine

  9. 17 CFR 229.1009 - (Item 1009) Persons/assets, retained, employed, compensated or used.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1009) Persons/assets, retained, employed, compensated or used. 229.1009 Section 229.1009 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY...

  10. 17 CFR 229.1008 - (Item 1008) Interest in securities of the subject company.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1008) Interest in securities of the subject company. 229.1008 Section 229.1008 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY AND...

  11. Yields of fission products produced by thermal-neutron fission of 229Th

    International Nuclear Information System (INIS)

    Dickens, J.K.; McConnell, J.W.

    1983-01-01

    Absolute yields have been determined for 47 gamma rays emitted in the decay of 37 fission products representing 25 mass chains created during thermal-neutron fission of 229 Th. Using a Ge(Li) detector, spectra were obtained of gamma rays emitted between 15 min and 0.4 yr after very short irradiations by thermal neutrons of a 15-μg sample of 229 Th. On the basis of measured gamma-ray yields and known nuclear data, yields for cumulative production of 37 fission products were deduced. The absolute overall normalization uncertainty is 235 U, we postulate a simple functional dependence sigma = sigma(Z/sub p/), and using this dependence obtain values of Z/sub p/(A) for 15 mass chains created during fission of 229 Th. Values of Z/sub p/(A) were estimated for other mass chains based upon results of a recent study of Z/sub p/(A). Charge distributions determined using the deduced mass distribution and the deduced sets of Z/sub p/(A) and sigma(Z/sub p/) are in very good agreement with recent measurements, exhibiting a pronounced even-odd effect in elemental yields. These results may be used to predict unmeasured yields for 229 Th fission

  12. Nanotechnology Standardization Activities – Support of U.S. Representation on ISO/TC 229 Nanotechnologies

    Energy Technology Data Exchange (ETDEWEB)

    Benko, Heather [American National Standards Inst. (ANSI), Washington, DC (United States)

    2017-03-14

    In carrying out its responsibilities on behalf of the United States, ANSI provides comprehensive, administrative support and expertise on international protocols and procedures to: (1) the U.S. Technical Advisory Group (TAG) to the International Organization for Standardization’s (ISO) Technical Committee (TC) 229 Nanotechnologies, and (2) the corresponding U.S. TAG Working Groups tasked with formulating U.S. positions on topics relevant to nanotechnology standardization. Additionally, secretariat and procedural support is provided for the ISO/TC 229 WG 3 on health, safety and environment, for which the United States was assigned leadership by the participating national body members of ISO/TC 229. As the official entity that serves as the U.S. representative to ISO, ANSI provides not only expert coordination of U.S. positions and representation at ISO but also strategic direction, advice and procedural expertise to facilitate navigation of international issues to promote U.S. positions for incorporation into the ISO/TC 229 program of work necessary to support U.S. objectives.

  13. 30 CFR 229.123 - Standards for audit activities.

    Science.gov (United States)

    2010-07-01

    ... 229.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... required, including a knowledge of accounting, auditing, agency regulations, and industry operations. (ii... statement of standards. (iii) The auditor's report should contain a statement of positive assurance on those...

  14. 5 CFR 532.229 - Local wage survey committee.

    Science.gov (United States)

    2010-01-01

    ... employees, the need of the employees' work units for their presence on the job, and the prudent management of available financial and human resources. Employing agencies and activities shall cooperate and... Section 532.229 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS...

  15. 17 CFR 229.1208 - (Item 1208) Oil and gas properties, wells, operations, and acreage.

    Science.gov (United States)

    2010-04-01

    ... properties, wells, operations, and acreage. 229.1208 Section 229.1208 Commodity and Securities Exchanges..., operations, and acreage. (a) Disclose, as of a reasonably current date or as of the end of the fiscal year... interests owned in gross wells or acres expressed as whole numbers and fractions of whole numbers. (3...

  16. 22 CFR 229.445 - Marital or parental status.

    Science.gov (United States)

    2010-04-01

    ... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 229.445 Marital or parental status. (a) Status..., or marital status that treats students differently on the basis of sex. (b) Pregnancy and related...

  17. 49 CFR Appendix B to Part 229 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ...) 15/8″ or more 5,000 7,000 (i) Tire thickness 2,500 5,000 (j) Rim thickness: (1) Less than 1″ in road... 229.73Wheel sets 2,500 5,000 229.75Wheel and tire defects: (a),(d) Slid flat or shelled spot(s): (1... thickness of: (1) 7/8″ or less but more than 13/16″ 2,500 5,000 (2) 13/16″ or less 5,000 7,500 (g) Tread...

  18. BST2/CD317 counteracts human coronavirus 229E productive infection by tethering virions at the cell surface

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shiu-Mei [Department of Medical Research and Education, Taipei Veterans General Hospital and Institute of Clinical Medicine, Taipei 11217, Taiwan (China); Institute of Clinical Medicine, National Yang-Ming University School of Medicine, Taipei, Taiwan (China); Huang, Kuo-Jung [Department of Medical Research and Education, Taipei Veterans General Hospital and Institute of Clinical Medicine, Taipei 11217, Taiwan (China); Wang, Chin-Tien, E-mail: chintien@ym.edu.tw [Department of Medical Research and Education, Taipei Veterans General Hospital and Institute of Clinical Medicine, Taipei 11217, Taiwan (China); Institute of Clinical Medicine, National Yang-Ming University School of Medicine, Taipei, Taiwan (China)

    2014-01-20

    Bone marrow stromal antigen 2 (BST2), an interferon-inducible antiviral factor, has been shown to block the release of various enveloped viruses from cells. It has also been identified as an innate immune system component. Most enveloped viruses subject to BST2 restriction bud at the plasma membrane. Here we report our findings that (a) the production of human coronavirus 229E (HCoV-229E) progeny viruses, whose budding occurs at the ER-Golgi intermediate compartment (ERGIC), markedly decreases in the presence of BST2; and (b) BST2 knockdown expression results in enhanced HCoV-229E virion production. Electron microscopy analyses indicate that HCoV-229E virions are tethered to cell surfaces or intracellular membranes by BST2. Our results suggest that BST2 exerts a broad blocking effect against enveloped virus release, regardless of whether budding occurs at the plasma membrane or intracellular compartments. - Highlights: • BST2 knockdown expression results in enhanced HCoV-229E egress. • HCoV-229E virions are tethered to cell surfaces or intracellular membranes by BST2. • HCoV-229E infection at high MOI can significantly downregulate HeLa BST2 and rescue HIV-1 egress.

  19. 17 CFR 229.1006 - (Item 1006) Purposes of the transaction and plans or proposals.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1006) Purposes of the transaction and plans or proposals. 229.1006 Section 229.1006 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY...

  20. 17 CFR 229.1007 - (Item 1007) Source and amount of funds or other consideration.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1007) Source and amount of funds or other consideration. 229.1007 Section 229.1007 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY...

  1. 17 CFR 229.801 - Securities Act industry guides.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Securities Act industry guides... AND CONSERVATION ACT OF 1975-REGULATION S-K List of Industry Guides § 229.801 Securities Act industry... claims and claim adjustment expenses of property-casualty insurance underwriters. (g) Guide 7...

  2. 17 CFR 229.1204 - (Item 1204) Oil and gas production, production prices and production costs.

    Science.gov (United States)

    2010-04-01

    ... production, production prices and production costs. 229.1204 Section 229.1204 Commodity and Securities... production, production prices and production costs. (a) For each of the last three fiscal years disclose... production cost, not including ad valorem and severance taxes, per unit of production. Instruction 1 to Item...

  3. 17 CFR 229.908 - (Item 908) Reasons for and alternatives to the roll-up transaction.

    Science.gov (United States)

    2010-04-01

    ... with their existing business plans, including the effects of such continuation and the material risks... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 908) Reasons for and alternatives to the roll-up transaction. 229.908 Section 229.908 Commodity and Securities Exchanges SECURITIES...

  4. 25 CFR 1000.229 - May a Tribe/Consortium propose a substitute for a regulation it wishes to be waived?

    Science.gov (United States)

    2010-04-01

    ... regulation it wishes to be waived? 1000.229 Section 1000.229 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.229 May a Tribe...

  5. Radioisotope dilution analyses of geological samples using 236U and 229Th

    International Nuclear Information System (INIS)

    Rosholt, J.N.

    1984-01-01

    The use of 236 U and 229 Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: 1) these isotopes do not occur in terrestrial rocks, 2) they have negligible decay losses because of their long half lives, 3) they cause minimal recoil contamination to surface-barrier detectors, 4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and 5) they allow for simple and constant corrections for spectral interferences, 0.5% of the 238 U activity is subtracted for the contribution of 235 U in the 236 U peak and 1% of the 229 Th activity is subtracted from the 230 Th activity. Disadvantages in using 236 U and 229 Th are: 1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, 2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and 3) separate calibrations of the 236 U and 229 Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. (orig.)

  6. Radioisotope dilution analyses of geological samples using 236U and 229Th

    Science.gov (United States)

    Rosholt, J.N.

    1984-01-01

    The use of 236U and 229Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: (1) these isotopes do not occur in terrestrial rocks, (2) they have negligible decay losses because of their long half lives, (3) they cause minimal recoil contamination to surface-barrier detectors, (4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and (5) they allow for simple and constant corrections for spectral inferences, 0.5% of the 238U activity is subtracted for the contribution of 235U in the 236U peak and 1% of the 229Th activity is subtracted from the 230Th activity. Disadvantages in using 236U and 229Th are: (1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, (2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and (3) separate calibrations of the 236U and 229Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. ?? 1984.

  7. 48 CFR 252.229-7009 - Relief from customs duty and value added tax on fuel (passenger vehicles) (United Kingdom).

    Science.gov (United States)

    2010-10-01

    ... and value added tax on fuel (passenger vehicles) (United Kingdom). 252.229-7009 Section 252.229-7009... Relief from customs duty and value added tax on fuel (passenger vehicles) (United Kingdom). As prescribed in 229.402-70(i), use the following clause: Relief from Customs Duty and Value Added Tax on Fuel...

  8. R229Q Polymorphism of NPHS2 Gene in Group of Iraqi Children with Steroid-Resistant Nephrotic Syndrome

    Directory of Open Access Journals (Sweden)

    Shatha Hussain Ali

    2017-01-01

    Full Text Available Background. The polymorphism R229Q is one of the most commonly reported podocin sequence variations among steroid-resistant nephrotic syndromes (SRNS. Aim of the Study. We investigated the frequency and risk of this polymorphism among a group of Iraqi children with SRNS and steroid-sensitive nephrotic syndrome (SSNS. Patients and Methods. A prospective case control study which was conducted in Al-Imamein Al-Kadhimein Medical City, spanning the period from the 1st of April 2015 to 30th of November 2015. Study sample consisted of 54 children having NS, divided into 2 groups: patients group consisted of 27 children with SRNS, and control group involved 27 children with SSNS. Both were screened by real time polymerase chain reaction for R229Q in exon 5 of NPHS2 gene. Results. Molecular study showed R229Q polymorphism in 96.3% of SRNS and 100% of SSNS. There were no phenotypic or histologic characteristics of patients bearing homozygous R229Q polymorphism and the patients with heterozygous R229Q polymorphism. Conclusion. Polymorphism R229Q of NPHS2 gene is prevalent in Iraqi children with SRNS and SSNS. Further study needs to be done, for other exons and polymorphism of NPHS2 gene in those patients.

  9. 14 CFR 121.229 - Location of fuel tanks.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Location of fuel tanks. 121.229 Section 121... of fuel tanks. (a) Fuel tanks must be located in accordance with § 121.255. (b) No part of the engine... the wall of an integral tank. (c) Fuel tanks must be isolated from personnel compartments by means of...

  10. 27 CFR 24.229 - Tank car and tank truck requirements.

    Science.gov (United States)

    2010-04-01

    ... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.229 Tank car and tank truck requirements. Railroad tank cars and tank trucks used to transport spirits for use in wine production will be constructed...

  11. 32 CFR 229.14 - Determination of archaeological or commercial value and cost of restoration and repair.

    Science.gov (United States)

    2010-07-01

    ... shall be its fair market value. Where the violation has resulted in damage to the archaeological resource, the fair market value should be determined using the condition of the archaeological resource... value and cost of restoration and repair. 229.14 Section 229.14 National Defense Department of Defense...

  12. A Rare Case of Human Coronavirus 229E Associated with Acute Respiratory Distress Syndrome in a Healthy Adult

    Directory of Open Access Journals (Sweden)

    Foula Vassilara

    2018-01-01

    Full Text Available Human coronavirus 229E (HCoV-229E is one of the first coronavirus strains being described. It is linked to common cold symptoms in healthy adults. Younger children and the elderly are considered vulnerable to developing lower respiratory tract infections (LRTIs. In particular, immunocompromised patients have been reported with severe and life-threatening LRTIs attributed to HCoV-229E. We report for the first time a case of LRTI and acute respiratory distress syndrome developed in a healthy adult with no comorbidities and HCoV-229E strain identified as the only causative agent. A 45-year-old female with a clear medical history presented with fever, cough, and headache. Respiratory tract infection was diagnosed, and empirical antibiotics were started. Within two days, she developed bilateral pleural effusions, diffuse consolidations, and ground glass opacities involving all lung fields. She needed immediate oxygen supply, while ABGs deteriorated and chest imaging and PaO2/FiO2 indicated ARDS. Early administration of systemic corticosteroids led to gradual clinical improvement. Multiplex PCR from nasal secretions was positive only for HCoV-229E and negative for multiple other pathogens. It remains to be elucidated how an immunocompetent adult developed a life-threatening LRTI caused by a “benign considered” coronavirus strain, the HCoV-229E.

  13. 48 CFR 229.402-1 - Foreign fixed-price contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Foreign fixed-price... Foreign fixed-price contracts. Use the clause at 252.229-7000, Invoices Exclusive of Taxes or Duties, in solicitations and contracts when a fixed-price contract will be awarded to a foreign concern. ...

  14. 48 CFR 852.229-70 - Sales or use taxes.

    Science.gov (United States)

    2010-10-01

    ..., Contract Terms and Conditions—Commercial Items. The articles listed in this solicitation will be purchased... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Sales or use taxes. 852... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses § 852.229...

  15. 17 CFR 229.1013 - (Item 1013) Purposes, alternatives, reasons and effects in a going-private transaction.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1013) Purposes, alternatives, reasons and effects in a going-private transaction. 229.1013 Section 229.1013 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF...

  16. BROAD-LINE REVERBERATION IN THE KEPLER-FIELD SEYFERT GALAXY Zw 229-015

    International Nuclear Information System (INIS)

    Barth, Aaron J.; Nguyen, My L.; Malkan, Matthew A.; Filippenko, Alexei V.; Li, Weidong; Cenko, S. Bradley; Choi, Jieun; Duchene, Gaspard; Ganeshalingam, Mohan; Gorjian, Varoujan; Joner, Michael D.; Bennert, Vardha Nicola; Botyanszki, Janos; Childress, Michael; Cucciara, Antonino; Comerford, Julia M.; Da Silva, Robert; Fumagalli, Michele; Gates, Elinor L.; Gerke, Brian F.

    2011-01-01

    The Seyfert 1 galaxy Zw 229-015 is among the brightest active galaxies being monitored by the Kepler mission. In order to determine the black hole mass in Zw 229-015 from Hβ reverberation mapping, we have carried out nightly observations with the Kast Spectrograph at the Lick 3 m telescope during the dark runs from 2010 June through December, obtaining 54 spectroscopic observations in total. We have also obtained nightly V-band imaging with the Katzman Automatic Imaging Telescope at Lick Observatory and with the 0.9 m telescope at the Brigham Young University West Mountain Observatory over the same period. We detect strong variability in the source, which exhibited more than a factor of two change in broad Hβ flux. From cross-correlation measurements, we find that the Hβ light curve has a rest-frame lag of 3.86 +0.69 -0.90 days with respect to the V-band continuum variations. We also measure reverberation lags for Hα and Hγ and find an upper limit to the Hδ lag. Combining the Hβ lag measurement with a broad Hβ width of σ line = 1590 ± 47 km s -1 measured from the rms variability spectrum, we obtain a virial estimate of M BH = 1.00 +0.19 -0.24 x 10 7 M sun for the black hole in Zw 229-015. As a Kepler target, Zw 229-015 will eventually have one of the highest-quality optical light curves ever measured for any active galaxy, and the black hole mass determined from reverberation mapping will serve as a benchmark for testing relationships between black hole mass and continuum variability characteristics in active galactic nuclei.

  17. Preparations for an optical access to the lowest nuclear excitation in {sup 229}Th

    Energy Technology Data Exchange (ETDEWEB)

    Wense, Lars v.d.; Seiferle, Benedict; Thirolf, Peter [Ludwig-Maximilians-Universitaet Muenchen (Germany); Laatiaoui, Mustapha [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH (Germany)

    2014-07-01

    The isomeric lowest excited nuclear level of {sup 229}Th has been indirectly measured to be 7.6±0.5 eV (163±11 nm). In order to improve the accuracy as prerequisite of an all-optical control, {sup 229m}Th is populated via a 2% decay branch in the α decay of {sup 233}U. The Thorium ions are extracted and cooled with the help of a buffer gas stopping cell and an RFQ-cooler. In order to suppress accompanying α decay chain products other than {sup 229}Th, a quadrupole mass spectrometer (QMS) is used, performance and extraction efficiency measurements were performed. Following the QMS, the Thorium isomers will be collected on a 50 μm micro electrode. The decay of these isomers can then be detected using deep UV optics, presently in the phase of preparation and adjustment. Newest results are presented.

  18. 17 CFR 229.102 - (Item 102) Description of property.

    Science.gov (United States)

    2010-04-01

    ... segment(s), as reported in the financial statements, that use the properties described. If any such... by the registrant. Detailed descriptions of the physical characteristics of individual properties or... qualitative factors. See Instruction 1 to Item 101 of Regulation S-K (§ 229.101). 3. In the case of an...

  19. 17 CFR 229.304 - (Item 304) Changes in and disagreements with accountants on accounting and financial disclosure.

    Science.gov (United States)

    2010-04-01

    ... disagreements with accountants on accounting and financial disclosure. 229.304 Section 229.304 Commodity and... accounting and financial disclosure. (a)(1) If during the registrant's two most recent fiscal years or any... any matter of accounting principles or practices, financial statement disclosure, or auditing scope or...

  20. 17 CFR 229.1002 - (Item 1002) Subject company information.

    Science.gov (United States)

    2010-04-01

    ... ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION S-K Mergers and Acquisitions (Regulation M-A) § 229... person has more current information. (c) Trading market and price. Identify the principal market in which... in the principal market (or, if there is no principal market, the range of high and low bid...

  1. Prospects for an energy determination of the {sup 229m}Th nuclear isomer via IC electrons

    Energy Technology Data Exchange (ETDEWEB)

    Seiferle, B.; Wense, L. v.d.; Thirolf, P.G. [LMU Muenchen, Garching (Germany); Laatiaoui, M. [GSI, Darmstadt (Germany); Helmholtz Institut Mainz, Mainz (Germany)

    2016-07-01

    Of all known nuclear excited states, the isomeric first excited state of {sup 229}Th possesses the lowest excitation energy reported to be E{sup *}=7.6(5) eV (=163(11) nm). This opens up the possibility to drive the transition with a laser and makes {sup 229m}Th an interesting candidate for future developments linking nuclear and atomic physics, such as a nuclear optical clock or a nuclear γ-ray laser. Still, for a direct laser excitation, the knowledge on the energy and half-life of the isomer is not precise enough. In this work and for the expected transition energy, neutral {sup 229}Th decays via the emission internal conversion (IC) electrons with an energy of 1.2 eV (i.e. difference between E* and the 1{sup st} ionization potential). A {sup 233}U α-recoil source is placed in a buffer-gas stopping cell. {sup 229}Th ions, of which 2% are in the isomeric state are recoiled out of the source. RF- and DC electrode structures form an ion beam out of all the recoil ions. Afterwards, {sup 229(m)}Th ions are separated from other short-lived daughter isotopes with a quadrupole mass separator and can be prepared for further experiments. The poster gives prospects for an energy determination of the IC electrons emitted during the decay of the isomer and for a corresponding half-life determination with this experimental setup.

  2. Continuous-wave, single-frequency 229  nm laser source for laser cooling of cadmium atoms.

    Science.gov (United States)

    Kaneda, Yushi; Yarborough, J M; Merzlyak, Yevgeny; Yamaguchi, Atsushi; Hayashida, Keitaro; Ohmae, Noriaki; Katori, Hidetoshi

    2016-02-15

    Continuous-wave output at 229 nm for the application of laser cooling of Cd atoms was generated by the fourth harmonic using two successive second-harmonic generation stages. Employing a single-frequency optically pumped semiconductor laser as a fundamental source, 0.56 W of output at 229 nm was observed with a 10-mm long, Brewster-cut BBO crystal in an external cavity with 1.62 W of 458 nm input. Conversion efficiency from 458 nm to 229 nm was more than 34%. By applying a tapered amplifier (TA) as a fundamental source, we demonstrated magneto-optical trapping of all stable Cd isotopes including isotopes Cd111 and Cd113, which are applicable to optical lattice clocks.

  3. 17 CFR 229.406 - (Item 406) Code of ethics.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 406) Code of ethics. 229... 406) Code of ethics. (a) Disclose whether the registrant has adopted a code of ethics that applies to... code of ethics, explain why it has not done so. (b) For purposes of this Item 406, the term code of...

  4. Human coronavirus 229E encodes a single ORF4 protein between the spike and the envelope genes

    Directory of Open Access Journals (Sweden)

    Berkhout Ben

    2006-12-01

    Full Text Available Abstract Background The genome of coronaviruses contains structural and non-structural genes, including several so-called accessory genes. All group 1b coronaviruses encode a single accessory protein between the spike and envelope genes, except for human coronavirus (HCoV 229E. The prototype virus has a split gene, encoding the putative ORF4a and ORF4b proteins. To determine whether primary HCoV-229E isolates exhibit this unusual genome organization, we analyzed the ORF4a/b region of five current clinical isolates from The Netherlands and three early isolates collected at the Common Cold Unit (CCU in Salisbury, UK. Results All Dutch isolates were identical in the ORF4a/b region at amino acid level. All CCU isolates are only 98% identical to the Dutch isolates at the nucleotide level, but more closely related to the prototype HCoV-229E (>98%. Remarkably, our analyses revealed that the laboratory adapted, prototype HCoV-229E has a 2-nucleotide deletion in the ORF4a/b region, whereas all clinical isolates carry a single ORF, 660 nt in size, encoding a single protein of 219 amino acids, which is a homologue of the ORF3 proteins encoded by HCoV-NL63 and PEDV. Conclusion Thus, the genome organization of the group 1b coronaviruses HCoV-NL63, PEDV and HCoV-229E is identical. It is possible that extensive culturing of the HCoV-229E laboratory strain resulted in truncation of ORF4. This may indicate that the protein is not essential in cell culture, but the highly conserved amino acid sequence of the ORF4 protein among clinical isolates suggests that the protein plays an important role in vivo.

  5. Human Coronaviruses 229E and NL63: Close Yet Still So Far

    Directory of Open Access Journals (Sweden)

    Ronald Dijkman

    2009-04-01

    Full Text Available HCoV-NL63 and HCoV-229E are two of the four human coronaviruses that circulate worldwide. These two viruses are unique in their relationship towards each other. Phylogenetically, the viruses are more closely related to each other than to any other human coronavirus, yet they only share 65% sequence identity. Moreover, the viruses use different receptors to enter their target cell. HCoV-NL63 is associated with croup in children, whereas all signs suggest that the virus probably causes the common cold in healthy adults. HCoV-229E is a proven common cold virus in healthy adults, so it is probable that both viruses induce comparable symptoms in adults, even though their mode of infection differs. Here, we present an overview of the current knowledge on both human coronaviruses, focusing on similarities and differences.

  6. 12 CFR 609.910 - Compliance with the Electronic Signatures in Global and National Commerce Act (Public Law 106-229...

    Science.gov (United States)

    2010-01-01

    ... Global and National Commerce Act (Public Law 106-229) (E-SIGN). 609.910 Section 609.910 Banks and Banking... with the Electronic Signatures in Global and National Commerce Act (Public Law 106-229) (E-SIGN). (a) General. E-SIGN makes it easier to conduct E-commerce. With some exceptions, E-SIGN permits the use and...

  7. 50 CFR 229.32 - Atlantic large whale take reduction plan regulations.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Atlantic large whale take reduction plan... Regulations § 229.32 Atlantic large whale take reduction plan regulations. (a)(1) Purpose and scope. The purpose of this section is to implement the Atlantic Large Whale Take Reduction Plan to reduce incidental...

  8. Preparations for an optical access to the lowest nuclear excitation in {sup 229}Th

    Energy Technology Data Exchange (ETDEWEB)

    Wense, Lars v.d.; Seiferle, Benedict; Thirolf, Peter G. [Ludwig-Maximilians-Universitaet Muenchen (Germany); Laatiaoui, Mustapha [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany)

    2015-07-01

    The isomeric lowest excited nuclear level of {sup 229}Th has been indirectly measured to be 7.6±0.5 eV (163±11 nm). This low transition energy, compared to energies typically involved in nuclear processes, would allow for the application of laser-spectroscopic methods. Also considering the isomeric lifetime of the excited state (estimated to be 10{sup 3} to 10{sup 4} s), which leads to an extremely sharp linewidth of Δω/ω ∝ 10{sup -20}, the isomer becomes a strong candidate for a nuclear-based frequency standard. In order to directly detect the isomeric ground-state decay and improve the accuracy of its energy as a prerequisite for an all-optical control, {sup 229m}Th is populated via a 2% decay branch in the α decay of {sup 233}U. The Thorium ions are extracted and cooled with the help of a buffer-gas stopping cell and an RFQ-cooler. In order to suppress accompanying α decay chain products other than {sup 229}Th, a quadrupole mass spectrometer (QMS) is used. Following the QMS, the Thorium isomeric decay is expected to be detectable. Internal conversion as well as photonic decay is probed via different detection techniques. Latest results are presented.

  9. Characterization of the expression and immunogenicity of the ns4b protein of human coronavirus 229E

    DEFF Research Database (Denmark)

    Chagnon, F; Lamarre, A; Lachance, C

    1998-01-01

    to demonstrate the expression of ns4b in HCV-229E-infected cells using flow cytometry. Given a previously reported contiguous five amino acid shared region between ns4b and myelin basic protein, a purified recombinant histidine-tagged ns4b protein and (or) human myelin basic protein were injected into mice......Sequencing of complementary DNAs prepared from various coronaviruses has revealed open reading frames encoding putative proteins that are yet to be characterized and are so far only described as nonstructural (ns). As a first step in the elucidation of its function, we characterized the expression...... and immunogenicity of the ns4b gene product from strain 229E of human coronavirus (HCV-229E), a respiratory virus with a neurotropic potential. The gene was cloned and expressed in bacteria. A fusion protein of ns4b with maltose-binding protein was injected into rabbits to generate specific antibodies that were used...

  10. 48 CFR 52.229-9 - Taxes-Cost-Reimbursement Contracts With Foreign Governments.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Taxes-Cost-Reimbursement... Provisions and Clauses 52.229-9 Taxes—Cost-Reimbursement Contracts With Foreign Governments. As prescribed in 29.402-2(b), insert the following clause: Taxes—Cost-Reimbursement Contracts With Foreign Governments...

  11. 17 CFR 229.904 - (Item 904) Risk factors and other considerations.

    Science.gov (United States)

    2010-04-01

    ... partnerships is identified as a potential benefit of the roll-up transaction, the amount of cost savings and a comparison of such amount to the costs of the roll-up transaction; and (ii) If there may be a material... 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION S-K Roll-Up Transactions § 229.904 (Item...

  12. Quality assurance program plan for FRG sealed isotopic heat sources project (C-229)

    International Nuclear Information System (INIS)

    Tanke, J.M.

    1997-01-01

    This QAPP implements the Quality Assurance Program Plan for the FRG Sealed Isotopic Heat Sources Project (C-229). The heat source will be relocated from the 324 Building and placed in interim storage at the Central Waste Complex (CWC)

  13. 22 CFR 229.425 - Counseling and use of appraisal and counseling materials.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Counseling and use of appraisal and counseling... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 229.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A recipient shall not discriminate against any person on...

  14. Human Coronaviruses 229E and NL63: Close Yet Still So Far

    NARCIS (Netherlands)

    Dijkman, Ronald; van der Hoek, Lia

    2009-01-01

    HCoV-NL63 and HCoV-229E are two of the four human coronaviruses that circulate worldwide. These two viruses are unique in their relationship towards each other. Phylogenetically, the viruses are more closely related to each other than to any other human coronavirus, yet they only share 65% sequence

  15. 5 CFR 591.229 - How does OPM inform agencies and employees of COLA rate changes?

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.229 How does OPM inform agencies and employees of...

  16. Step-by-step application methodology in practical KEPCO 22.9kV bus-bar system

    International Nuclear Information System (INIS)

    Yoon, Jae-young; Lee, Seung-yeol

    2010-01-01

    With the increase of power demand and the progress of power industry deregulation, the transmission and distribution systems will have more complicated problems by the influence of curtailing investment and the NIMBY phenomena in overall power systems. [1-2] It is expected that the route length per MW demand of South Korea will decrease gradually from 0.6[C-km/MW] to 0.53[C-km/MW] in 2010.[3] This comes up to a real serious problem from system planning and operation viewpoints. HTS technologies related to power system have properties to solve these complex transmission and distribution constraints, especially for metropolitan area, in the future. As the HTS technology has developed, the HTS cable technology can be the most effective alternative to solve the future expected power network constraints. This paper describes the application methodology of developing 22.9kV HTS cable by CAST for practical distribution system. 22.9kV HTS cable under development with step-by-step application methodology can substitute the existing and planning conventional 154kV cable.[4-5] If this scheme is applied, part of downtown 154kV substation of metropolitan city such as Seoul can be changed into 22.9kV switching station. Additionally, it can give huge economic, environmental benefits to all of the concerned authorities.

  17. 48 CFR 252.229-7011 - Reporting of Foreign Taxes-U.S. Assistance Programs.

    Science.gov (United States)

    2010-10-01

    ... all value added taxes and customs duties imposed by the recipient country. This exemption is in... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reporting of Foreign Taxes... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.229-7011 Reporting of Foreign Taxes—U.S...

  18. Diversity and Evolutionary Histories of Human Coronaviruses NL63 and 229E Associated with Acute Upper Respiratory Tract Symptoms in Kuala Lumpur, Malaysia.

    Science.gov (United States)

    Al-Khannaq, Maryam Nabiel; Ng, Kim Tien; Oong, Xiang Yong; Pang, Yong Kek; Takebe, Yutaka; Chook, Jack Bee; Hanafi, Nik Sherina; Kamarulzaman, Adeeba; Tee, Kok Keng

    2016-05-04

    The human alphacoronaviruses HCoV-NL63 and HCoV-229E are commonly associated with upper respiratory tract infections (URTI). Information on their molecular epidemiology and evolutionary dynamics in the tropical region of southeast Asia however is limited. Here, we analyzed the phylogenetic, temporal distribution, population history, and clinical manifestations among patients infected with HCoV-NL63 and HCoV-229E. Nasopharyngeal swabs were collected from 2,060 consenting adults presented with acute URTI symptoms in Kuala Lumpur, Malaysia, between 2012 and 2013. The presence of HCoV-NL63 and HCoV-229E was detected using multiplex polymerase chain reaction (PCR). The spike glycoprotein, nucleocapsid, and 1a genes were sequenced for phylogenetic reconstruction and Bayesian coalescent inference. A total of 68/2,060 (3.3%) subjects were positive for human alphacoronavirus; HCoV-NL63 and HCoV-229E were detected in 45 (2.2%) and 23 (1.1%) patients, respectively. A peak in the number of HCoV-NL63 infections was recorded between June and October 2012. Phylogenetic inference revealed that 62.8% of HCoV-NL63 infections belonged to genotype B, 37.2% was genotype C, while all HCoV-229E sequences were clustered within group 4. Molecular dating analysis indicated that the origin of HCoV-NL63 was dated to 1921, before it diverged into genotype A (1975), genotype B (1996), and genotype C (2003). The root of the HCoV-229E tree was dated to 1955, before it diverged into groups 1-4 between the 1970s and 1990s. The study described the seasonality, molecular diversity, and evolutionary dynamics of human alphacoronavirus infections in a tropical region. © The American Society of Tropical Medicine and Hygiene.

  19. The first complete genome sequences of clinical isolates of human coronavirus 229E

    NARCIS (Netherlands)

    Farsani, Seyed Mohammad Jazaeri; Dijkman, Ronald; Jebbink, Maarten F.; Goossens, Herman; Ieven, Margareta; Deijs, Martin; Molenkamp, Richard; van der Hoek, Lia

    2012-01-01

    Human coronavirus 229E has been identified in the mid-1960s, yet still only one full-genome sequence is available. This full-length sequence has been determined from the cDNA-clone Inf-1 that is based on the lab-adapted strain VR-740. Lab-adaptation might have resulted in genomic changes, due to

  20. Sun et al., Afr J Tradit Complement Altern Med. (2011) 8(3):224-229

    African Journals Online (AJOL)

    AJTCAM

    Sun et al., Afr J Tradit Complement Altern Med. (2011) 8(3):224-229. 224. EFFECTS OF CHINESE MATERIA MEDICA-FUBAO DANGGUI JIAO ON EXPERIMENTAL. ENDOMETRIOSIS. Xing Sun*, Master; Lijue Chen, Master; Fanbo Zeng1,. Department of Pharmacy, Tongji Medical College, Huazhong. University of Science ...

  1. Results of a Direct Search Using Synchrotron Radiation for the Low-Energy (229)Th Nuclear Isomeric Transition.

    Science.gov (United States)

    Jeet, Justin; Schneider, Christian; Sullivan, Scott T; Rellergert, Wade G; Mirzadeh, Saed; Cassanho, A; Jenssen, H P; Tkalya, Eugene V; Hudson, Eric R

    2015-06-26

    We report the results of a direct search for the (229)Th (I(π)=3/2(+)←5/2(+)) nuclear isomeric transition, performed by exposing (229)Th-doped LiSrAlF(6) crystals to tunable vacuum-ultraviolet synchrotron radiation and observing any resulting fluorescence. We also use existing nuclear physics data to establish a range of possible transition strengths for the isomeric transition. We find no evidence for the thorium nuclear transition between 7.3 eV and 8.8 eV with transition lifetime (1-2) s≲τ≲(2000-5600)  s. This measurement excludes roughly half of the favored transition search area and can be used to direct future searches.

  2. A VUV detection system for the direct photonic identification of the first excited isomeric state of "2"2"9Th

    International Nuclear Information System (INIS)

    Seiferle, B.; Von der Wense, L.; Thirolf, P.G.; Laatiaoui, M.

    2016-01-01

    With an expected energy of 7.6(5) eV, "2"2"9Th possesses the lowest excited nuclear state in the landscape of all presently known nuclei. The energy corresponds to a wavelength of about 160 nm and would conceptually allow for an optical laser excitation of a nuclear transition. We report on a VUV optical detection system that was designed for the direct detection of the isomeric ground-state transition of "2"2"9Th. "2"2"9"("m") Th ions originating from a "2"3"3U α-recoil source are collected on a micro electrode that is placed in the focus of an annular parabolic mirror. The latter is used to parallelize the UV fluorescence that may emerge from the isomeric ground-state transition of "2"2"9Th. The parallelized light is then focused by a second annular parabolic mirror onto a CsI-coated position-sensitive MCP detector behind the mirror exit. To achieve a high signal-to-background ratio, a small spot size on the MCP detector needs to be achieved. Besides extensive ray-tracing simulations of the optical setup, we present a procedure for its alignment, as well as test measurements using a D_2 lamp, where a focal-spot size of ∼100 μm has been achieved. Assuming a purely photonic decay, a signal-to-background ratio of ∼7000:1 could be achieved. (authors)

  3. 25 CFR 162.229 - How long can the term of an agricultural lease run?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How long can the term of an agricultural lease run? 162... AND PERMITS Agricultural Leases Lease Requirements § 162.229 How long can the term of an agricultural lease run? (a) An agricultural lease must provide for a definite lease term, specifying the commencement...

  4. Probing the effect of the non-active-site mutation Y229W in New Delhi metallo-β-lactamase-1 by site-directed mutagenesis, kinetic studies, and molecular dynamics simulations.

    Directory of Open Access Journals (Sweden)

    Jiao Chen

    Full Text Available New Delhi metallo-β-lactamase-1 (NDM-1 has attracted extensive attention for its high catalytic activities of hydrolyzing almost all β-lactam antibiotics. NDM-1 shows relatively higher similarity to subclass B1 metallo-β-lactamases (MβLs, but its residue at position 229 is identical to that of B2/B3 MβLs, which is a Tyr instead of a B1-MβL-conserved Trp. To elucidate the possible role of Y229 in the bioactivity of NDM-1, we performed mutagenesis study and molecular dynamics (MD simulations. Although residue Y229 is spatially distant from the active site and not contacting directly with the substrate or zinc ions, the Y229W mutant was found to have higher kcat and Km values than those of wild-type NDM-1, resulting in 1 ∼ 7 fold increases in k(cat /K(m values against tested antibiotics. In addition, our MD simulations illustrated the enhanced flexibility of Loop 2 upon Y229W mutation, which could increase the kinetics of both substrate entrance (kon and product egress (koff. The enhanced flexibility of Loop 2 might allow the enzyme to adjust the geometry of its active site to accommodate substrates with different structures, broadening its substrate spectrum. This study indicated the possible role of the residue at position 229 in the evolution of NDM-1.

  5. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    International Nuclear Information System (INIS)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-01-01

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  6. 3H-labeling of prokinetic motilide ABT-229 for biodistribution and metabolism studies

    International Nuclear Information System (INIS)

    Faghih, Ramin; Burnell-Curty, Cynthia; Surber, Bruce; Shoghi, Simin; Borre, Anthony; Ye Yao; Lartey, P.A.; Nellans, H.N.

    1996-01-01

    The prokinetic drug candidate, ABT-229, has been successfully [ 3 H]-labeled in the macrolactone ring. This was accomplished with [ 3 H]-NaBH 4 reduction of the 11-ketone analog in a four step synthetic sequence beginning with the drug candidate. The 3 H-labeled drug was obtained with specific activity of 9.0 Ci/mmol and radiochemical purity > 99%. This constitutes the first methodology for 3 H-labeling of the macrolactone in an erythromycin derivative. (author)

  7. 30 CFR 229.109 - Reimbursement for costs incurred by a State under the delegation of authority.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Reimbursement for costs incurred by a State... Administration of Delegations § 229.109 Reimbursement for costs incurred by a State under the delegation of..., on a quarterly basis, a summary of costs incurred for which the State is seeking reimbursement. Only...

  8. A Study on the construction of 22.9 kV distribution test line of KEPCO

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hi Kyun; Choi, Hung Sik; Hwang, Si Dole; Jung, Young Ho [Korea Electric Power Corp. (KEPCO), Taejon (Korea, Republic of). Research Center; Kim, Dong Hwan; Choi, Chang Huk [Korea Power Engineering Company and Architecture Engineers (Korea, Republic of)

    1995-12-31

    In order to enhance the reliability of power supply and the quality of electricity, a study on the construction of 22.9 kV distribution test line was performed. The main objective of this study was to establish a construction plan and a basic design to perform the construction and the detailed design of the test line effectively. (author). 21 refs., 45 figs.

  9. Performance of a 229Thorium solid-state nuclear clock

    International Nuclear Information System (INIS)

    Kazakov, G A; Schreitl, M; Winkler, G; Schumm, T; Litvinov, A N; Romanenko, V I; Yatsenko, L P; Romanenko, A V

    2012-01-01

    The 7.8 eV nuclear isomer transition in 229 thorium has been suggested as a clock transition in a new type of optical frequency standard. Here we discuss the construction of a ‘solid-state nuclear clock’ from thorium nuclei implanted into single crystals transparent in the vacuum ultraviolet range. We investigate crystal-induced line shifts and broadening effects for the specific system of calcium fluoride. At liquid nitrogen temperatures, the clock performance will be limited by decoherence due to magnetic coupling of the thorium nuclei to neighboring nuclear moments, ruling out the commonly used Rabi or Ramsey interrogation schemes. We propose clock stabilization based on a fluorescence spectroscopy method and present optimized operation parameters. Taking advantage of the large number of quantum oscillators under continuous interrogation, a fractional instability level of 10 −19 might be reached within the solid-state approach. (paper)

  10. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  11. Using {sup 233}U-doped crystals to access the few-eV isomeric transition in {sup 229}Th

    Energy Technology Data Exchange (ETDEWEB)

    Stellmer, Simon; Schreitl, Matthias; Kazakov, Georgy A.; Sterba, Johannes H.; Schumm, Thorsten [Vienna Center for Quantum Science and Technology (VCQ) and Atominstitut, TU Wien, Vienna (Austria)

    2016-07-01

    The isotope {sup 229}Th possesses an exceptionally low-lying isomeric state at an energy of only a few eV. While direct laser excitation of the isomer is a tantalizing future prospect, the stage is not yet set for nuclear laser spectroscopy: too little is known about the energy, lifetime, and internal conversion pathways of the isomer. Alternative routes to populate the isomer are needed for further investigations. We use the alpha decay {sup 233}U →{sup 229g,m}Th to populate the isomer with a probability of 2%. The {sup 233}U is embedded into VUV-transparent crystals, as the isomer transition is expected around 160 nm. The wavelength of the gamma ray, emitted upon de-excitation of the isomer into the ground state, is measured with a spectrometer. Calculations show that the isomer emission is not obscured by radioluminescence of the crystal. We report on the current status of the experiment.

  12. Investigation of the origin of elements of the uranium-235 family noticed in excess around the EL4 experimental nuclear reactor during its dismantling. Site of the Monts d'Arree - Brennilis (29) power plant. Years 2007-2008. Report and appendices with results

    International Nuclear Information System (INIS)

    2009-02-01

    The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods

  13. 12 CFR Appendix A to Part 229 - Routing Number Guide to Next-Day Availability Checks and Local Checks

    Science.gov (United States)

    2010-01-01

    ... Checks and Local Checks A Appendix A to Part 229 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM AVAILABILITY OF FUNDS AND COLLECTION OF CHECKS... Association. The routing number takes two forms: a fractional form and a nine-digit form. A paying bank...

  14. Review on transactinium isotope build-up and decay in reactor fuel and related sensitivities to cross section changes and results and main conclusions of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data, held at Karlsruhe, November 1975

    International Nuclear Information System (INIS)

    Kuesters, H.; Lalovic, M.

    1976-04-01

    In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de

  15. Feasibility study of internal conversion electron spectroscopy of {sup 229m}Th

    Energy Technology Data Exchange (ETDEWEB)

    Seiferle, Benedict; Wense, Lars von der; Thirolf, Peter G. [Ludwig-Maximilians-Universitaet Muenchen, Garching (Germany)

    2017-05-15

    With an expected energy of 7.8(5) eV, the isomeric first excited state in {sup 229}Th exhibits the lowest excitation energy of all known nuclei. Until today, a value for the excitation energy has been inferred only by indirect measurements. In this paper we propose an experimental method that is potentially capable of measuring the ground-state transition energy via the detection of the internal conversion electrons. MatLab-based Monte Carlo simulations have been performed to obtain an estimate of the expected statistics and to test the feasibility and the expected precision of the experiment. From the simulations we conclude that with the presented methods an energy determination with a precision of better than 0.1 eV is within reach. (orig.)

  16. H-alpha observations of Sh2-190, Sh2-222, Sh2-229, Sh2-236 HII regions

    Science.gov (United States)

    Sahan, Muhittin

    2018-02-01

    Hα spectral line (6563Å) profiles of four northern HII regions in the our galaxy (Sh2-190, Sh2-222, Sh2-229, Sh2-236) have been obtained using DEFPOS spectrometer, located at coude focus of 150 cm RTT150 telescope at TUBITAK National Observatory (TUG, Antalya, Turkey). Observations were carried out at nights of 2015 December 24-27 with long exposure times ranging from 900s to 3600s. The LSR velocities and the linewidths (Full Width Half Maximum: FWHM) of the Hα emission lines were found to be in the range of -45.46 kms-1 to +3.57 kms-1 and 38.50 kms-1 to 44.10 kms-1, respectively. The Sh2-229 HII region is the faintest one (211.16 R), while the Sh2-236 HII region (IC410) is brightest source (535.75 R). The LSR velocity and the line width (FWHM) results of the DEFPOS/RTT150 system were compared with the data by several authors given in literature and results of DEFPOS data were found to be in good agreement with data given in literature.

  17. In Silico Molecular Modeling and Docking Studies on Novel Mutants (E229V, H225P and D230C) of the Nucleotide-Binding Domain of Homo sapiens Hsp70.

    Science.gov (United States)

    Elengoe, Asita; Hamdan, Salehhuddin

    2017-12-01

    In this study, we explored the possibility of determining the synergistic interactions between nucleotide-binding domain (NBD) of Homo sapiens heat-shock 70 kDa protein (Hsp70) and E1A 32 kDa of adenovirus serotype 5 motif (PNLVP) in the efficiency of killing of tumor cells in cancer treatment. At present, the protein interaction between NBD and PNLVP motif is still unknown, but believed to enhance the rate of virus replication in tumor cells. Three mutant models (E229V, H225P and D230C) were built and simulated, and their interactions with PNLVP motif were studied. The PNLVP motif showed the binding energy and intermolecular energy values with the novel E229V mutant at -7.32 and -11.2 kcal/mol. The E229V mutant had the highest number of hydrogen bonds (7). Based on the root mean square deviation, root mean square fluctuation, hydrogen bonds, salt bridge, secondary structure, surface-accessible solvent area, potential energy and distance matrices analyses, it was proved that the E229V had the strongest and most stable interaction with the PNLVP motif among all the four protein-ligand complex structures. The knowledge of this protein-ligand complex model would help in designing Hsp70 structure-based drug for cancer therapy.

  18. Clinico-epidemiological characteristics of acute respiratory infections caused by coronavirus OC43, NL63 and 229E.

    Science.gov (United States)

    Reina, J; López-Causapé, C; Rojo-Molinero, E; Rubio, R

    2014-12-01

    Acute respiratory infection is a very common condition in the general population. The majority of these infections are due to viruses. This study attempted to determine the clinical and epidemiological characteristics of adult patients with respiratory infection by the coronavirus OC43, NL63 and 229E. Between January 2013 and February 2014, we prospectively studied all patients with suspected clinical respiratory infection by taking throat swabs and performing a reverse transcription polymerase chain reaction in search of coronavirus. In 48 cases (7.0% of the 686 enrolled patients; 12.6% of the 381 in whom a virus was detected) the presence of a coronavirus demonstrated. In 24 cases, the virus was OC43 (50%); in 14 cases, the virus was NL63 (29%); and in 10 cases, the virus was 229E (21%). The mean age was 54.5 years, with a slight predominance of men. The most common clinical presentations were nonspecific influenza symptoms (43.7%), pneumonia (29.2%) and chronic obstructive pulmonary disease exacerbation (8.3%). Fifty-two percent of the patients required hospitalization, and 2 patients required intensive care. There were no deaths. Acute respiratory infections caused by coronavirus mainly affect middle-aged male smokers, who are often affected by previous diseases. The most common clinical picture has been nonspecific influenza symptoms. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

  19. Kinematics and duty cycles of the SM-229 force-reflecting servomanipulator

    International Nuclear Information System (INIS)

    Stoughton, R.S.

    1986-02-01

    This report describes the first known experimental study of servomanipulator duty cycles to appear in the literature. The servomanipulator used was TeleOperator Systems Model SM-229. The experimental approach used was to record the joint positions and motor currents of the right slave arm at a rate of 10 Hz over about 50 h of typical remote manipulation operations. The results are presented as position usage patterns in joint and real-world coordinates, time-use histograms of joint velocities and motor currents, and three-dimensional mechanical power histograms for each joint. All results are presented in dimensionless form, scaled to the design ranges of the manipulator and the total operation time recorded. Applications of this study include improvements in kinematic ranges, gear reductions, motor sizings, drive configurations, and stress relief. Included in appendices are an uncertainty analysis, calibration procedures, and analysis of the kinematics of the manipulator. 12 refs., 42 figs., 15 tabs

  20. Pemanfaatan Limbah Buah Pisang Dan Air Kelapa Sebagai Bahan Media Kultur Jaringan Anggrek Bulan (Phalaenopsis Amabilis) Tipe 229

    OpenAIRE

    Djajanegara, Ira

    2010-01-01

    Coconut water and rotten banana fruits are commonly found in traditional markets as organic wastes. One way to overcome the problems caused by these organic wastes is to convert these unuseful matter into an important and economically useful matter by using them as components of tissue culture media. One important commodity that is usually propagated by tissue culture is Phalaenopsis orchid type 229 (Phalaenopsis amabilis). Therefore, it would be more benefit to substitute the expensive chemi...

  1. PEMANFAATAN LIMBAH BUAH PISANG DAN AIR KELAPA SEBAGAI BAHAN MEDIA KULTUR JARINGAN ANGGREK BULAN (Phalaenopsis amabilis) TIPE 229

    OpenAIRE

    Djajanegara, Ira

    2016-01-01

    Coconut water and rotten banana fruits are commonly found in traditional markets as organic wastes. One way to overcome the problems caused by these organic wastes is to convert these unuseful matter into an important and economically useful matter by using them as components of tissue culture media. One important commodity that is usually propagated by tissue culture is Phalaenopsis orchid type 229 (Phalaenopsis amabilis). Therefore, it would be more benefit to substitute the expensive chemi...

  2. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Moulin, J.

    2008-06-01

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  3. The nuclear isomer transition in Thorium-229. Search for the VUV photon

    Energy Technology Data Exchange (ETDEWEB)

    Stellmer, Simon [TU Wien (Austria). Atominstitut; VCQ, Vienna (Austria); Schreitl, Matthias; Schumm, Thorsten [TU Wien (Austria). Atominstitut; Yoshimura, Koji [Okayama University (Japan)

    2015-07-01

    The isotope {sup 229}Th is believed to possess a low-lying nuclear excitation, at an energy of about 7.8(5) eV, corresponding to a wavelength of 160(10) nm. Convincing direct evidence of the existence of this state, for instance by observation of its excitation or decay, is still pending. Optical excitation of the isomer state is an exceptional challenge, as the required wavelength is not known, the transition is believed to be extremely narrow, and the choice of suitable lasers is limited. Instead, we use synchrotron radiation at 29 keV to populate the second excited state, which then decays into the desired isomer state. This state proceeds further into the ground state under emission of the much sought-after VUV photon. This photon is detected in a spectrometer. The measurements are performed at the SPring-8 facility in Japan; we will report on the latest status of the experiment.

  4. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions

    International Nuclear Information System (INIS)

    2007-01-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  5. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  6. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira

    2007-11-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  7. Myeloablation-associated deletion of ORF4 in a human coronavirus 229E infection.

    Science.gov (United States)

    Greninger, Alexander L; Pepper, Gregory; Shean, Ryan C; Cent, Anne; Palileo, Isabel; Kuypers, Jane M; Schiffer, Joshua T; Jerome, Keith R

    2017-01-01

    We describe metagenomic next-generation sequencing (mNGS) of a human coronavirus 229E from a patient with AML and persistent upper respiratory symptoms, who underwent hematopoietic cell transplantation (HCT). mNGS revealed a 548-nucleotide deletion, which comprised the near entirety of the ORF4 gene, and no minor allele variants were detected to suggest a mixed infection. As part of her pre-HCT conditioning regimen, the patient received myeloablative treatment with cyclophosphamide and 12 Gy total body irradiation. Iterative sequencing and RT-PCR confirmation of four respiratory samples over the 4-week peritransplant period revealed that the pre-conditioning strain contained an intact ORF4 gene, while the deletion strain appeared just after conditioning and persisted over a 2.5-week period. This sequence represents one of the largest genomic deletions detected in a human RNA virus and describes large-scale viral mutation associated with myeloablation for HCT.

  8. Assessment of surface reactivity of thorium oxide in conditions close to chemical equilibrium by isotope exchange {sup 229}Th/{sup 232}Th method

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki-Muresan, Tomo; Perrigaud, Katy; Vandenborre, Johan; Ribet, Solange; Grambow, Bernd [Nantes Univ., CNRS/IN2P3 (France). SUBATECH Unite Mixte de Recherche 6457; Takamasa, Inai [TOKAI Univ., Kanagawa (Japan)

    2017-08-01

    This work aims to assess the solubility and the surface reactivity of crystallized thorium at pH 3.0 in presence of three types of solids: synthesized powder at 1300 C, crushed kernel, and intact kernel. In this study, the kernel is composed by the core solid from high temperature reactors (HTR) sphere particles. The originality of this work consisted in following in a sequential order the kinetic of dissolution, the surface reactivity in presence of isotope tracer {sup 229}Th, and its desorption process. Long time experiments (634 days) allowed to get deeper understanding on the behavior of the surface reactivity in contact with the solution. Solubility values are ranging from 0.3 x 10{sup -7} mol.L{sup -1} to 3 x 10{sup -7} mol.L{sup -1} with a dissolution rate of 10{sup -6}-10{sup -4} g.m{sup -2} day{sup -1}. PHREEQC modeling showed that crystallized ThO{sub 2}(cr, 20 nm) phase controls the equilibrium in solution. Isotope exchange between {sup 229}Th and {sup 232}Th indicated that well-crystallized phase exist as an inert surface regarding to the absence of exchange between surface solid and solution.

  9. Discovery of a ∼5 day characteristic timescale in the Kepler power spectrum of Zw 229–15

    Energy Technology Data Exchange (ETDEWEB)

    Edelson, R.; Smith, K. L.; Mushotzky, R. [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Vaughan, S. [X-Ray and Observational Astronomy Group, Department of Physics and Astronomy, University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Malkan, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095-1547 (United States); Kelly, B. C. [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93106-9530 (United States); Boyd, P. T., E-mail: redelson@astro.umd.edu [Astrophysics Science Division, NASA/GSFC, Code 660, Greenbelt, MD 20771 (United States)

    2014-11-01

    We present time series analyses of the full Kepler data set of Zw 229–15. This Kepler light curve—with a baseline greater than 3 yr, composed of virtually continuous, evenly sampled 30 minute measurements—is unprecedented in its quality and precision. We utilize two methods of power spectral analysis to investigate the optical variability and search for evidence of a bend frequency associated with a characteristic optical variability timescale. Each method yields similar results. The first interpolates across data gaps to use the standard Fourier periodogram. The second, using the CARMA-based time-domain modeling technique of Kelly et al., does not need evenly sampled data. Both methods find excess power at high frequencies that may be due to Kepler instrumental effects. More importantly, both also show strong bends (Δα ∼ 2) at timescales of ∼5 days, a feature similar to those seen in the X-ray power spectral densities of active galactic nuclei (AGNs) but never before in the optical. This observed ∼5 day timescale may be associated with one of several physical processes potentially responsible for the variability. A plausible association could be made with light-crossing dynamical or thermal timescales depending on the assumed value of the accretion disk size and on unobserved disk parameters such as α and H/R. This timescale is not consistent with the viscous timescale, which would be years in a ∼10{sup 7} M {sub ☉} AGN such as Zw 229–15. However, there must be a second bend on long (≳ 1 yr) timescales and that feature could be associated with the viscous timescale.

  10. Construction of testing facilities and verifying tests of a 22.9 kV/630 A class superconducting fault current limiter

    Science.gov (United States)

    Yim, S.-W.; Yu, S.-D.; Kim, H.-R.; Kim, M.-J.; Park, C.-R.; Yang, S.-E.; Kim, W.-S.; Hyun, O.-B.; Sim, J.; Park, K.-B.; Oh, I.-S.

    2010-11-01

    We have constructed and completed the preparation for a long-term operation test of a superconducting fault current limiter (SFCL) in a Korea Electric Power Corporation (KEPCO) test grid. The SFCL with rating of 22.9 kV/630 A, 3-phases, has been connected to the 22.9 kV test grid equipped with reclosers and other protection devices in Gochang Power Testing Center of KEPCO. The main goals of the test are the verification of SFCL performance and protection coordination studies. A line-commutation type SFCL was fabricated and installed for this project, and the superconducting components were cooled by a cryo-cooler to 77 K in the sub-cooled liquid nitrogen pressurized by 3 bar of helium gas. The verification test includes un-manned - long-term operation with and without loads and fault tests. Since the test site is 170 km away from the laboratory, we will adopt the un-manned operation with real-time remote monitoring and controlling using high speed internet. For the fault tests, we will apply fault currents up to around 8 kArms to the SFCL using an artificial fault generator. The fault tests may allow us not only to confirm the current limiting capability of the SFCL, but also to adjust the SFCL - recloser coordination such as resetting over-current relay parameters. This paper describes the construction of the testing facilities and discusses the plans for the verification tests.

  11. Construction of testing facilities and verifying tests of a 22.9 kV/630 A class superconducting fault current limiter

    International Nuclear Information System (INIS)

    Yim, S.-W.; Yu, S.-D.; Kim, H.-R.; Kim, M.-J.; Park, C.-R.; Yang, S.-E.; Kim, W.-S.; Hyun, O.-B.; Sim, J.; Park, K.-B.; Oh, I.-S.

    2010-01-01

    We have constructed and completed the preparation for a long-term operation test of a superconducting fault current limiter (SFCL) in a Korea Electric Power Corporation (KEPCO) test grid. The SFCL with rating of 22.9 kV/630 A, 3-phases, has been connected to the 22.9 kV test grid equipped with reclosers and other protection devices in Gochang Power Testing Center of KEPCO. The main goals of the test are the verification of SFCL performance and protection coordination studies. A line-commutation type SFCL was fabricated and installed for this project, and the superconducting components were cooled by a cryo-cooler to 77 K in the sub-cooled liquid nitrogen pressurized by 3 bar of helium gas. The verification test includes un-manned - long-term operation with and without loads and fault tests. Since the test site is 170 km away from the laboratory, we will adopt the un-manned operation with real-time remote monitoring and controlling using high speed internet. For the fault tests, we will apply fault currents up to around 8 kA rms to the SFCL using an artificial fault generator. The fault tests may allow us not only to confirm the current limiting capability of the SFCL, but also to adjust the SFCL - recloser coordination such as resetting over-current relay parameters. This paper describes the construction of the testing facilities and discusses the plans for the verification tests.

  12. Formation and evolution of ultrafine particles produced by radiolysis and photolysis

    International Nuclear Information System (INIS)

    Madelaine, G.J.; Perrin, M.L.; Renoux, A.

    1980-01-01

    Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation

  13. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  14. Status of liquid metal reactor development in the United States of America

    International Nuclear Information System (INIS)

    Griffith, J.D.; Horton, K.E.

    1991-01-01

    An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

  15. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  16. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  17. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    International Nuclear Information System (INIS)

    P. Bernot

    2005-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  18. Long-term test of the 22.9kV HTS power cable system in LS Cable Ltd

    International Nuclear Information System (INIS)

    Jang, Hyun Man; Lee, Chang Young; Kim, Choon Dong; Kim, Do Hyung; Park, In Son; Ji, Bong Ki; Kim, Dong Wook; Cho, Jeonwook

    2006-01-01

    Since 2001, LS cable Ltd. has been developing the design, manufacturing and evaluation technologies for high temperature superconducting (HTS) power cable system as a member of DAPAS (Dream for Advanced Power system by Applied Superconductivity technology) program in Korea. The 30 m HTS cable system that is rated at 22.9 kV and 1.2 kA giving a rated capacity of 50 MVA had been developed and tested. The cable was designed as a cold dielectric type employing Bi-2223 HTS tapes and polypropylene (PP) laminated paper as the conductor and electrical insulation, respectively. The cable is cooled with sub-cooled liquid nitrogen at temperature from 75 to 77 K. The manufacturing and the installation of the cable system were completed in 2004. Long-term performance test of the cable system has been conducted for six months to verify its electric and mechanical properties in 2005

  19. Kinetics of radioisotope exchange between brine and rock in a geothermal system

    International Nuclear Information System (INIS)

    Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku

    1988-01-01

    A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours

  20. Splitting sensitivity of the ground and 7.6 eV isomeric states of 229Th

    International Nuclear Information System (INIS)

    Hayes, A. C.; Friar, J. L.; Moeller, P.

    2008-01-01

    The lowest-known excited state in nuclei is the 7.6 eV isomer of 229 Th. This energy is within the range of laser-based investigations that could allow accurate measurements of possible temporal variation of this energy splitting. This in turn could probe temporal variation of the fine-structure constant or other parameters in the nuclear Hamiltonian. We investigate the sensitivity of this transition energy to these quantities. We find that the two states are predicted to have identical deformations and thus the same Coulomb energies within the accuracy of the model (viz., within roughly 30 keV). We therefore find no enhanced sensitivity to variation of the fine-structure constant. In the case of the strong interaction the energy splitting is found to have a complicated dependence on several parameters of the interaction, which makes an accurate prediction of sensitivity to temporal changes of fundamental constants problematical. Neither the strong- nor Coulomb-interaction contributions to the energy splitting of this doublet can be constrained within an accuracy better than a few tens of keV, so that only upper limits can be set on the possible sensitivity to temporal variations of the fundamental constants

  1. Correction to the paper “a simple model to determine the interrelation between the integral characteristics of hall thrusters” [Plasma Physics Reports 40, 229 (2014)

    International Nuclear Information System (INIS)

    Shumilin, V. P.; Shumilin, A. V.; Shumilin, N. V.

    2015-01-01

    The paper is devoted to comparison of experimental data with theoretical predictions concerning the dependence of the current of accelerated ions on the operating voltage of a Hall thruster with an anode layer. The error made in the paper published by the authors in Plasma Phys. Rep. 40, 229 (2014) occurred because of a misprint in the Encyclopedia of Low-Temperature Plasma. In the present paper, this error is corrected. It is shown that the simple model proposed in the above-mentioned paper is in qualitative and quantitative agreement with experimental results

  2. Time-dependent differences in management and microbiology of orthopaedic internal fixation-associated infections: an observational prospective study with 229 patients.

    Science.gov (United States)

    Kuehl, R; Tschudin-Sutter, S; Morgenstern, M; Dangel, M; Egli, A; Nowakowski, A; Suhm, N; Theilacker, C; Widmer, A F

    2018-04-10

    Little information has been published on orthopaedic internal fixation-associated infections. We aimed to analyse time-dependent microbiology, treatment, and outcome. Over a 10-year period, all consecutive patients with internal fixation-associated infections at the University Hospital of Basel, were prospectively followed and clinical, microbiological and outcome data were acquired. Infections were classified as early (0-2 weeks after implantation), delayed (3-10 weeks), and late (>10 weeks). Two hundred and twenty-nine patients were included, with a median follow-up of 773 days (IQR 334-1400). Staphylococcus aureus was the most prevalent pathogen (in 96/229 patients, 41.9%). Enterobacteriaceae were frequent in early infections (13/49, 26.5%), whereas coagulase-negative staphylococci (36/92, 39.1%), anaerobes (15/92, 16.3%) and streptococci (10/92, 10.9%) increased in late revisions. Failure was observed in 27/229 (11.7%). Implants were retained in 42/49 (85.7%) in early, in 51/88 (57.9%) in delayed, and in 9/92 (9.8%) in late revisions (p < 0.01). Early revisions failed in 6/49 (12.2%), delayed in 9/88 (10.2%), and late in 11/92 (13.0%) (p 0.81). Debridement and retention failed in 6/42 (14.3%) for early, in 6/51 (11.8%) for delayed, and in 3/9 (33.3%) for late revisions (p 0.21). Biofilm-active antibiotic therapy tailored to resistance correlated with improved outcome for late revisions failure (6/72, 7.7% versus 6/12, 50.0%; p < 0.01) but not for early revisions failure (5/38, 13.2% versus 1/11, 9.1%; p 1.0). Treatment of internal fixation-associated infections showed a high success rate of 87-90% over all time periods. Implant retention was highly successful in early and delayed infections but only limited in late infections. Copyright © 2018 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

  3. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    Ahlquist, A.J.

    1981-01-01

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  4. Determination of radionuclides in discharged water from gold ...

    African Journals Online (AJOL)

    Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

  5. Promoter Hypermethylation of the EMP3 Gene in a Series of 229 Human Gliomas

    Directory of Open Access Journals (Sweden)

    Marta Mellai

    2013-01-01

    Full Text Available The epithelial membrane protein 3 (EMP3 is a candidate tumor suppressor gene in the critical region 19q13.3 for several solid tumors, including tumors of the nervous systems. The aim of this study was to investigate the EMP3 promoter hypermethylation status in a series of 229 astrocytic and oligodendroglial tumors and in 16 GBM cell lines. The analysis was performed by methylation-specific PCR and capillary electrophoresis. Furthermore, the EMP3 expression at protein level was evaluated by immunohistochemistry and Western blotting analysis. Associations of EMP3 hypermethylation with total 1p/19q codeletion, MGMT promoter hypermethylation, IDH1/IDH2 and TP53 mutations, and EGFR amplification were studied, as well as its prognostic significance. The EMP3 promoter hypermethylation has been found in 39.5% of gliomas. It prevailed in low-grade tumors, especially in gliomas with an oligodendroglial component, and in sGBMs upon pGBMs. In oligodendroglial tumors, it was strongly associated with both IDH1/IDH2 mutations and total 1p/19q codeletion and inversely with EGFR gene amplification. No association was found with MGMT hypermethylation and TP53 mutations. In the whole series, the EMP3 hypermethylation status correlated with 19q13.3 loss and lack of EMP3 expression at protein level. A favorable prognostic significance on overall survival of the EMP3 promoter hypermethylation was found in patients with oligodendroglial tumors.

  6. K2-29 b/WASP-152 b: AN ALIGNED AND INFLATED HOT JUPITER IN A YOUNG VISUAL BINARY

    International Nuclear Information System (INIS)

    Santerne, A.; Barros, S. C. C.; Mena, E. Delgado; Montalto, M.; Sousa, S. G.; Adibekyan, V.; Hébrard, G.; Lillo-Box, J.; Barrado, D.; Armstrong, D. J.; Pollacco, D.; Osborn, H. P.; Demangeon, O.; Deleuil, M.; Debackere, A.; Arlic, G.; Barthe, G.; Abe, L.; Almenara, J.-M.; André, P.

    2016-01-01

    In the present paper we report the discovery of a new hot Jupiter, K2-29 b, first detected by the Super-WASP observatory and then by the K2 space mission during its campaign 4. The planet has a period of 3.25 days, a mass of 0.73 ± 0.04 M ♃ , and a radius of 1.19 ± 0.02 R ♃ . The host star is a relatively bright ( V = 12.5) G7 dwarf with a nearby K5V companion. Based on stellar rotation and the abundance of lithium, we find that the system might be as young as ∼450 Myr. The observation of the Rossiter–McLaughlin effect shows that the planet is aligned with respect to the stellar spin. Given the deep transit (20 mmag), the magnitude of the star and the presence of a nearby stellar companion, the planet is a good target for both space- and ground-based transmission spectroscopy, in particular in the near-infrared where both stars are relatively bright.

  7. K2-29 b/WASP-152 b: AN ALIGNED AND INFLATED HOT JUPITER IN A YOUNG VISUAL BINARY

    Energy Technology Data Exchange (ETDEWEB)

    Santerne, A.; Barros, S. C. C.; Mena, E. Delgado; Montalto, M.; Sousa, S. G.; Adibekyan, V. [Instituto de Astrofísica e Ciências do Espaço, Universidade do Porto, CAUP, Rua das Estrelas, 4150-762 Porto (Portugal); Hébrard, G. [Institut d’Astrophysique de Paris, UMR7095 CNRS, Université Pierre and Marie Curie, 98bis boulevard Arago, F-75014 Paris (France); Lillo-Box, J.; Barrado, D. [Departamento de Astrofsica, Centro de Astrobiologa (CSIC-INTA), ESAC campus E-28692 Villanueva de la Caada (Madrid) (Spain); Armstrong, D. J.; Pollacco, D.; Osborn, H. P. [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom); Demangeon, O.; Deleuil, M. [Aix Marseille Université, CNRS, Laboratoire d’Astrophysique de Marseille UMR 7326, F-13388, Marseille (France); Debackere, A.; Arlic, G.; Barthe, G. [European Pro/Am Network of Exoplanetary Transit Observers (France); Abe, L. [Laboratoire Lagrange, UMR7239, Université de Nice Sophia-Antipolis, CNRS, Observatoire de la Cote d’Azur, F-06300 Nice (France); Almenara, J.-M. [Université Grenoble Alpes, IPAG, F-38000 Grenoble (France); André, P., E-mail: alexandre.santerne@astro.up.pt [Observatoire de Belesta-en-Lauragais-Assoc. Astronomie Adagio 30 Route de Revel, F-31450 Varennes (France); and others

    2016-06-10

    In the present paper we report the discovery of a new hot Jupiter, K2-29 b, first detected by the Super-WASP observatory and then by the K2 space mission during its campaign 4. The planet has a period of 3.25 days, a mass of 0.73 ± 0.04 M {sub ♃}, and a radius of 1.19 ± 0.02 R {sub ♃}. The host star is a relatively bright ( V = 12.5) G7 dwarf with a nearby K5V companion. Based on stellar rotation and the abundance of lithium, we find that the system might be as young as ∼450 Myr. The observation of the Rossiter–McLaughlin effect shows that the planet is aligned with respect to the stellar spin. Given the deep transit (20 mmag), the magnitude of the star and the presence of a nearby stellar companion, the planet is a good target for both space- and ground-based transmission spectroscopy, in particular in the near-infrared where both stars are relatively bright.

  8. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    Riedhauser, S.R.

    1994-06-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  9. Assessment of contralateral neck failure in 229 cases of carcinoma of the tonsillar region treated with techniques designed to spare contralateral parotid function

    International Nuclear Information System (INIS)

    O'Sullivan, B.; Warde, P.; Grice, B.; Goh, C.; Keane, T.; Payne, D.; Liu, F-F.; McLean, M.; Waldron, J.; Cummings, B.

    1996-01-01

    Purpose/Objective: Radiation-induced xerostomia is a frequent cause of morbidity in head and neck cancer patients. To minimize this complication unilateral techniques (UT) designed to treat the primary tumor and ipsilateral neck have been used for many years in selected cases at our institution. Although such techniques exclude the contralateral parotid from the high dose target volume, they also leave the contralateral neck nodes untreated. The purpose of the study was to evaluate the risk of failure in the opposite neck. Materials and Methods: We identified 229 patients treated with UT from a series of 641 cases with carcinoma of the tonsillar region treated with curative intent between 1970 and 1991. Detailed documentation of the tumor, the radiation dosimetry, the sites of failure, and outcome including local, regional, and distant failure, and late complications, were performed. Actuarial 5-year plots were used to calculate local control, regional control, and survival rates. Results: Median age was 61 years (74 females/155 males); median follow-up 8 years (range 6 months to 21 years). AJCC (1992) T categories were T1:73, T2:120, T3:30, T4:6. The N category distribution was: N0:136, N1:53, N2a:29, N2b:8, and N3:8 cases. Base of tongue and palate were involved in 49 and 82 cases respectively. Irradiation techniques consisted of ipsilateral wedge pairs with Cobalt of 6MV photons in 210 cases (92%), while the remainder were electrons with or without photons. Customized compensators were used in the majority of cases in addition to the use of wedge filters. 75% received 50 Gy in 4 weeks, 10% received 60 Gy in 6 weeks, while the remainder received other doses intended to be curative. A radioactive implant was also used in 20 patients. The 5-year actuarial rates were as follows: overall local control: 76%, regional node control: 80%; cause specific survival: 80%. A total of 7 patients manifested regional disease in the opposite neck (crude rate of 3% or 7 of 229

  10. Radiometric determination of {sup 226}, {sup 228}Ac and {sup 40}K in fly ashes and building materials

    Energy Technology Data Exchange (ETDEWEB)

    Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science

    1996-12-31

    In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.

  11. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  12. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  13. 'Masurium' and the 'early transuranium elements' or how discovery of nuclear fission was not clearly seen

    International Nuclear Information System (INIS)

    Keller, C.

    1988-01-01

    Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de

  14. Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators

    Science.gov (United States)

    Wolszczak, W.; Dorenbos, P.

    2017-06-01

    Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.

  15. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  16. Calculation of entropy of liquid metals using acoustic measurements in the framework of the rigid sphere model

    International Nuclear Information System (INIS)

    Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.

    2001-01-01

    For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru

  17. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  18. ANTI-B-CELL THERAPY AT IMMUNE INFLAMMATORY RHEUMATIC DISEASES: EFFICACY AND TOLERABILITY IN 229 PATIENTS

    Directory of Open Access Journals (Sweden)

    L. P. Ananieva

    2014-01-01

    Full Text Available Objective: to assess the efficacy and tolerability of Rituximab treatment in patients with serious immune inflammatory rheumatic diseases (IRD like systemic lupus erythematosus (SLE, systemic sclerosis (SS, systemic vasculitis (SV, Sjogren syndrome (SjS, dermatomyositis/polymyositis (DM/PM.Subjects and methods. The clinical efficacy has been analyzed in 229 patients with IRD: SLE (n=97, SV (n=50, SS (n=40, SjS (n=23 and DM/PM (n=19. Rituximab treatment was accompanied by administration of glucocorticoids and/or immunosuppressive drugs. Most patients demonstrated resistance to or low tolerability of standard therapy. Efficacy of treatment was analyzed in each group with the criteria relevant for each disease. To compare clinical response to the treatment between the groups we used gradations accepted by international registries: complete (good response, partial response, no response. Average duration of monitoring comprised 72 (1–288 weeks after the first introduction of Rituximab. Average Rituximab dose administered to patients over the period of monitoring was low and varied from 1.6±0.84 in DM/PM to 3.1±1.75 in SV. About 80% of patients received one or two courses of Rituximab except for patients with SS (half of them received three and more courses.Results. «Complete response» was observed in 50.6%, «partial response» – in 35% of patients. Rituximab courses provided positive dynamics in clinical scores and allowed to reduce supportive dose of glucocorticoids and to lower the dose or withdraw of immune-stimulating drugs. Multiple Rituximab courses provided stable and longlasting effect. Recurrences were observed less frequently, whereas efficacy of the therapy increased during a year and longer. Occurrence of adverse events and mortality rate were comparable to data of other national Rituximab registries.Conclusion. The results of the study may prove administration of Rituximab in patients with resistance to standard

  19. False-Positive Results in a Recombinant Severe Acute Respiratory Syndrome-Associated Coronavirus (SARS-CoV) Nucleocapsid Enzyme-Linked Immunosorbent Assay Due to HCoV-OC43 and HCoV-229E Rectified by Western Blotting with Recombinant SARS-CoV Spike Polypeptide

    OpenAIRE

    Woo, Patrick C. Y.; Lau, Susanna K. P.; Wong, Beatrice H. L.; Chan, Kwok-Hung; Hui, Wai-Ting; Kwan, Grace S. W.; Peiris, J. S. Malik; Couch, Robert B.; Yuen, Kwok-Yung

    2004-01-01

    Using paired serum samples obtained from patients with illness associated with increases in anti-human coronavirus OC43 (HCoV-OC43) or anti-HCoV-229E antibodies, we examined the possibility of false-positive results detected in a recombinant severe acute respiratory syndrome (SARS)-associated coronavirus (SARS-CoV) nucleocapsid protein immunoglobulin G enzyme-linked immunosorbent assay (ELISA). Three of the 21 and 1 of the 7 convalescent-phase serum samples from persons with increases in anti...

  20. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    International Nuclear Information System (INIS)

    Payne, T.E.

    1991-01-01

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  1. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    International Nuclear Information System (INIS)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

    2017-01-01

    The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Journal of Naval Science. Volume 2. Number 3. July 1976

    Science.gov (United States)

    1976-07-01

    supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10

  4. Laser excitation of 8-eV electronic states in Th{sup +}. A first pillar of the electronic bridge toward excitation of the Th-229 nucleus

    Energy Technology Data Exchange (ETDEWEB)

    Herrera-Sancho, Oscar-Andrey

    2012-11-23

    The possibility to realize a nuclear clock based on the optical magnetic dipole transition from the ground state to the low-energy isomeric state in the {sup 229}Th nucleus has motivated experiments and proposals toward highly accurate clocks with trapped ions and highly stable optical frequency standards with Th-doped solids. These systems hold great promise to open a field of research in the borderland between atomic and nuclear physics, which will enable highly sensitive tests of postulates from fundamental physics and also will allow us to coherently excite and control nuclear states, opening a wonderful and intriguing new field in physics. A major experimental obstacle that has to be overcome before any precision spectroscopy can be performed with this system is however the insufficient knowledge on the exact transition energy. The best experimental result so far is an indirect determination from {gamma}-spectroscopy with a relative uncertainty of about 6%. To facilitate the search for the nuclear transition within a wide uncertainty range around 8 eV, we investigate two-photon excitation in the dense electronic level structure of Th{sup +}, which enables the nuclear excitation via a resonantly enhanced inverse electronic bridge process. Experiments on one- and two-photon laser excitation of buffer gas cooled {sup 232}Th{sup +} ions in a radio-frequency ion trap are reported in this thesis. The strongest resonance line at 402 nm from the (6d{sup 2}7s)J=3/2 ground state to the (6d7s7p)J=5/2 state is driven as the first excitation step. Using nanosecond laser pulses in the 250-nm wavelength range for the second step of a two-photon excitation, we have observed seven previously unknown levels in the unexplored region of the electronic level structure around 8 eV. This investigation shows that the Th{sup +} ion seems to be well suited for the search of the isomer transition because both, theory and experimental results, agree on the density of strong transitions

  5. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  6. 77 FR 19128 - Defense Federal Acquisition Regulation Supplement: Separation of Combined Provisions and Clauses...

    Science.gov (United States)

    2012-03-30

    .... (2) Use the provision at 252.229-7013, Tax Exemptions (Spain)-- Representation, in solicitations that... (Spain)--representation. As prescribed in 229.402-70(e)(2), use the following clause: TAX EXEMPTIONS...)--Representation. 252.229-7005, Tax Exemptions (Spain)... 252.229-7013, Tax Exemptions (Spain)--Representation...

  7. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  8. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    International Nuclear Information System (INIS)

    2006-01-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  9. 229 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    In this study, the conventional microbiological culture methods were used to ... from 120 vegetable samples of five different types; which were all obtained at seven ... pure isolates testing positive as being pathogenic after biochemical analysis.

  10. 229 ORIGINAL ARTILE

    African Journals Online (AJOL)

    Boaz

    and Environmental Modeling System (BioTEMS) was used to analyze ... epidemiologic surveillance to mitigate outbreaks and to test anti-microbial delivery systems such as the .... Rocky Mountain spotted fever, avian influenza, plague, ... Orange polygon- moderate risk of EBOV, Yellow polygon-lower risk of EBOV; blue ...

  11. Agency 229 Matters

    OpenAIRE

    Virginia Tech Office of Economic Development

    2017-01-01

    The Virginia Tech Office of Economic Development was commissioned to conduct a study of current impacts of VAES and Extension on the economy and to gather recommendations from industry on how funding could be leveraged to drive more innovation and advancement. The office spoke with more than 200 stakeholders from private industry, local and state government; VCE agents, specialists, volunteers, and clients; VAES researchers; and many of the agricultural councils and commodity groups that fund...

  12. 78 FR 13154 - Petition for Waiver of Compliance

    Science.gov (United States)

    2013-02-26

    ..., Locomotives used in switching service; 229.47, Emergency brake valve; 229.115, Slip/slide alarms; 229.125... mobile switches, shoves, and pulls all railcars with their train air brakes cut in to maintain control of...

  13. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    Higgo, J.J.W.

    1987-09-01

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  14. Calculation technique of free and impurity ion electronic structures

    International Nuclear Information System (INIS)

    Kulagin, N.A.; Sviridov, D.T.

    1986-01-01

    The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix

  15. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

    2010-01-01

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  16. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-09-01

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

  17. Unique natural exopolysaccharides for biomimetic protective effect against urban pollution.

    Science.gov (United States)

    Borel, Magali; Lamarque, Elisabeth; Loing, Estelle

    Through natural selection, living organisms have evolved well-adapted survival strategies over time. The shallow salt waters of Moorea lagoon are the site of accumulation of microbial mats called "Kopara," in the native Polynesian language. This unique ecosystem is rich in film-forming exopolysaccharides (EPSs) secreted by microorganisms within the biofilm, as a mean to protect themselves from environmental stress (strong ultraviolet [UV], pH, salinity … ). Using blue biotechnology, a manufacturing process was developed to obtain an EPS with skin benefits. The active ingredient (EPS-229) protects against urban pollution, including free radicals, heavy metals, hydrocarbons, and PM 2.5 (particulate matter with a size lower than 2.5 μm). The anti-lipid peroxidation action of EPS-229 was studied in an in vitro UVB-irradiated keratinocyte culture model, using lipophilic fluorescent probe. The chelating properties of EPS-229 were evaluated in tubo in the presence of cadmium and lead. The protective effect of EPS-229 on pollution-exposed skin explants was investigated through quantification of released malondialdehyde (MDA) and histological observation of skin morphology using optical microscopy. Clinical evaluation of the protective and cleansing efficacy of a water solution containing EPS-229 (0.02% and 0.01% w/v, respectively) was performed, against placebo, on a panel of 18 volunteers. For these studies, the forearms of volunteers were treated with EPS-229 before (anti-adhesion affect) or after (cleansing effect) application of PM 2.5 (iron particles of 1 μm). The presence of skin-adherent particles was observed and quantified by image analysis, using specific digital masks. In vitro , EPS-229 significantly protected keratinocyte cell membranes from lipid peroxidation. A decrease of 28% was achieved when a concentration of 0.001% w/v EPS-229 was applied to the cell culture. In tubo , EPS-229 also presented strong chelating properties. Maximal adsorption was

  18. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  19. Dissolved Concentration Limits of Radioactive Elements

    International Nuclear Information System (INIS)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  20. Hausdorff gaps and towers in P(\\omega)/Fin

    Czech Academy of Sciences Publication Activity Database

    Borodulin-Nadzieja, P.; Chodounský, David

    2015-01-01

    Roč. 229, č. 3 (2015), s. 197-229 ISSN 0016-2736 R&D Projects: GA AV ČR IAA100190902 Institutional support: RVO:67985840 Keywords : Hausdorff gaps * special gaps * towers Subject RIV: BA - General Mathematics Impact factor: 0.553, year: 2015 http://journals.impan.pl/cgi-bin/doi?fm229-3-1

  1. How fission was discovered

    International Nuclear Information System (INIS)

    Fluegge, S.

    1989-01-01

    After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission

  2. Determination of the extraction efficiency for {sup 233}U source α-recoil ions from the MLL buffer-gas stopping cell

    Energy Technology Data Exchange (ETDEWEB)

    Wense, Lars v.d.; Seiferle, Benedict; Thirolf, Peter G. [Ludwig-Maximilians-Universitaet Muenchen, Garching (Germany); Laatiaoui, Mustapha [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Helmholtz Institut Mainz, Mainz (Germany)

    2015-03-01

    Following the α decay of {sup 233}U, {sup 229}Th recoil ions are shown to be extracted in a significant amount from the MLL buffer-gas stopping cell. The produced recoil ions and subsequent daughter nuclei are mass purified with the help of a customized quadrupole mass spectrometer. The combined extraction and mass purification efficiency for {sup 229}Th{sup 3+} is determined via MCP-based measurements and via the direct detection of the {sup 229}Th α decay. A large value of (10±2)% for the combined extraction and mass purification efficiency of {sup 229}Th{sup 3+} is obtained at a mass resolution of about 1u/e. In addition to {sup 229}Th, also other α-recoil ions of the {sup 233,} {sup 232}U decay chains are addressed. (orig.)

  3. Prevalence of gallstones in 1,229 patients submitted to surgical laparoscopic treatment of GERD and esophageal achalasia: associated cholecystectomy was a safe procedure.

    Science.gov (United States)

    Sallum, Rubens Antonio Aissar; Padrão, Eduardo Messias Hirano; Szachnowicz, Sergio; Seguro, Francisco C B C; Bianchi, Edno Tales; Cecconello, Ivan

    2015-01-01

    Association between esophageal achalasia/ gastroesophageal reflux disease (GERD) and cholelithiasis is not clear. Epidemiological data are controversial due to different methodologies applied, the regional differences and the number of patients involved. Results of concomitant cholecistectomy associated to surgical treatment of both diseases regarding safety is poorly understood. To analyze the prevalence of cholelithiasis in patients with esophageal achalasia and gastroesophageal reflux submitted to cardiomyotomy or fundoplication. Also, to evaluate the safety of concomitant cholecistectomy. Retrospective analysis of 1410 patients operated from 2000 to 2013. They were divided into two groups: patients with GERD submitted to laparocopic hiatoplasty plus Nissen fundoplication and patients with esophageal achalasia to laparoscopic cardiomyotomy plus partial fundoplication. It was collected epidemiological data, specific diagnosis and subgroups, the presence or absence of gallstones, surgical procedure, operative and clinical complications and mortality. All groups/subgroups were compared. From 1,229 patients with GERD or esophageal achalasia, submitted to laparoscopic cardiomyotomy or fundoplication, 138 (11.43%) had cholelitiasis, occurring more in females (2.38:1) with mean age of 50,27 years old. In 604 patients with GERD, 79 (13,08%) had cholelitiasis. Lower prevalence occurred in Barrett's esophagus patients 7/105 (6.67%) (p=0.037). In 625 with esophageal achalasia, 59 (9.44%) had cholelitiasis, with no difference between chagasic and idiopathic forms (p=0.677). Complications of patients with or without cholecystectomy were similar in fundoplication and cardiomyotomy (p=0.78 and p=1.00).There was no mortality or complications related to cholecystectomy in this series. Prevalence of cholelithiasis was higher in patients submitted to fundoplication (GERD). Patients with chagasic or idiopatic forms of achalasia had the same prevalence of cholelithiasis. Gallstones

  4. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  5. A small-molecule benzimidazole derivative that potently activates AMPK to increase glucose transport in skeletal muscle: comparison with effects of contraction and other AMPK activators.

    Science.gov (United States)

    Lai, Yu-Chiang; Kviklyte, Samanta; Vertommen, Didier; Lantier, Louise; Foretz, Marc; Viollet, Benoît; Hallén, Stefan; Rider, Mark H

    2014-06-15

    AMPK (AMP-activated protein kinase) is an attractive therapeutic drug target for treating metabolic disorders. We studied the effects of an AMPK activator developed by Merck (ex229 from patent application WO2010036613), comparing chemical activation with contraction in intact incubated skeletal muscles. We also compared effects of ex229 with those of the Abbott A769662 compound and AICAR (5-amino-4-imidazolecarboxamide riboside). In rat epitrochlearis muscle, ex229 dose-dependently increased AMPK activity of α1-, α2-, β1- and β2-containing complexes with significant increases in AMPK activity seen at a concentration of 50 μM. At a concentration of 100 μM, AMPK activation was similar to that observed after contraction and importantly led to an ~2-fold increase in glucose uptake. In AMPK α1-/α2-catalytic subunit double-knockout myotubes incubated with ex229, the increases in glucose uptake and ACC (acetyl-CoA carboxylase) phosphorylation seen in control cells were completely abolished, suggesting that the effects of the compound were AMPK-dependent. When muscle glycogen levels were reduced by ~50% after starvation, ex229-induced AMPK activation and glucose uptake were amplified in a wortmannin-independent manner. In L6 myotubes incubated with ex229, fatty acid oxidation was increased. Furthermore, in mouse EDL (extensor digitorum longus) and soleus muscles, ex229 increased both AMPK activity and glucose uptake at least 2-fold. In summary, ex229 efficiently activated skeletal muscle AMPK and elicited metabolic effects in muscle appropriate for treating Type 2 diabetes by stimulating glucose uptake and increasing fatty acid oxidation.

  6. Perceived Stress and Its Relationship With Chronic Medical Conditions and Multimorbidity Among 229,293 Community-Dwelling Adults in 44 Low- and Middle-Income Countries.

    Science.gov (United States)

    Vancampfort, Davy; Koyanagi, A; Ward, Philip B; Veronese, Nicola; Carvalho, André F; Solmi, Marco; Mugisha, James; Rosenbaum, Simon; De Hert, Marc; Stubbs, Brendon

    2017-10-15

    In this study, we assessed the association of chronic medical conditions and multimorbidity with perceived stress among community-dwelling adults in 44 low- and middle-income countries. Data from the World Health Survey (2002-2004), including 229,293 adults, were analyzed. A perceived stress score (range, 0 (lowest stress)-100 (highest stress)) was computed on the basis of 2 questions from the Perceived Stress Scale. Eleven chronic conditions were assessed. Multivariable linear regression analyses were conducted to explore the associations. All chronic conditions were associated with significantly higher mean perceived stress scores, with the exception of edentulism. The associations were particularly strong for depression (β = 14.71, 95% confidence interval (CI): 13.68, 15.74), visual impairment (β = 10.66, 95% CI: 8.09, 13.23), and schizophrenia (β = 9.98, 95% CI: 7.71, 12.24). Compared with no chronic conditions, the β coefficients for perceived stress with the presence of 1, 2, 3, and ≥4 chronic conditions were 5.58 (95% CI: 4.94, 6.23), 9.58 (95% CI: 8.67, 10.49), 14.15 (95% CI: 12.63, 15.67), and 20.17 (95% CI: 18.29, 22.05), respectively. The associations with perceived stress were significantly stronger among the poorest individuals for arthritis, asthma, diabetes, edentulism, and ≥4 chronic conditions. Our data suggest that a range of chronic conditions and multimorbidity are associated with greatly increased perceived stress among people in low- and middle-income countries, and that the poorest persons may be a particularly vulnerable group. © The Author(s) 2017. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  7. Process for radioisotope recovery and system for implementing same

    Science.gov (United States)

    Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

    2009-10-06

    A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

  8. A human coronavirus responsible for the common cold massively kills dendritic cells but not monocytes.

    Science.gov (United States)

    Mesel-Lemoine, Mariana; Millet, Jean; Vidalain, Pierre-Olivier; Law, Helen; Vabret, Astrid; Lorin, Valérie; Escriou, Nicolas; Albert, Matthew L; Nal, Béatrice; Tangy, Frédéric

    2012-07-01

    Human coronaviruses are associated with upper respiratory tract infections that occasionally spread to the lungs and other organs. Although airway epithelial cells represent an important target for infection, the respiratory epithelium is also composed of an elaborate network of dendritic cells (DCs) that are essential sentinels of the immune system, sensing pathogens and presenting foreign antigens to T lymphocytes. In this report, we show that in vitro infection by human coronavirus 229E (HCoV-229E) induces massive cytopathic effects in DCs, including the formation of large syncytia and cell death within only few hours. In contrast, monocytes are much more resistant to infection and cytopathic effects despite similar expression levels of CD13, the membrane receptor for HCoV-229E. While the differentiation of monocytes into DCs in the presence of granulocyte-macrophage colony-stimulating factor and interleukin-4 requires 5 days, only 24 h are sufficient for these cytokines to sensitize monocytes to cell death and cytopathic effects when infected by HCoV-229E. Cell death induced by HCoV-229E is independent of TRAIL, FasL, tumor necrosis factor alpha, and caspase activity, indicating that viral replication is directly responsible for the observed cytopathic effects. The consequence of DC death at the early stage of HCoV-229E infection may have an impact on the early control of viral dissemination and on the establishment of long-lasting immune memory, since people can be reinfected multiple times by HCoV-229E.

  9. Stratified Outcome Evaluation of Peritonitis

    African Journals Online (AJOL)

    Risk evaluation in secondary peritonitis can direct treatment planning, predict ... ulcer (22.9%) and ileum (18.6%). Patients who complicated .... Frequency Percentage. Appendicitis. 22. 31.4%. Duodenal perforation. 16. 22.9%. Ileal. 13. 18.6%.

  10. The chemistry of the actinide elements. Volume I

    International Nuclear Information System (INIS)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

  11. A neutron source of variable fluence

    International Nuclear Information System (INIS)

    Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.

    1975-01-01

    The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr

  12. 32 CFR 229.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., bone, ivory, shell, metal, wood, hide, feathers, pigments, and flaked, ground, or pecked stone); (iv.../agricultural gardens or fields, bedrock mortars or grinding surfaces, rock alignments, cairns, trails, borrow...

  13. 49 CFR 229.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... the Association of American Railroads. Acceptable quality level (AQL). The AQL is expressed in terms of percent defective or defects per 100 units. Lots having a quality level equal to a specified AQL... intersection of the side wall and the roof sheathing. Sand delivery system means a permanently stationed or...

  14. 12 CFR 229.56 - Liability.

    Science.gov (United States)

    2010-01-01

    ...) Comparative negligence. (i) If a person incurs damages that resulted in whole or in part from that person's negligence or failure to act in good faith, then the amount of any damages due to that person under paragraph (a)(1) of this section shall be reduced in proportion to the amount of negligence or bad faith...

  15. 50 CFR 229.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... interactions, fishing operations, marine mammal life history information, and other scientific data, and... inches (17.78 cm). Spotter plane means a plane that is deployed for the purpose of locating schools of...

  16. 12 CFR 229.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM AVAILABILITY...) Unit of general local government means any city, county, parish, town, township, village, or other... government, such as school districts or water districts. (ll) Wire transfer means an unconditional order to a...

  17. 12 CFR 229.13 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ... the existence of facts that would cause a well-grounded belief in the mind of a reasonable person... another bank; (3) A war; or (4) An emergency condition beyond the control of the depositary bank, if the...

  18. A comprehensive database of Duchenne and Becker muscular dystrophy patients in Children's Hospital of Fudan University

    Directory of Open Access Journals (Sweden)

    Xi-hua LI

    2015-05-01

    Full Text Available Background China is one of the countries that have the largest number of patients suffering from Duchenne and Becker muscular dystrophy (DMD/BMD. Although the building of international DMD/BMD databases has laid a foundation for clinical drug development and clinical trials, it has not yet been carried out in China. In this study, a modified registry form of Remudy was applied to 229 DMD/BMD patients in order to establish a comprehensive database, which will lay the groundwork for international cooperation.  Methods A total of 229 DMD/BMD patients diagnosed by genetic testing or muscle biopsy admitted in Children's Hospital of Fudan University (CHFU during the period of August 2011 to December 2013 were enrolled in this study. The data included sex, age, age at diagnosis, geographic distribution of patients, DMD gene mutation types, family history, walking capability, cardiac and respiratory function, steroid treatment and rehabilitation intervention.  Results There were 194 DMD and 35 BMD male patients who were diagnosed at the age of 0-18 years, and among them, most patients were diagnosed at the age of > 3-4 (16.59%, 38/229 and > 7-8 (14.85%, 34/229 years. Exon deletion was the most frequent genetic mutations for DMD/BMD [65.46% (127/194 and 74.29% (26/35], respectively. Patients with a family history accounted for 23.14% (53/229. The rate of DMD registrants losing walking capability was 17.53% (34/194, and all the BMD registrants were able to walk. Cardiac functions were examined in 46.29% (106/229 DMD/BMD boys and respiratory functions were examined in 17.90% (41/229 DMD/BMD boys. The proportion of DMD patients receiving prednisone with dosage of 0.75 mg/(kg·d was 26.29% (51/194.  Conclusions This database describes in detail the genotype, clinical manifestation, diagnosis and treatment and rehabilitation status of 229 DMD/BMD patients in China. The database not only provides comprehensive information for DMD/BMD patient management

  19. Ixodes scapularis saliva mitigates inflammatory cytokine secretion during Anaplasma phagocytophilum stimulation of immune cells

    Czech Academy of Sciences Publication Activity Database

    Chen, G.; Severo, M. S.; Sohail, M.; Sakhon, O. S.; Wikel, S. K.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 5, č. 1 (2012), s. 229 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Tick * Ixodes scapularis * Saliva * Anaplasma phagocytophilum * Rickettsial agent Subject RIV: EC - Immunology Impact factor: 3.246, year: 2012 http://www.parasitesandvectors.com/content/5/1/229

  20. Integrated interpretation of geophysical and geological data: Tectonic implications. Tectonic pattern of the intraplate deformation area

    Digital Repository Service at National Institute of Oceanography (India)

    Neprochnov, Y.P; Rao, D.G; Buravtsev, A.A.; Levchenko, O.V.; Murthy, K.S

    stream_size 4 stream_content_type text/plain stream_name Mem_Geol_Soc_India_1998_39_229.pdf.txt stream_source_info Mem_Geol_Soc_India_1998_39_229.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  1. Characterization of novel human respiratory viruses

    NARCIS (Netherlands)

    Dijkman, R.

    2011-01-01

    Wereldwijd komen vier humane coronavirussen (HCoVs) voor, waaronder NL63 en 229E. NL63 werd in 2004 ontdekt in het AMC en veroorzaakt de kinderziekte pseudokroep; 229E is een verkoudheidsvirus. Waarschijnlijk veroorzaken beide virussen vergelijkbare symptomen bij volwassenen. Er is weinig bekend

  2. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    Marx, Sebastian Markus

    2014-01-01

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  3. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  4. Development of ion beam sputtering techniques for actinide target preparation

    International Nuclear Information System (INIS)

    Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

    1985-01-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

  5. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  6. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

    1979-01-01

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  7. The effect of lance geometry and carbon coating of silicon lances on propidium iodide uptake in lance array nanoinjection of HeLa 229 cells

    Science.gov (United States)

    Sessions, John W.; Lindstrom, Dallin L.; Hanks, Brad W.; Hope, Sandra; Jensen, Brian D.

    2016-04-01

    Connecting technology to biologic discovery is a core focus of non-viral gene therapy biotechnologies. One approach that leverages both the physical and electrical function of microelectromechanical systems (MEMS) in cellular engineering is a technology previously described as lance array nanoinjection (LAN). In brief, LAN consists of a silicon chip measuring 2 cm by 2 cm that has been etched to contain an array of 10 μm tall, solid lances that are spaced every 10 μm in a grid pattern. This array of lances is used to physically penetrate hundreds of thousands of cells simultaneously and to then electrically deliver molecular loads into cells. In this present work, two variables related to the microfabrication of the silicon lances, namely lance geometry and coating, are investigated. The purpose of both experimental variables is to assess these parameters’ effect on propidium iodide (PI), a cell membrane impermeable dye, uptake to injected HeLa 229 cells. For the lance geometry experimentation, three different microfabricated lance geometries were used which include a flat/narrow (FN, 1 μm diameter), flat/wide (FW, 2-2.5 μm diameter), and pointed (P, 1 μm diameter) lance geometries. From these tests, it was shown that the FN lances had a slightly better cell viability rate of 91.73% and that the P lances had the best PI uptake rate of 75.08%. For the lance coating experimentation, two different lances were fabricated, both silicon etched lances with some being carbon coated (CC) in a  <100 nm layer of carbon and the other lances being non-coated (Si). Results from this experiment showed no significant difference between lance types at three different nanoinjection protocols (0V, +1.5V DC, and  +5V Pulsed) for both cell viability and PI uptake rates. One exception to this is the comparison of CC/5V Pul and Si/5V Pul samples, where the CC/5V Pul samples had a cell viability rate 5% higher. Both outcomes were unexpected and reveal how to better

  8. 76 FR 47638 - Petition for Waiver of Compliance

    Science.gov (United States)

    2011-08-05

    ... measures. DCTA submitted the first petition for relief (the ``Base Waiver'') in which it sought relief from..., 229.71, 229.135, and Appendix D--Criteria for Certification of Crashworthy Event Recorder Memory... in these proceedings by submitting written views, data, or comments. FRA does not anticipate...

  9. Evolution of Army Attack Aviation: A Chaotic Coupled Pendulums Analogy

    Science.gov (United States)

    2013-05-23

    forward of the FLOT for 36 minutes.32 Ground Campaign: 4-229 AVN Deep Attack, 26-27 February With the commencement of the ground campaign on 24......battalions worth of tanks and armored personnel carriers while receiving no damage to 4-229 AVN aircraft.34 Prior planning, training, and command

  10. Awareness and desirability of the Nigerian antenatal women about ...

    African Journals Online (AJOL)

    Results:Of the 650 subjects, 249(38.3%)were aware of analgesia use in labour and their sources of information were through media (30.9%), antenatal counselling (22.9%), friends/relations (17.3%), internet (5.6%) and others – literature/lectures/ symposium (22.9%). The only factor that influence awareness on logistic ...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 229 of 229 ... Vol 16, No 2 (2004), The deposition of magnesium fluoride (MGF2) thin films by chemical bath deposition (CBD) technique: their characterization and ... Vol 18, No 1 (2006), Variation in well-head gamma radiation levels at the Nigerian Petroleum Development Company oil field, Ologbo, Edo State, ...

  12. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 119; Issue 3. Volume 119, Issue 3. June 2010, pages 229-396. pp 229-247. Active and break spells of the Indian summer monsoon · M Rajeevan Sulochana Gadgil Jyoti Bhate · More Details Abstract Fulltext PDF. In this paper, we suggest criteria for the ...

  13. Identification of a new human coronavirus

    NARCIS (Netherlands)

    van der Hoek, Lia; Pyrc, Krzysztof; Jebbink, Maarten F.; Vermeulen-Oost, Wilma; Berkhout, Ron J. M.; Wolthers, Katja C.; Wertheim-van Dillen, Pauline M. E.; Kaandorp, Jos; Spaargaren, Joke; Berkhout, Ben

    2004-01-01

    Three human coronaviruses are known to exist: human coronavirus 229E (HCoV-229E), HCoV-OC43 and severe acute respiratory syndrome (SARS)-associated coronavirus (SARS-CoV). Here we report the identification of a fourth human coronavirus, HCoV-NL63, using a new method of virus discovery. The virus was

  14. 49 CFR 229.7 - Prohibited acts.

    Science.gov (United States)

    2010-10-01

    ... injury to persons, or has caused death or injury, a penalty not to exceed $100,000 per violation may be... such requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations, and, where a...

  15. Publications | Page 229 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Vocational education, on-the-job training and labour market integration of young workers in urban West Africa (restricted access). Using surveys covering seven West African economic capitals in the early 2000s, this paper describes the labour market integration of youth with regard to their level of formal education and to ...

  16. 12 CFR 229.57 - Consumer awareness.

    Science.gov (United States)

    2010-01-01

    ... (b) of this section, a brief disclosure to each of its consumer customers that describes— (1) That a... consumer customer who receives paid original checks or paid substitute checks with his or her periodic... October 28, 2004, for each consumer who is a customer of the bank on that date; and (ii) At the time the...

  17. 49 CFR 229.27 - Annual tests.

    Science.gov (United States)

    2010-10-01

    ... supply line to the air brake system shall be cleaned, repaired, or replaced. (2) Brake cylinder relay valve portions, main reservoir safety valves, brake pipe vent valve portions, feed and reducing valve portions in the air brake system (including related dirt collectors and filters) shall be cleaned, repaired...

  18. 34 CFR 300.229 - Disciplinary information.

    Science.gov (United States)

    2010-07-01

    ... of any current or previous disciplinary action that has been taken against the child and transmit the... engaged in by the child that required disciplinary action, a description of the disciplinary action taken... statement of current or previous disciplinary action that has been taken against the child. (Authority: 20 U...

  19. 22 CFR 229.235 - Statutory amendments.

    Science.gov (United States)

    2010-04-01

    ... conference; or (ii) The selection of students to attend any such conference; (3) Father-son or mother... operations, faculty and student housing, campus shuttle bus service, campus restaurants, the bookstore, and...

  20. Teaching about Nuclear Disarmament. Fastback 229.

    Science.gov (United States)

    Becker, James, M.

    Background information to help educators teach about nuclear disarmament is presented. There are six sections. The first section, "Nuclear Arms Education: Avoiding the Final Catastrophe," discusses the national priority of preparing for war, militarism as a value, and the mushroom cloud and spaceship earth as symbols of a global age. The second…

  1. Low lying states of Th229

    DEFF Research Database (Denmark)

    Andersen, Torkild; Maack Bisgård, K.; Hansen, P.Gregers

    1961-01-01

    The decay of 1.6 × 105y U233 has been studied by means of a six gap beta-ray spectrometer, a xenon filled proportional counter and scintillation spectrometers. Internal conversion electrons having energies below 100 keV were measured. The mixing ratios for the 42 keV and the 55 keV transitions ag...... agree with the assumed rotational character of the 42 keV and 97 keV states. Results concerning the 163 keV state indicate that this state is also a member of the ground state rotational band.......The decay of 1.6 × 105y U233 has been studied by means of a six gap beta-ray spectrometer, a xenon filled proportional counter and scintillation spectrometers. Internal conversion electrons having energies below 100 keV were measured. The mixing ratios for the 42 keV and the 55 keV transitions...

  2. 49 CFR 229.135 - Event recorders.

    Science.gov (United States)

    2010-10-01

    ...) Distance; (v) Throttle position; (vi) Applications and operations of the train automatic air brake; (vii... automatic air brake, including emergency applications. The system shall record, or provide a means of... responsive to a command originating from or executed by an on-board computer (e.g., electronic braking system...

  3. 49 CFR 229.29 - Biennial tests.

    Science.gov (United States)

    2010-10-01

    ... electric-pneumatic master controllers in the air brake system (including related dirt collectors and... the person performing the work and that person's supervisor shall sign the form. A record of the parts.... The air record shall include the locomotive number, a list of the air brake components, and the date...

  4. Publications | Page 229 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... in which girls and women are discriminated against from birth and socialized to live a life of male subordination. ... Landmark survey tracks decade of changes in India's rural schools ... Tobacco Control in Africa: People, Politics and Policies.

  5. 49 CFR 229.129 - Locomotive horn.

    Science.gov (United States)

    2010-10-01

    .... The locomotive shall be positioned on straight, level track. (6) Measurements shall be taken only when... between 20 percent and 95 percent inclusively; wind velocity is not more than 12 miles per hour and there..., at an angle no greater than 20 degrees from the center line of the track, and oriented with respect...

  6. 47 CFR 22.229 - Designated entities.

    Science.gov (United States)

    2010-10-01

    ... entrepreneur is an entity that, together with its controlling interests and affiliates, has average annual... entrepreneur, as defined in this section, or a consortium of entrepreneurs may use the bidding credit specified...

  7. A cross-sectional study from Pakistan

    African Journals Online (AJOL)

    (DOAJ), African Journal Online, Bioline International, Open-J-Gate and Pharmacy Abstracts. INTRODUCTION .... Social Sciences (SPSS). ... Store for future use. 52 (50.5) 17 ... Friend. 4 (66.7). 2 (33.3). 0 (0). 0 (0). 0 (0). 6 (1.5). Others. 16 (45.7). 8 (22.9). 8 (22.9) .... campaigns for the public and media awareness programs ...

  8. EST Table: FS908806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS908806 E_FL_fufe_15F06_F_0 10/09/28 64 %/229 aa ref|XP_974421.1| PREDICTED: similar to synoviolin.../09/10 58 %/222 aa gnl|Amel|GB14313-PA 10/09/10 64 %/229 aa gi|91087035|ref|XP_974421.1| PREDICTED: similar to synoviolin [Tribolium castaneum] DC547331 fufe ...

  9. Noradrenergic mechanisms and high blood pressure maintenance in genetic hypertension: The role of Gi proteins and voltage-dependent calcium channels

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef; Pintérová, Mária; Líšková, Silvia; Dobešová, Zdenka; Kuneš, Jaroslav

    2007-01-01

    Roč. 29, č. 4 (2007), s. 229-229 ISSN 1064-1963. [International symposium on SHR /12./. 20.10.2006-21.10.2006, Kyoto] R&D Projects: GA MZd(CZ) NR7786 Institutional research plan: CEZ:AV0Z50110509 Keywords : genetic hypertension * noradrenergic mechanisms * Gi proteins * voltage-dependent calcium channels Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

  10. Emergence of Quinolone Resistance amongst Escherichia coli ...

    African Journals Online (AJOL)

    Rate of resistance was 22.3% showing an increase in quinolone resistance when ... FQR E. coli was more common in patients with urinary tract infection (22.9%). ... in the faeces of healthy adults was 22.9%, 6.7% in children and 22.2% in avian. ... thereby aiding the spread of antibiotic resistant strains from avians to human ...

  11. Draft genome sequence of Xylella fastidiosa pear leaf scorch strain in Taiwan

    Science.gov (United States)

    The draft genome sequence of Xylella fastidiosa pear leaf scorch strain (PLS229) isolated from pear cultivar Hengshan (Pyrus pyrifolia) in Taiwan is reported. The bacterium has a genome size of 2,733,013 bp with a G+C content of 53.1%. The PLS229 strain genome was annotated to have 3,259 open readin...

  12. The Business of Politics Commerce, and Culture in East Asia

    DEFF Research Database (Denmark)

    Ooi, Can-Seng

    2016-01-01

    Review of: "Cultural Policies in East Asia: Dynamics Between the State, Arts and Creative Industries". Edited by Hye-Kyung Lee and Lorraine Lim. Basingstoke: Palgrave, Macmillan, 2014. 229 pp.......Review of: "Cultural Policies in East Asia: Dynamics Between the State, Arts and Creative Industries". Edited by Hye-Kyung Lee and Lorraine Lim. Basingstoke: Palgrave, Macmillan, 2014. 229 pp....

  13. Accurate measurement of the first excited nuclear state in 235U

    Science.gov (United States)

    Ponce, F.; Swanberg, E.; Burke, J.; Henderson, R.; Friedrich, S.

    2018-05-01

    We have used superconducting high-resolution radiation detectors to measure the energy level of metastable Um235 as 76.737 ± 0.018 eV. The Um235 isomer is created from the α decay of 239Pu and embedded directly into the detector. When the Um235 subsequently decays, the energy is fully contained within the detector and is independent of the decay mode or the chemical state of the uranium. The detector is calibrated using an energy comb from a pulsed UV laser. A comparable measurement of the metastable Thm229 nucleus would enable a laser search for the exact transition energy in 229Th-Thm229 as a step towards developing the first ever nuclear (baryonic) clock.

  14. Dicty_cDB: SLC470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC470 (Link to dictyBase) - - - Contig-U15735-1 SLC470Z (Link... to Original site) - - SLC470Z 386 - - - - Show SLC470 Library SL (Link to library) Clone ID SLC470 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC470Q.Seq.d/ Representative seq. ID SLC47...0Z (Link to Original site) Representative DNA sequence >SLC470 (SLC470Q) /CSM/SL/SLC4-C/SLC470Q.Seq.d/ XXXXX...Seq.d/ 533 e-151 SLF229 (SLF229Q) /CSM/SL/SLF2-B/SLF229Q.Seq.d/ 533 e-151 SLC470 (SLC470Q) /CSM/SL/SLC4-C/SLC4

  15. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    International Nuclear Information System (INIS)

    Shiotsuki, Masao; Miyahara, Kaname

    2003-01-01

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  16. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  17. Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

    International Nuclear Information System (INIS)

    Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.

    2011-01-01

    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)

  18. Soil nuclide distribution coefficients and their statistical distributions

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

    1984-12-01

    Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

  19. CXCR7 is induced by hypoxia and mediates glioma cell migration towards SDF-1α

    International Nuclear Information System (INIS)

    Esencay, Mine; Sarfraz, Yasmeen; Zagzag, David

    2013-01-01

    Glioblastomas, the most common and malignant brain tumors of the central nervous system, exhibit high invasive capacity, which hinders effective therapy. Therefore, intense efforts aimed at improved therapeutics are ongoing to delineate the molecular mechanisms governing glioma cell migration and invasion. In order to perform the studies, we employed optimal cell culture methods and hypoxic conditions, lentivirus-mediated knockdown of protein expression, Western Blot analysis, migration assays and immunoprecipitation. We determined statistical significance by unpaired t-test. In this report, we show that U87MG, LN229 and LN308 glioma cells express CXCR7 and that exposure to hypoxia upregulates CXCR7 protein expression in these cell lines. CXCR7-expressing U87MG, LN229 and LN308 glioma cells migrated towards stromal-derived factor (SDF)-1α/CXCL12 in hypoxic conditions in the Boyden chamber assays. While shRNA-mediated knockdown of CXCR7 expression did not affect the migration of any of the three cell lines in normoxic conditions, we observed a reduction in the migration of LN229 and LN308, but not U87MG, glioma cells towards SDF-1α in hypoxic conditions. In addition, knockdown of CXCR7 expression in LN229 and LN308 glioma cells decreased levels of SDF-1α-induced phosphorylation of ERK1/2 and Akt. Inhibiting CXCR4 in LN229 and LN308 glioma cells that were knocked down for CXCR7 did not further reduce migration towards SDF-1α in hypoxic conditions and did not affect the levels of phosphorylated ERK1/2 and Akt. Analysis of immunoprecipitated CXCR4 from LN229 and LN308 glioma cells revealed co-precipitated CXCR7. Taken together, our findings indicate that both CXCR4 and CXCR7 mediate glioma cell migration towards SDF-1α in hypoxic conditions and support the development of therapeutic agents targeting these receptors

  20. Activity of Metabotropic Glutamate Receptor 4 Suppresses Proliferation and Promotes Apoptosis With Inhibition of Gli-1 in Human Glioblastoma Cells

    Directory of Open Access Journals (Sweden)

    Zhichao Zhang

    2018-05-01

    Full Text Available Glioblastoma multiforme (GBM is the most lethal glioma variant in the adult brain and among the deadliest of human cancers. Increasing evidence has shown that metabotropic glutamate receptor subtype 4 (mGluR4 expression may play roles in regulating the growth of neural stem cells as well as several cancer cell lines. Here, we investigated the effects of mGluR4 on the growth and apoptosis of the LN229 GBM cell line. Involvement of Gli-1, one of the key transcription factors in the sonic Hedgehog (SHH signaling pathway, was further explored. In this study, mGluR4 was activated using selective agonist VU0155041; and gene-targeted siRNAs were used to generate loss of function of mGluR4 and Gli-1 in LN229 cells. The results demonstrated that LN229 cells expressed mGluR4 and the agonist VU0155041 decreased cell viability in a dose- and time-dependent manner. Activation of mGluR4 inhibited cyclin D1 expression, activated pro-caspase-8/9/3, and disrupted the balance of Bcl-2/Bax expression, which indicated cell cycle arrest and apoptosis of LN229 cells, respectively. Furthermore, Gli-1 expression was reduced by mGluR4 activation in LN229 cells, and downregulation of Gli-1 expression by gene-targeted siRNA resulted in both inhibition of cell proliferation and promotion of apoptosis. Moreover, VU0155041 treatment substantially blocked SHH-induced cyclin D1 expression and cell proliferation, while increasing TUNEL-positive cells and the activation of apoptosis-related proteins. We concluded that activation of mGluR4 expressed in LN229 cells could inhibit GBM cell growth by decreasing cell proliferation and promoting apoptosis. Further suppression of intracellular Gli-1 expression might be involved in the action of mGluR4 on cancer cells. Our study suggested a novel role of mGluR4, which might serve as a potential drug target for control of GBM cell growth.

  1. Clinical value of NPHS2 analysis in early- and adult-onset steroid-resistant nephrotic syndrome.

    Science.gov (United States)

    Santín, Sheila; Tazón-Vega, Bárbara; Silva, Irene; Cobo, María Ángeles; Giménez, Isabel; Ruíz, Patricia; García-Maset, Rafael; Ballarín, José; Torra, Roser; Ars, Elisabet

    2011-02-01

    To date, very few cases with adult-onset focal segmental glomerulosclerosis (FSGS) carrying NPHS2 variants have been described, all of them being compound heterozygous for the p.R229Q variant and one pathogenic mutation. Mutation analysis was performed in 148 unrelated Spanish patients, of whom 50 presented with FSGS after 18 years of age. Pathogenicity of amino acid substitutions was evaluated through an in silico scoring system. Haplotype analysis was carried out using NPHS2 single nucleotide polymorphism and microsatellite markers. Compound heterozygous or homozygous NPHS2 pathogenic mutations were identified in seven childhood-onset steroid-resistant nephrotic syndrome (SRNS) cases. Six additional cases with late childhood- and adult-onset SRNS were compound heterozygotes for p.R229Q and one pathogenic mutation, mostly p.A284V. p.R229Q was more frequent among SRNS cases relative to controls (odds ratio=2.65; P=0.02). Significantly higher age at onset of the disease and slower progression to ESRD were found in patients with one pathogenic mutation plus the p.R229Q variant in respect to patients with two NPHS2 pathogenic mutations. NPHS2 analysis has a clinical value in both childhood- and adult-onset SRNS patients. For adult-onset patients, the first step should be screening for p.R229Q and, if positive, for p.A284V. These alleles are present in conserved haplotypes, suggesting a common origin for these substitutions. Patients carrying this specific NPHS2 allele combination did not respond to corticoids or immunosuppressors and showed FSGS, average 8-year progression to ESRD, and low risk for recurrence of FSGS after kidney transplant.

  2. MEASUREMENT OF THE MASS AND STELLAR POPULATION DISTRIBUTION IN M82 WITH THE LBT

    Energy Technology Data Exchange (ETDEWEB)

    Greco, Johnny P.; Martini, Paul; Thompson, Todd A., E-mail: greco.40@buckeyemail.osu.edu [Department of Astronomy, Ohio State University, Columbus, OH 43210 (United States)

    2012-09-20

    We present a K-band spectroscopic study of the stellar and gas kinematics, mass distribution, and stellar populations of the archetypical starburst galaxy M82. Our results are based on a single spectrum at a position angle of 67.{sup 0}5 through the K-band nucleus. We used the {sup 12}CO stellar absorption band head at 2.29 {mu}m (CO{sub 2.29}) to measure the rotation curve out to nearly 4 kpc radius on both the eastern and western sides of the galaxy. Our data show that the rotation curve is flat from 1 to 4 kpc. This stands in sharp contrast to some previous studies, which have interpreted H I and CO emission-line position-velocity diagrams as evidence for a declining rotation curve. The kinematics of the Br{gamma}, H{sub 2}, and He I emission lines are consistent with, although characterized by slightly higher velocities than, the stellar kinematics. We derived M82's mass distribution from our stellar kinematic measurements and estimate that its total dynamical mass is {approx}10{sup 10} M{sub Sun }. We measured the equivalent width of CO{sub 2.29} (W{sub 2.29}) as a function of distance from the center of the galaxy to investigate the spatial extent of the red supergiant (RSG) population. The variation in W{sub 2.29} with radius clearly shows that RSGs dominate the light inside 500 pc radius. M82's superwind is likely launched from this region, where we estimate that the enclosed mass is {approx}<2 Multiplication-Sign 10{sup 9} M{sub Sun }.

  3. Area Handbook Series: East Germany: A Country Study

    Science.gov (United States)

    1987-07-01

    popularity, supported the NSDAP with funds. Meanwhile, Briining’s successor, Franz von Papen , a strong authoritarian who wished to establish a corporate...Study Papen , Franz von , 33 training, 227; Transport Police, xxiv, Parow, 229 xxv, 226, 229, 273; Water Police, 260 Pavlovskii, I.G., 350 Polish Corridor...Constitution). Franz von l’apen, chancellor May-December I132; Hitle’s National Socialists won 2:30 Reichstag seats in July 1932 elettioins and ctiecrged

  4. 36 CFR 223.229 - Contents of prospectus.

    Science.gov (United States)

    2010-07-01

    ... acreage; (e) The estimated volumes, quality, size, or other appropriate measure for the special forest... type of contract, permit, or other authorizing instrument to be used for the sale; (i) The termination date and normal operating season, if any, of the contract, permit, or other authorizing instrument; (j...

  5. Gender | Page 229 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    . ... Building Businesses with Small Producers présente les constatations et une analyse ... Researchers identified the regions in Southeast Asia most vulnerable to ... asked why some children in developing countries are not being vaccinated.

  6. 49 CFR 229.31 - Main reservoir tests.

    Science.gov (United States)

    2010-10-01

    ... appropriately safe environment. (d) Each aluminum main reservoir before being placed in use and at intervals... working pressure fixed by the chief mechanical officer. The test date, place, and pressure shall be... be subjected to a hydrostatic pressure of at least 25 percent more than the maximum working pressure...

  7. Gender | Page 229 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The human element still dominates." Don't talk of computers or other information and communication technologies (ICTs) ... ainsi que les changements provoqués par l'introduction des TIC au sein de diverses communautés d'Afrique.

  8. 4 CFR 22.9 - Subpoenas [Rule 9].

    Science.gov (United States)

    2010-01-01

    ... information (including writings, papers, books, accounts, photographs, drawings, graphs, charts, recordings... and the mileage allowed by 28 U.S.C. 1821 or other applicable law; however, where the subpoena is...

  9. 17 CFR 229.901 - (Item 901) Definitions.

    Science.gov (United States)

    2010-04-01

    ... of the entity, management compensation or investment objectives; or (viii) A transaction in which all... after an initial period of time following commencement of operations). (ii) A real estate investment... Investment Company Act of 1940 (15 U.S.C. 80a-1 et seq.) or any Business Development Company as defined in...

  10. 22 CFR 229.140 - Dissemination of policy.

    Science.gov (United States)

    2010-04-01

    ... secondary school students, employees, sources of referral of applicants for admission and employment, and... later, which notification shall include publication in: (i) Newspapers and magazines operated by such...

  11. 17 CFR 229.1100 - (Item 1100) General.

    Science.gov (United States)

    2010-04-01

    ... matters and any pertinent tax matters, exchange controls, currency restrictions or other economic, fiscal... INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY POLICY... registration statement or prospectus. 4. If neither the third party nor any of its affiliates has had a direct...

  12. 32 CFR 229.8 - Issuance of permits.

    Science.gov (United States)

    2010-07-01

    ..., education, and/or experience, and possesses demonstrable competence in archaeological theory and methods..., administration, or management, including at least 4 months experience and/or specialized training in the kind of... knowledge in the public interest, which may include but need not be limited to, scientific or scholarly...

  13. 17 CFR 229.10 - (Item 10) General.

    Science.gov (United States)

    2010-04-01

    ... classification system; and a statement informing investors that a security rating is not a recommendation to buy... face of any pro forma financial information required to be disclosed by Article 11 of Regulation S-X... rules, or a system of regulation of a government or governmental authority or self-regulatory...

  14. 12 CFR 229.53 - Substitute check indemnity.

    Science.gov (United States)

    2010-01-01

    ... expenses of representation) related to the substitute check. (2) Comparative negligence. (i) If a loss... negligence or failure to act in good faith, then the indemnity amount described in paragraph (b)(1) of this section shall be reduced in proportion to the amount of negligence or bad faith attributable to the...

  15. 49 CFR 229.137 - Sanitation, general requirements.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Cabs and... for duty or occupying the cab for duty; and (6) Equipped with a trash receptacle, unless the railroad otherwise provides portable trash receptacles to employees upon reporting for duty or occupying the cab for...

  16. 17 CFR 229.1108 - (Item 1108) Servicers.

    Science.gov (United States)

    2010-04-01

    ..., provide statistical information regarding servicer advances on the pool assets and the servicer's overall... handling delinquencies, losses, bankruptcies and recoveries, such as through liquidation of the underlying...

  17. 17 CFR 229.1101 - (Item 1101) Definitions.

    Science.gov (United States)

    2010-04-01

    ... maturity, delinquency and loss information and geographic distribution) and other factual information... or the asset pool itself; (5) Statistical information displaying for a particular class of asset... characteristics, total rate of return, option adjusted spread or other financial or statistical information...

  18. 17 CFR 229.601 - (Item 601) Exhibits.

    Science.gov (United States)

    2010-04-01

    ... accountant regarding non-reliance on a previously issued audit report or completed interim review X (8) Opinion re tax matters X X X X X X X (9) Voting trust agreement X X X X X X X (10) Material contracts X X... X X X X X X (16) Letter re change in certifying accountant 4 X X X X X X (17) Correspondence on...

  19. 50 CFR 229.11 - Confidential fisheries data.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS AUTHORIZATION FOR COMMERCIAL FISHERIES UNDER THE MARINE... identity or business of any person; (3) When required by court order; or (4) In the case of scientific...

  20. 229-IJBCS-Article-Dr D L GONE

    African Journals Online (AJOL)

    RHUMSIKI

    les phénomènes d'absorption des métaux lourds et limiter leur migration vers les nappes d'eau souterraine. Le biogaz émanant de la décharge est composé essentiellement de CH4 (70%) et de CO2 (29%). Le rapport. CH4/CO2 est élevé, supérieur à 2, ce qui traduit l'anoxicité du milieu et sa grande capacité à produire le.

  1. 7 CFR 1220.229 - Influencing governmental action.

    Science.gov (United States)

    2010-01-01

    ... government, or any political subdivision thereof. (b) The prohibition in paragraph (a) of this section shall... communication to appropriate government officials of information relating to the conduct, implementation, or... political subdivision thereof. ...

  2. Taxonomic Evaluation of Cleveland Harbor Lake Areas

    Science.gov (United States)

    2014-01-01

    collected using a standard (8.2-L) stainless steel ponar grab (229 x 229 mm) in basic accordance with USEPA (2001). The grab sampler was dropped from...through stacked 1.0- and 0.5-mm stainless steel sieves to separate coarse and fine material. Sample material retained in both sieves was thoroughly... 416 . Berry, E. 1943. The Amnicolidae of Michigan: Distribution, ecology, and taxonomy. Misc. Publ. Mus. Zool. U. Mich. 57:1-68. Dillon, R. T., Jr

  3. Effect of electrostatic interactions on phase stability of cubic phases of biomembranes.

    Science.gov (United States)

    Li, Shu Jie; Masum, Shah Md; Yamashita, Yuko; Tamba, Yukihiro; Yamazaki, Masahito

    2002-06-01

    We investigated effect of electrostatic interactions due to surfacecharges on structures and stability of cubic phases of monoolein (MO)membrane using the small-angle X-ray scattering method. Firstly, wechanged the surface charge density of the membrane by usingdioleoylphosphatidic acid (DOPA). As increasing DOPA concentration in themembrane at 30 wt % lipid concentration, a Q(224) to Q(229) phasetransition occurred at 0.6 mol % DOPA, and at and above 25 mol %, DOPA/MOmembranes were in the L(α) phase. NaCl in the bulk phase reduced theeffect of DOPA. These results indicate that as the electrostaticinteractions increase, the most stable phase changes as follows: Q(224)⇒ Q(229) ⇒ L(α). The increase in DOPAconcentration reduced the absolute value of spontaneous curvature of themembrane, | H(0) |. Secondly, we changed the surface charge of themembrane by adding a de novo designed peptide, which has netpositive charges and a binding site on the electrically neutral membraneinterface. The peptide-1 (WLFLLKKK) induced a Q(224) to Q(229)phase transition in the MO membrane at low peptide concentration. As NaClconcentration increases, the MO/peptide-1 membrane changed from Q(229)to Q(224) phase. The increase in peptide-1 concentration reduced |H(0) |. Based on these results, the stability of the cubic phases and themechanism of phase transition between cubic phase and L(α) phase arediscussed.

  4. Establishment of CMab-43, a Sensitive and Specific Anti-CD133 Monoclonal Antibody, for Immunohistochemistry.

    Science.gov (United States)

    Itai, Shunsuke; Fujii, Yuki; Nakamura, Takuro; Chang, Yao-Wen; Yanaka, Miyuki; Saidoh, Noriko; Handa, Saori; Suzuki, Hiroyoshi; Harada, Hiroyuki; Yamada, Shinji; Kaneko, Mika K; Kato, Yukinari

    2017-10-01

    CD133, also known as prominin-1, was first described as a cell surface marker on early progenitor and hematopoietic stem cells. It is a five-domain transmembrane protein composed of an N-terminal extracellular tail, two small cytoplasmic loops, two large extracellular loops containing seven potential glycosylation sites, and a short C-terminal intracellular tail. CD133 has been used as a marker to identify cancer stem cells derived from primary solid tumors and as a prognostic marker of gliomas. Herein, we developed novel anti-CD133 monoclonal antibodies (mAbs) and characterized their efficacy in flow cytometry, Western blot, and immunohistochemical analyses. We expressed the full length of CD133 in LN229 glioblastoma cells, immunized mice with LN229/CD133 cells, and performed the first screening using flow cytometry. After limiting dilution, we established 100 anti-CD133 mAbs, reacting with LN229/CD133 cells but not with LN229 cells. Subsequently, we performed the second and third screening with Western blot and immunohistochemical analyses, respectively. Among 100 mAbs, 11 strongly reacted with CD133 in Western blot analysis. One of 11 clones, CMab-43 (IgG 2a , kappa), showed a sensitive and specific reaction against colon cancer cells, warranting the use of CMab-43 in detecting CD133 in pathological analyses of CD133-expressing cancers.

  5. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

    2013-01-01

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  6. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

    2011-03-15

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

  7. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    International Nuclear Information System (INIS)

    Kulagin, N.A.

    2011-01-01

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.

  8. Review of radionuclide source terms used for performance-assessment analyses

    International Nuclear Information System (INIS)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

  9. Chemical separation of Th-230 from uranium ore

    International Nuclear Information System (INIS)

    Kikunaga, H.; Nakanishi, T.; Mitsugashira, T.; Hara, M.

    2001-01-01

    We are studying the decay processes of low energy nuclear isomer of Th-229. Our approach to produce Th-229m is (γ, n) reaction on Th-230, hence, about 100 μg of Th-230 is necessary as a target. However, our stock of Th-230 has run out during several experiments, thus, we tried to separate Th-230 from uranium ore. In this paper, the detail of a chemical separation procedure for Th-230 from uranium ore and the results are reported. (author)

  10. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  11. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  12. Success and Failure Rates of 1,344 6- to 9-mm-Length Rough-Surface Implants Placed at the Time of Transalveolar Sinus Elevations, Restored with Single Crowns, and Followed for 60 to 229 Months in Function.

    Science.gov (United States)

    Fugazzotto, Paul A

    To assess the success and stability of 6-, 7-, 8-, and 9-mm-long, 6.5-mm-wide-neck tissue-level implants placed at the time of transalveolar sinus augmentation therapy, utilizing a trephine and osteotome approach, which were restored with single crowns. In total, 1,344 implants were placed by the author, varying in length from 6 to 9 mm, with parallel-wall 4.8-mm-diameter implant bodies and 6.5-mm-diameter implant necks. The implants were restored with single abutments and crowns by a variety of practitioners. They were followed for 60 to 229 months in function, with a mean time of 121.1 months in function. Implant success was evaluated by the author utilizing a combination of the Albrektsson et al criteria, and buccal and palatal/lingual bone sounding under anesthesia. The overall cumulative success rate was 98.8%. One hundred ninety 6-mm-long implants demonstrated a cumulative success rate of 97.5% at a mean time of 109.2 months in function. Eleven 7-mm-long implants demonstrated a cumulative success rate of 100% at a mean time of 218.5 months in function. One thousand ninety-four 8-mm-long implants demonstrated a cumulative success rate of 98.9% at a mean time of 112.3 months in function. Forty-nine 9-mm-long implants demonstrated a cumulative success rate of 100% at a mean time of 212.1 months in function. Implants of 6 to 9 mm in length, placed at the time of trephine and osteotome transalveolar sinus elevation procedures and restored with abutments and single crowns, demonstrate a high level of long-term clinical success, assuming specific comprehensive treatment criteria are met.

  13. The Mattassee Lake Sites: Archeological Investigations Along the Lower Santee River in the Coastal Plain of South Carolina.

    Science.gov (United States)

    1982-12-01

    shell base recovered the majority of the vessel fragments associ- from the site is marked with the legend ated with 38BK229 consisted of compara- " PETERS ...LEAGUE" identifying it as a pro- tively recent glass beverage bottle sherds. duct of the Peters Cartridge Company of Since the west end of this site...Cf Zr2i’e ce &"le-r jitiral 4fffliation 7,pe Cate Drlior, 2 rovenience nit Ana, . zec SUE 388E229 - t reate Arcnaic :,It Pottery 5E-S 3C C

  14. Formation of cubic phases from large unilamellar vesicles of dioleoylphosphatidylglycerol/monoolein membranes induced by low concentrations of Ca2+.

    Science.gov (United States)

    Awad, Tarek S; Okamoto, Yoshihide; Masum, Shah Md; Yamazaki, Masahito

    2005-12-06

    We developed a new method for the transformation of large unilamellar vesicles (LUVs) into the cubic phase. We found that the addition of low concentrations of Ca(2+) to suspensions of multilamellar vesicles (MLVs) of membranes of monoolein (MO) and dioleoylphosphatidylglycerol (DOPG) mixtures (DOPG/MO) changed their L(alpha) phase to the cubic phases. For instance, the addition of 15-25 mM Ca(2+) to 30%-DOPG/70%-MO-MLVs induced the Q(229) phase, whereas the addition of > or =28 mM Ca(2+) induced the Q(224) phase. LUVs of DOPG/MO membranes containing > or =25 mol % DOPG were prepared easily. Low concentrations of Ca(2+) transformed these LUVs in excess buffer into the Q(224) or the Q(229) phase, depending on the Ca(2+) concentration. For example, 15 and 50 mM Ca(2+) induced the Q(224) and Q(229) phase in the 30%-DOPG/70%-MO-LUVs at 25 degrees C, respectively. This finding is the first demonstration of transformation of LUVs of lipid membranes into the cubic phase under excess water condition.

  15. Laser spectroscopy of francium isotopes at the borders of the region of reflection asymmetry

    CERN Document Server

    Budinčević, I; Bissell, M L; Cocolios, T E; de Groote, R P; De Schepper, S; Fedosseev, V N; Flanagan, K T; Franchoo, S; Garcia Ruiz, R F; Heylen, H; Lynch, K M; Marsh, B A; Neyens, G; Procter, T J; Rossel, R E; Rothe, S; Strashnov, I; Stroke, H H; Wendt, K D A

    2014-01-01

    The magnetic dipole moments and changes in mean-square charge radii of the neutron-rich $^{218m,219,229,231}\\text{Fr}$ isotopes were measured with the newly-installed Collinear Resonance Ionization Spectroscopy (CRIS) beam line at ISOLDE, CERN, probing the $7s~^{2}S_{1/2}$ to $8p~^{2}P_{3/2}$ atomic transition. The $\\delta\\langle r^{2}\\rangle^{A,221}$ values for $^{218m,219}\\text{Fr}$ and $^{229,231}\\text{Fr}$ follow the observed increasing slope of the charge radii beyond $N~=~126$. The charge radii odd-even staggering in this neutron-rich region is discussed, showing that $^{220}\\text{Fr}$ has a weakly inverted odd-even staggering while $^{228}\\text{Fr}$ has normal staggering. This suggests that both isotopes reside at the borders of a region of inverted staggering, which has been associated with reflection-asymmetric shapes. The $g(^{219}\\text{Fr}) = +0.69(1)$ value supports a $\\pi 1h_{9/2}$ shell model configuration for the ground state. The $g(^{229,231}\\text{Fr})$ values support the tentative $I^{\\pi}(^...

  16. 40 CFR 229.2 - Transport of target vessels.

    Science.gov (United States)

    2010-07-01

    ... marine navigation is not otherwise impaired by the sunk vessel; (3) All such vessel sinkings shall be... may degrade the marine environment, -including without limitation (i) emptying of all fuel tanks and... free of petroleum, and (ii) removing from the hulls other pollutants and all readily detachable...

  17. 22 CFR 229.125 - Effect of other requirements.

    Science.gov (United States)

    2010-04-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264; sections 704 and 855 of the Public Health Service Act (42 U.S.C. 295m, 298b-2); Title VII of the Civil Rights Act of 1964 (42 U.S.C. 2000e et seq.); the Equal Pay Act of 1963 (29 U.S.C. 206); and any other Act of Congress or Federal regulation. (b) Effect of State or...

  18. 17 CFR 229.1010 - (Item 1010) Financial statements.

    Science.gov (United States)

    2010-04-01

    ....1010 (Item 1010) Financial statements. (a) Financial information. Furnish the following financial information: (1) Audited financial statements for the two fiscal years required to be filed with the company's... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1010) Financial...

  19. 12 CFR Appendix E to Part 229 - Commentary

    Science.gov (United States)

    2010-01-01

    ... industry, to define terms that are not defined in the EFA Act, and to carry out the purposes of the EFA Act... States Postal Service to the extent that they act as paying banks because the Check 21 Act includes these..., Sundays, and legal holidays. Legal holiday, however, is not defined, and the variety of local holidays...

  20. 17 CFR 229.905 - (Item 905) comparative information.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 905) comparative...) comparative information. (a)(1) Describe the voting and other rights of investors in the successor under the successor's governing instruments and under applicable law. Compare such rights to the voting and other...

  1. 17 CFR 229.1207 - (Item 1207) Delivery commitments.

    Science.gov (United States)

    2010-04-01

    ... information required by this Item: (1) In a form understandable to investors; and (2) Based upon the facts and... subject to priorities or curtailments which may affect quantities delivered to certain classes of... factors beyond the registrant's control that may affect the registrant's ability to meet its contractual...

  2. 22 CFR 229.415 - Access to course offerings.

    Science.gov (United States)

    2010-04-01

    ..., and adult education courses. (b)(1) With respect to classes and activities in physical education at..., that deal exclusively with human sexuality may be conducted in separate sessions for boys and girls. (6... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex...

  3. 49 CFR 229.25 - Tests: Every periodic inspection.

    Science.gov (United States)

    2010-10-01

    ... mechanical gauges used by the engineer to aid in the control or braking of the train or locomotive, except... follows: (1) All automatic controls, alarms and protective devices shall be inspected and tested. (2...

  4. 17 CFR 229.402 - (Item 402) Executive compensation.

    Science.gov (United States)

    2010-04-01

    ... which its securities are listed or traded. (2) All compensation covered. This Item requires clear... different currency, a footnote must be provided to identify that currency and describe the rate and...

  5. 17 CFR 229.1111 - (Item 1111) Pool assets.

    Science.gov (United States)

    2010-04-01

    ... information for the asset pool, including statistical information regarding delinquencies and losses. (d.... Present statistical information in tabular or graphical format, if such presentation will aid understanding. Present statistical information in appropriate distributional groups or incremental ranges in...

  6. 17 CFR 229.1107 - (Item 1107) Issuing entities.

    Science.gov (United States)

    2010-04-01

    ... issue or invest in additional securities, to borrow money or to make loans to other persons. Describe... this information graphically or in a flow chart if it will aid understanding. (i) If the pool assets are securities, as defined under the Securities Act, state the market price of the securities and the...

  7. 17 CFR 229.407 - (Item 407) Corporate governance.

    Science.gov (United States)

    2010-04-01

    ...-CSR (§§ 249.331 and 274.128 of this chapter)), unless the party relying on such report knows or has... expert for any purpose, including without limitation for purposes of section 11 of the Securities Act (15...

  8. Directed modification of L-LcLDH1, an L-lactate dehydrogenase from Lactobacillus casei, to improve its specific activity and catalytic efficiency towards phenylpyruvic acid.

    Science.gov (United States)

    Li, Jian-Fang; Li, Xue-Qing; Liu, Yan; Yuan, Feng-Jiao; Zhang, Ting; Wu, Min-Chen; Zhang, Ji-Ru

    2018-05-22

    To improve the specific activity and catalytic efficiency of L-LcLDH1, an NADH-dependent allosteric L-lactate dehydrogenase from L. casei, towards phenylpyruvic acid (PPA), its directed modification was conducted based on the semi-rational design. The three variant genes, Lcldh1 Q88R , Lcldh1 I229A and Lcldh1 T235G , were constructed by whole-plasmid PCR as designed theoretically, and expressed in E. coli BL21(DE3), respectively. The purified mutant, L-LcLDH1 Q88R or L-LcLDH1 I229A , displayed the specific activity of 451.5 or 512.4 U/mg towards PPA, by which the asymmetric reduction of PPA afforded L-phenyllactic acid (PLA) with an enantiomeric excess (ee p ) more than 99%. Their catalytic efficiencies (k cat /K m ) without D-fructose-1,6-diphosphate (D-FDP) were 4.8- and 5.2-fold that of L-LcLDH1. Additionally, the k cat /K m values of L-LcLDH1 Q88R and L-LcLDH1 I229A with D-FDP were 168.4- and 8.5-fold higher than those of the same enzymes without D-FDP, respectively. The analysis of catalytic mechanisms by molecular docking (MD) simulation indicated that substituting I229 in L-LcLDH1 with Ala enlarges the space of substrate-binding pocket, and that the replacement of Q88 with Arg makes the inlet of pocket larger than that of L-LcLDH1. Copyright © 2018 Elsevier B.V. All rights reserved.

  9. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available HFLRPGTPGPA Sbjct: 1 ... PVGEHVYALELTDRWNTPAGTANGGYLFAVCLQALAREVPQPDLLSASGHFLRPGTPGPA 60 ... Query: 170 DPHEGRDRG...DGIGARVEYRMPELPGFFRGTPGGATTWEFWMRFADGREXXXXXXXXXXXX 229 ... DPHEGRDRGDGIGARVEYRMPELPGFFRGTPGGATTWEFWM...RFADGRE ... Sbjct: 121 DPHEGRDRGDGIGARVEYRMPELPGFFRGTPGGATTWEFWMRFADGREAD

  10. Go/NoGo performance in boys with Tourette syndrome

    DEFF Research Database (Denmark)

    Eichele, Heike; Eichele, Tom; Hammar, Asa

    2010-01-01

    This study compared performance and performance monitoring in 19 boys with Tourette syndrome (TS) (12.64 years, +/- 2.05) and 19 age-matched controls (13.16 years, +/- 2.29) using a Go/NoGo task. The results indicated similar performance accuracy in the TS group and the control group. TS particip......This study compared performance and performance monitoring in 19 boys with Tourette syndrome (TS) (12.64 years, +/- 2.05) and 19 age-matched controls (13.16 years, +/- 2.29) using a Go/NoGo task. The results indicated similar performance accuracy in the TS group and the control group. TS...

  11. The electrodeposition of thorium in natural materials for alpha spectrometry

    International Nuclear Information System (INIS)

    Roman, D.

    1980-01-01

    A technique has been developed for the electrodeposition of thorium on stainless steel planchettes following standard radiochemical separation and uptake in acetate buffer. The method has been used on over 130 samples including calcrete, clay, granite and shell matrices. To assess the efficiency at ultra low levels, three solutions of carrier free 228 Th ( -7 μg in 5 ml electrolyte) and four solutions of 229 Th (4.4x10 -4 μg in 5 ml) were studied. The efficiencies of the former averaged 66 per cent; those of the 229 Th varied from 41 to 91%. (author)

  12. [Investigation on standard application of industrial dust hazard classification].

    Science.gov (United States)

    Lu, Y; Zhang, M; Chen, W H

    2017-04-20

    Objective: To investigate the application and effectiveness evaluation of the standard of GBZ/T 229.1-2010 in practice, and to explore the applicability, aiming to provide technical evidence for the revision of GBZ/T 229.1-2010. Methods: There were 2 questionnaire surveys carried out in the study, including general survey and specific survey. Databases were established and data were input with Excel 2010 and Epidata version 3.1 software. SPSS version 19.0 software was used for data cleaning and statistical analysis. Results: The general survey received 100 questionnaires, with 43 from facilities and 57 from professional expertise. There were 59 questionnaires from occupational health technical service organizations held by government, and 11 from colleges and universities. The leading three jobs using GBZ/T 229.1-2010 were the occupational hazards evaluation for constructive project (69.0%) , lecturing/training (55.0%) , occupational hazards monitoring (50.0%) , respectively. The high frequency used contents of GBZ/T 229.1-2010 were the fourth part "classification" (67.0%) , the fifth part "the principles of classification management" (59.0%) , annex A "the correct use instructions" (52.0%) , respectively. In the results of feasibility, scores of the fourth part "classification" , the fifth part "the principles of classification management" , annex A "the correct use instructions" were 3.07, 3.03, 3.23, respectively. The parts needed to be modified as priories were the fourth part "classification" (22.0%) , the fifth part "the principles of classification management" (13.0%) , annex A "the correct use instructions" (12.0%) . The specific survey received 15 questionnaires, with 12 from the employers and 3 from occupational health technical service organizations. The awareness rate of GBZ/T 229.1-2010 among occupational health professionals was 83.3%. Classification results in the employers were used for guidance on improvement measures (66.7%) , health surveillance

  13. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Bacillus clausii KSM-K16] ... Length = 104 ... Query: 170 EQIALLPLIGEIDTHRAKVIFDQTLEQCVNTRVDS...LLIDLSGVPVIDTMVANQIFSLIDG 229 ... EQIALLPLIGEIDTHRAKVIFDQTLEQCVNTRVDSLLIDL...SGVPVIDTMVANQIFSLIDG Sbjct: 1 ... EQIALLPLIGEIDTHRAKVIFDQTLEQCVNTRVDSLLIDLSGVPVIDTMVANQIFSLIDG 60 ...

  14. Opposing effects of PI3K/Akt and Smad-dependent signaling pathways in NAG-1-induced glioblastoma cell apoptosis.

    Directory of Open Access Journals (Sweden)

    Zhiguo Zhang

    Full Text Available Nonsteroidal anti-inflammatory drug (NSAID activated gene-1 (NAG-1 is a divergent member of the transforming growth factor-beta (TGF-β superfamily. NAG-1 plays remarkable multifunctional roles in controlling diverse physiological and pathological processes including cancer. Like other TGF-β family members, NAG-1 can play dual roles during cancer development and progression by negatively or positively modulating cancer cell behaviors. In glioblastoma brain tumors, NAG-1 appears to act as a tumor suppressor gene; however, the precise underlying mechanisms have not been well elucidated. In the present study, we discovered that overexpression of NAG-1 induced apoptosis in U87 MG, U118 MG, U251 MG, and T98G cell lines via the intrinsic mitochondrial pathway, but not in A172 and LN-229 cell lines. NAG-1 could induce the phosphorylation of PI3K/Akt and Smad2/3 in all six tested glioblastoma cell lines, except Smad3 phosphorylation in A172 and LN-229 cell lines. In fact, Smad3 expression and its phosphorylation were almost undetectable in A172 and LN-229 cells. The PI3K inhibitors promoted NAG-1-induced glioblastoma cell apoptosis, while siRNAs to Smad2 and Smad3 decreased the apoptosis rate. NAG-1 also stimulated the direct interaction between Akt and Smad3 in glioblastoma cells. Elevating the level of Smad3 restored the sensitivity to NAG-1-induced apoptosis in A172 and LN-229 cells. In conclusion, our results suggest that PI3K/Akt and Smad-dependent signaling pathways display opposing effects in NAG-1-induced glioblastoma cell apoptosis.

  15. Development of a single-phase 30 m HTS power cable

    Science.gov (United States)

    Cho, Jeonwook; Bae, Joon-Han; Kim, Hae-Jong; Sim, Ki-Deok; Kim, Seokho; Jang, Hyun-Man; Lee, Chang-Young; Kim, Dong-Wook

    2006-05-01

    HTS power transmission cables appear to be the replacement and retrofitting of underground cables in urban areas and HTS power transmission cable offers a number of technical and economic merits compared to the normal conductor cable system. A 30 m long, single-phase 22.9 kV class HTS power transmission cable system has been developed by Korea Electrotechnology Research Institute (KERI), LS Cable Ltd., and Korea Institute of Machinery and Materials (KIMM), which is one of the 21st century frontier project in Korea since 2001. The HTS power cable has been developed, cooled down and tested to obtain realistic thermal and electrical data on HTS power cable system. The evaluation results clarified such good performance of HTS cable that DC critical current of the HTS cable was 3.6 kA and AC loss was 0.98 W/m at 1260 Arms and shield current was 1000 Arms. These results proved the basic properties for 22.9 kV HTS power cable. As a next step, we have been developing a 30 m, three-phase 22.9 kV, 50 MV A HTS power cable system and long term evaluation is in progress now.

  16. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available A ... +G ... Sbjct: 1 ... PTVGIVIPARNEAAVIGTSVRSLLEQDYAGPLHLIVVDDHSEDGTGDIARQTAVDLGQGD 60 ... Query: 170 GFDVVSQMARLR...VESVWERLVVPAFVYFFAQLYPFRWIXXXXXXXXXXXXXXXXXXXXXC 229 ... +VS M +LR +SVWE+L++PAFV+FFA+LYPFRW+ ...

  17. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available p. PCC 7120] ... Length = 229 ... Query: 32 ... VLVIGGAEDKVHGREILRTFFGRAGASKAYITIIPSASREPAIIGGRYIRIFEEMGAEK...V 91 ... VLVIGGAEDKVHGREILRTFFGRAGASKAYITIIPSASREPAIIGGRYIRIFEEMGAEKV Sbjc...t: 1 ... VLVIGGAEDKVHGREILRTFFGRAGASKAYITIIPSASREPAIIGGRYIRIFEEMGAEKV 60 ... Query: 152 AGTSAGAAVMGHHMIAGGGSGETPN

  18. Emanations and 'induced' radioactivity: from mystery to (mis)use

    International Nuclear Information System (INIS)

    Kolar, Z.I.

    1999-01-01

    The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

  19. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    International Nuclear Information System (INIS)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung

    2014-01-01

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

  20. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

    2014-05-15

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.

  1. Dicty_cDB: AFI444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI444 (Link to dictyBase) - - - Contig-U16560-1 AFI444Z (Link... to Original site) - - AFI444Z 326 - - - - Show AFI444 Library AF (Link to library) Clone ID AFI444 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16560-1 Original site URL http://dict...e ... 109 2e-36 B27806( B27806 ) ubiquitin (clone lambda229) - slime mold (Dictyo...s... 109 2e-36 A27806( A27806 ) polyubiquitin 5 (clone pLK229) - slime mold (Dict... 109 6e-36 M19666_1( M19

  2. VizieR Online Data Catalog: Lick AGN monitoring 2011: light curves (Barth+, 2015)

    Science.gov (United States)

    Barth, A. J.; Bennert, V. N.; Canalizo, G.; Filippenko, A. V.; Gates, E. L.; Greene, J. E.; Li, W.; Malkan, M. A.; Pancoast, A.; Sand, D. J.; Stern, D.; Treu, T.; Woo, J.-H.; Assef, R. J.; Bae, H.-J.; Brewer, B. J.; Cenko, S. B.; Clubb, K. I.; Cooper, M. C.; Diamond-Stanic, A. M.; Hiner, K. D.; Honig, S. F.; Hsiao, E.; Kandrashoff, M. T.; Lazarova, M. S.; Nierenberg, A. M.; Rex, J.; Silverman, J. M.; Tollerud, E. J.; Walsh, J. L.

    2015-05-01

    This project was allocated 69 nights at the Lick 3m Shane telescope, distributed between 2011 March 27 and June 13. Observations were conducted using the Kast double spectrograph (3440-5515Å on the blue side and 5410-8200Å on the red side). In order to extend our light curves for two AGNs, we also requested additional observations from other observers using the Kast spectrograph: Mrk 50 from 2011 January through March, and Zw 229-015 in June and July. For Zw 229-015, three additional observations were taken 20-23 days after the end of our main campaign. See section 3. (2 data files).

  3. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 387 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCA...ALPEGLIES Sbjct: 1 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 60 ... Query: 448 GRPVPVDFALI...domonas palustris CGA009] ... Length = 229 ... Query: 328 MAQLSRTVRLVEAGIPVLL

  4. Ultraviolet Resonant Raman Enhancements in the Detection of Explosives

    Energy Technology Data Exchange (ETDEWEB)

    Short Jr., Billy Joe [Naval Postgraduate School, Monterey, CA (United States)

    2009-06-01

    Raman-based spectroscopy is potentially militarily useful for standoff detection of high explosives. Normal (non-resonance) and resonance Raman spectroscopies are both light scattering techniques that use a laser to measure the vibrational spectrum of a sample. In resonance Raman, the laser is tuned to match the wavelength of a strong electronic absorbance in the molecule of interest, whereas, in normal Raman the laser is not tuned to any strong electronic absorbance bands. The selection of appropriate excitation wavelengths in resonance Raman can result in a dramatic increase in the Raman scattering efficiency of select band(s) associated with the electronic transition. Other than the excitation wavelength, however, resonance Raman is performed experimentally the same as normal Raman. In these studies, normal and resonance Raman spectral signatures of select solid high explosive (HE) samples and explosive precursors were collected at 785 nm, 244 nm and 229 nm. Solutions of PETN, TNT, and explosive precursors (DNT & PNT) in acetonitrile solvent as an internal Raman standard were quantitatively evaluated using ultraviolet resonance Raman (UVRR) microscopy and normal Raman spectroscopy as a function of power and select excitation wavelengths. Use of an internal standard allowed resonance enhancements to be estimated at 229 nm and 244 nm. Investigations demonstrated that UVRR provided ~2000-fold enhancement at 244 nm and ~800-fold improvement at 229 nm while PETN showed a maximum of ~25-fold at 244 nm and ~190-fold enhancement at 229 nm solely from resonance effects when compared to normal Raman measurements. In addition to the observed resonance enhancements, additional Raman signal enhancements are obtained with ultraviolet excitation (i.e., Raman scattering scales as !4 for measurements based on scattered photons). A model, based partly on the resonance Raman enhancement results for HE solutions, is presented for estimating Raman enhancements for solid HE samples.

  5. Correction: Experimental and theoretical studies of nanofluid thermal conductivity enhancement: a review

    Directory of Open Access Journals (Sweden)

    Kleinstreuer Clement

    2011-01-01

    Full Text Available Abstract Correction to Kleinstreuer C, Feng Y: Experimental and theoretical studies of nanofluid thermal conductivity enhancement: a review. Nanoscale Research Letters 2011, 6:229.

  6. 40 CFR 229.3 - Transportation and disposal of vessels.

    Science.gov (United States)

    2010-07-01

    ... procedures; (iv) Information on the potential effect of the vessel disposal on the marine environment; and (v... practicable all materials which may degrade the marine environment, including without limitation (i) emptying... and tanks are essentially free of petroleum, and (ii) removing from the hulls other pollutants and all...

  7. 17 CFR 229.101 - (Item 101) Description of business.

    Science.gov (United States)

    2010-04-01

    ... of current or future operations of the segment. Comparative financial information shall be included..., trademarks, licenses, franchises and concessions held. (v) The extent to which the business of the segment is... areas may not be indicative of current or future operations. To the extent necessary to the discussion...

  8. 17 CFR 229.508 - (Item 508) Plan of distribution.

    Science.gov (United States)

    2010-04-01

    ... business function of such underwriter(s) will be to sell the securities to be registered, or that the... acquisition, reorganization, readjustment or succession, describe briefly the general effect of the plan and...

  9. 27 CFR 44.229 - Collateral evidence as to landing.

    Science.gov (United States)

    2010-04-01

    ... failure to furnish such proofs; that such failure was not occasioned by any lack of diligence on the part... prescribed evidence of landing as may be obtained from the consignee or other persons having knowledge... translations thereof in English, and, when the letters fail to identify sufficiently the tobacco products, and...

  10. 17 CFR 229.301 - (Item 301) Selected financial data.

    Science.gov (United States)

    2010-04-01

    ... subsidiaries consolidated. 4. If interim period financial statements are included, or are required to be... issuer shall disclose also the following information in all filings containing financial statements: A.... currency of the foreign currency in which the financial statements are denominated; B. A history of...

  11. 17 CFR 229.1123 - (Item 1123) Servicer compliance statement.

    Science.gov (United States)

    2010-04-01

    ... 1934 AND ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION S-K Asset-Backed Securities (Regulation... officer's knowledge, based on such review, the servicer has fulfilled all of its obligations under the... servicing the pool assets, a separate servicer compliance statement is required from each servicer that...

  12. 50 CFR 229.35 - Bottlenose Dolphin Take Reduction Plan.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS AUTHORIZATION FOR COMMERCIAL FISHERIES UNDER THE MARINE MAMMAL PROTECTION ACT OF 1972 Take Reduction Plan Regulations and Emergency Regulations... management council demarcation line between the Atlantic Ocean and the Gulf of Mexico (as described in § 600...

  13. 17 CFR 229.504 - (Item 504) Use of proceeds.

    Science.gov (United States)

    2010-04-01

    ... of registrant's financial condition and results of operations, such as liquidity and capital expenditures. 3. If any material amounts of other funds are necessary to accomplish the specified purposes for which the proceeds are to be obtained, state the amounts and sources of such other funds needed for each...

  14. 17 CFR 229.1001 - (Item 1001) Summary term sheet.

    Science.gov (United States)

    2010-04-01

    ... sheet that is written in plain English. The summary term sheet must briefly describe in bullet point format the most material terms of the proposed transaction. The summary term sheet must provide security... transaction. The bullet points must cross-reference a more detailed discussion contained in the disclosure...

  15. 17 CFR 229.909 - (Item 909) Conflicts of interest.

    Science.gov (United States)

    2010-04-01

    ...) Conflicts of interest. (a) Briefly describe the general partner's fiduciary duties to each partnership subject to the roll-up transaction and each actual or potential material conflict of interest between the... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 909) Conflicts of...

  16. All projects related to | Page 229 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Advancing Evaluation Theory and Practice in South Asia: Community of .... The Role of Militia, Predatory State Authorities, and Rogue Capital in the Horn of Africa ... Topic: CONFLICTS, CAPITAL MOVEMENTS, STATE, Economic and social ...

  17. Inheritance of Gelatinization Temperature and Gel Consistency in Rice (Oryza sativa L.)

    Science.gov (United States)

    Kiani; Sh.; Ranjbar, G. A.; Kazemitabar, S. K.; Jelodar, N. B.; Nowrozi, M.; Bagheri, N.

    Gelatinization Temperature (GT) and Gel Consistency (GC) are important traits in determination of rice quality. In present study four rice cultivars namely Sang-e-Tarrom, Gerdeh, IR229 and IRRI2 have been utilized in hybridization as parents. In order to know about genetic characteristics and inheritance of the related traits, direct and reciprocal crosses have been conducted between parents Sang-e-Tarrom and Gerdeh and between IR229 and IRRI2. Inheritance of related traits have been studied in direct and reciprocal hybridizations for hard, intermediate and soft GC, low and high GT. For these evaluations P1, P2, F1, F2, BC1, BC2 generations and their reciprocal crosses have been utilized in present study. Results showed that gene hard GC dominates on intermediate and soft and also intermediate GT dominates on low. From direct and reciprocal crosses Gerdeh x Sang-e-Tarrom and IR229 x IRRI2 have been illustrated that GC and GT expressions are under monogenic control of one major gene corresponding with several modifier genes. Gene dosage effects play a tremendously important and effective role in segregation production among traits. Regarding to the obtained results selections can effectively be performed in later segregation generations for GC and in early generations for GT.

  18. Od krize Západu k jeho katastrofě: Ke strukturalistické koncepci filosofie dějin J. L. Fischera

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    2016-01-01

    Roč. 64, č. 2 (2016), s. 229-246 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : crisis * peripetia * catastrophe * 'primitivism' * legitimisation * democracy Subject RIV: AA - Philosophy ; Religion

  19. Journal of Biosciences

    Indian Academy of Sciences (India)

    tribpo

    Antiserum directed against cell surface antigens ... lating antigen in bancroftian filariasis. 229 ... Tissue specific compartmental analysis of gonado- ..... Prostate. Effect of luteinizing hormone releasing hormone analogues on testosterone ...

  20. 75 FR 12810 - Petition for Waiver of Compliance

    Science.gov (United States)

    2010-03-17

    ... DEPARTMENT OF TRANSPORTATION Federal Railroad Administration Petition for Waiver of Compliance In... Switching Service, 49 CFR Part 224 Reflectorization of Rail Freight Rolling Stock, and 49 CFR Part 229...

  1. 77 FR 39965 - Endangered and Threatened Wildlife and Plants; Listing the Hyacinth Macaw

    Science.gov (United States)

    2012-07-06

    .... 229). A network of nongovernmental organizations, Rede Cerrado, has been established to promote local sustainable-use practices for natural resources (Klink and Machado 2005, p. 710). Rede Cerrado provided the...

  2. Pichicuco 6: Gulf of California CTD Data Report. R/V New Horizon,

    Science.gov (United States)

    1984-11-01

    cSient ists at Cent ro dj( Oceariografia Fisica eit re ivestilgadores, del Cell - . Inivestilgaciin CieriTica N Ldiucaciori Suiperior de’ t ro de...1 16 STAMIN PC6092 28 37.0 N 112 55.8 W 23/11/84 2054Z 896/1260mn Temperature a2.9 4.93 6.9 8.9 19.9 12.9 14.9 16.9 18.2 22.9 22.9 24.9 26.2 28.2 622...50.0 14.258 34.933 26.101 140.0 9.619 34.694 26.800 60.0 14.132 34.915 26.114 4 1 . . .. 1 󈧪 STAMIN PC6114 28 37.6 N 112 38.6 W 24/11/84 245Z 486/ 365m

  3. Plány Vyšehradu v Národní knihovně v Paříži

    Czech Academy of Sciences Publication Activity Database

    Nechvátal, Bořivoj

    2016-01-01

    Roč. 41, č. 2 (2016), s. 229-242 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : defence system * palisades * bastion * ravelin * Vyšehrad Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Position Measurements of the Core in 3C 66B

    Indian Academy of Sciences (India)

    Shanghai Astronomical Observatory, Chinese Academy of Sciences, Shanghai 200030, China. ... The Institute of Space and Astronautical Science, JAXA, Kanagawa 229-8510, Japan. ... Articles are also visible in Web of Science immediately.

  5. LOCAL GOVERNMENT AND INTERGOVERNMENTAL RELATIONS ...

    African Journals Online (AJOL)

    GRACE

    study reveals that intergovernmental relations among the levels of government .... International Journal of Development and Management Review (INJODEMAR) Vol.10 June, 2015 ..... Administrative Science Quarterly, 16 (2): 216-229. Jinadu ...

  6. Introduction to the cellular and molecular biology of cancer

    National Research Council Canada - National Science Library

    Selby, P. (Peter); Knowles, Margaret A

    2005-01-01

    ... A. Prigent 186xii CONTENTS 12 Apoptosis: molecular physiology and significance for cancer therapeutics Dean A. Fennell 210 13 Mechanisms of viral carcinogenesis Paul Farrell 229 14 Cytokines and canc...

  7. Therapy with high LET Radioisotopes: Can sufficient levels of attractive Auger and alpha emitters be produced to make their use practical?

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Mirzadeh, S.; Stabin, M.; Brill, A.B.

    2005-01-01

    Because of localized energy deposition within a very small volume, cellular targeted therapy with high linear energy transfer (LET) Auger-electron and alpha-particle emitting radioisotopes is of great interest. While the energy deposition from alpha particles usually encompasses several cell diameters, the dose from Auger electrons is confined to a single cell. Two major challenges for broader use of Alpha and Auger emitters are the efficient and cost effective routine production of sufficient levels of these radioisotopes, and the availability of targeting molecules to which the radioisotopes can be attached for cellular delivery of sufficient levels of activity for effective therapy. Examples of several Alpha-and Auger-emitting radioisotopes of current interest are presented. Alpha- and Auger electron-emitting radioisotopes can be produced in accelerators (A) and nuclear reactors (R), and several alpha emitter congeners (i.e. thorium-229) can be obtained from uranium decay products. The challenge for reactor production, is the availability and exploitation of methods - other then the usual radiative (n,γ) production route which will provide no-carrier-added (nca) or the high specific activity radioisotopes of interest. The submitted manuscript has been authored by a contractor of the U.S. Government under contract DE-AC05-00OR22725. Accordingly, the U.S. Government retains a nonexclusive, royalty-free license to publish or reproduce the published form of this contribution, or allow others to do so, for U.S. Government purposes High LET radioisotopes of current interest which are in the initial stages of development and/or which demonstrate practical use in clinical trials include several alpha-emitters, in particular bismuth-213 - and also the actinium-225 parent - astatine-211 and bismuth-212. Extensive experimental studies have been reported with Auger iododeoxyuridine (IdUR) radiolabeled with the iodine-125 emitter-labeled. However, development of production

  8. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  9. Generalized phase diagram for the rare-earth elements: Calculations and correlations of bulk properties

    International Nuclear Information System (INIS)

    Johansson, B.; Rosengren, A.

    1975-01-01

    A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K

  10. O przyczynach braku wyobrażeń miłości fizycznej w literaturze górnołużyckiej i kaszubskiej

    Czech Academy of Sciences Publication Activity Database

    Derlatka, Tomasz

    2015-01-01

    Roč. 161, č. 1 (2015), s. 221-229 ISSN 0137-1150 Institutional support: RVO:68378017 Keywords : Cassubian literature * Upper Lusatian literature * sexuality in literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. 48 CFR 812.301 - Solicitation provisions and contract clauses for the acquisition of commercial items.

    Science.gov (United States)

    2010-10-01

    ....216-70, Estimated quantities. (15) 852.228-71, Indemnification and insurance. (16) 852.229-70, Sales...) 852.273-71, Alternative negotiation techniques. (3) 852.273-72, Alternative evaluation. (4) 852.273-73...

  12. Should mean arterial pressure be included in the definition of ambulatory hypertension in children?

    Science.gov (United States)

    Suláková, Terezie; Feber, Janusz

    2013-07-01

    The diagnosis of hypertension (HTN)/normotension (NT) on ambulatory blood pressure monitoring (ABPM) is usually based on systolic (SBP) or diastolic blood pressure (DBP). The goal of this study was to analyze whether inclusion of mean arterial pressure (MAP) improves the detection of HTN on ABPM. We retrospectively studied ABPM records in 229 children (116 boys, median age = 15.3 years) who were referred for evaluation of HTN. A diagnosis of HTN was made if: (A) MAP or SBP or DBP was ≥ 1.65 SDS (95th percentile); (B) SBP or DBP was ≥ 1.65 SDS (95th percentile), during 24-h or daytime or night-time in both definitions. Using definition A, 46/229 patients had HTN compared to definition B by which only 37/229 patients had HTN (p = 0.001). The level of agreement between the two definitions was very good (kappa = 0.86 ± 0.04), however nine patients (19.5 %) were missed by not using MAP in the definition of HTN. These nine patients had only mild HTN with a median Z score of 1.69. The inclusion of MAP in the definition of ambulatory HTN significantly increased the number of hypertensive patients. MAP may be very helpful in detecting mild HTN in patients with normal/borderline SBP and DBP.

  13. Hepatitis B: report of prevalence and access to healthcare among Chinese residents in Sheffield UK.

    Science.gov (United States)

    Vedio, Alicia B; Ellam, Helena; Rayner, Frances; Stone, Benjamin; Kudesia, Goura; McKendrick, Michael W; Green, Stephen T

    2013-12-01

    Overall prevalence of hepatitis B (HBV) in the UK is low. However, among migrants from endemic areas, prevalence has been shown to be high. Furthermore, timely diagnosis and/or referral are required prevent serious health consequences through early institution of treatment. We identified locations that would be familiar to Chinese members of the community with the objective of facilitating testing. Dried blood spot samples were collected from 229 Chinese subjects and tested for HBV and also for hepatitis C virus (HCV) infection--offering complete chronic viral hepatitis screening. HBsAg was positive in 20/229 (8.7%) participants, (10 F, 10 M). Five women and one man were aware of their condition, but only one man and none of the women were under specialist care. The average length of residence in the UK for positive patients was 15 years (range 2-40). Evidence of HBV past infection, HBcAb(+)/HBsAg(-), was seen in 28/229 participants (12.2%). HCV antibody testing produced negative results in all participants. The methodology of testing was well accepted, 139/144 (95%) responded to a feedback questionnaire declaring no discomfort and 100% finding the information session useful. This model of outreach testing is helpful for addressing health inequalities afflicting the UK's Chinese community. Copyright © 2013 King Saud Bin Abdulaziz University for Health Sciences. Published by Elsevier Ltd. All rights reserved.

  14. [Absorption Characteristics and Simulation of LLM-105 in the Terahertz Range].

    Science.gov (United States)

    Meng, Zeng-rui; Shang, Li-ping; Du, Yu; Deng, Hu

    2015-07-01

    2,6-diamino-3,5-dinitropyrazine-1-oxide (LLM-105), a novel explosive with high energy and low sensibility. In order to study the molecular structure characteristics of the explosive, the absorption spectra of LLM-105 in the frequency range of 0.2-2.4 THz were detected by terahertz time-domain spectroscopy (THz-TDS). The results showed that a number of characteristic absorption peaks with different intensity located at 1.27, 1.59, 2.00, 2.08, 2.20, 2.29 THz. The article also simulated the absorption spectra of LLM-105 molecular crystal within 0.2-2.5 THz region by using Materials Studio 6.0 software based on density functional theory (DFT), and the simulated results agreed well with the experimental data except for the peak at 2.29 THz, which verified theoretically the accuracy of the experimental data. In addition, the vibrational modes of the characteristic peaks in the experimental absorption spectra were analyzed and identified, the results showed that the forming of the characteristic absorption peaks and the molecular vibration were closely related, which further provided important laboratory and technology support for the study of the transformation of molecule structure of LLM-105. There was no simulated frequency agreed with the experimental absorption peak at 2.29 THz, which may be caused by the vibration of the crystal lattice or other reasons.

  15. .i.Pluteus septocystidiatus./i., a new species with unique pleurocystidia

    Czech Academy of Sciences Publication Activity Database

    Ševčíková, H.; Antonín, V.; Borovička, Jan

    2014-01-01

    Roč. 66, č. 2 (2014), s. 229-239 ISSN 0082-0598 Institutional support: RVO:67985831 Keywords : ITS * Pluteaceae * Septa * Sp. nov * taxonomy Subject RIV: EF - Botanics Impact factor: 1.021, year: 2014

  16. Fish products and their trade in Tauric Chersonesos/Byzantine Cherson: the development of a traditional craft from Antiquity to the Middle Ages

    Czech Academy of Sciences Publication Activity Database

    Čechová, Martina

    2014-01-01

    Roč. 17, č. 1 (2014), s. 229-236. ISBN 978-2-87772-579-8. ISSN 2101-2849 Institutional support: RVO:68378017 Keywords : Tauric Chersonesos * fish products Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. 78 FR 71431 - National Family Week, 2013

    Science.gov (United States)

    2013-11-27

    ..., same-sex couple, single parent, or guardian--families are the building blocks of American society... Family Week, 2013 #0; #0; #0; Presidential Documents #0; #0; #0;#0;Federal Register / Vol. 78 , No. 229...

  18. Historie chovu domácích zvířat v Čechách a na Moravě ve světle archeozoologických nálezů

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2016-01-01

    Roč. 64, č. 5 (2016), s. 225-229 ISSN 0044-4812 Institutional support: RVO:67985912 Keywords : archaeozoology * history * domestic animals * domestication * central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  19. Recovering corporate memory. Wine porters’ guilds and religious traditions in pre-industrial northern Italy

    Directory of Open Access Journals (Sweden)

    Miguel Laborda-Pemán

    2016-09-01

    Full Text Available Review of: Lester K. Little, Indispensable immigrants: The wine porters of northern Italy and their saint, 1200-1800, Manchester, Manchester University Press, 2015, 229 p., ISBN: 978071909522, £ 70.00.

  20. Beyond a one-man show: The prelude of Revisionist Zionism, 1922-25

    Czech Academy of Sciences Publication Activity Database

    Zouplna, Jan

    2013-01-01

    Roč. 19, č. 3 (2013), s. 410-432 ISSN 1353-7121 Institutional support: RVO:68378009 Keywords : interwar Zionism * Israeli right * Russian-Jewish intelligentsia Subject RIV: AB - History Impact factor: 0.229, year: 2013

  1. Uživatelské rozhraní systému Kramerius 4

    Czech Academy of Sciences Publication Activity Database

    Lhoták, Martin; Jansová, Linda

    2011-01-01

    Roč. 63, č. 6 (2011), s. 227-229 ISSN 0011-2321 Institutional research plan: CEZ:AV0Z70830501 Keywords : user interface * Kramerius 4 * digital libraries Subject RIV: AF - Documentation, Librarianship, Information Studies

  2. 78 FR 53336 - List of Fisheries for 2013

    Science.gov (United States)

    2013-08-29

    ..., fisher self- reports, reports to the SRGs, conference papers, FMPs, and ESA documents. The LOF for 2013... platforms (e.g., vessels, airplanes, points on shore) (50 CFR 229.7). Although NMFS is not initiating...

  3. Protectants used in the cryopreservation of microorganisms

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk

    2003-01-01

    Roč. 46, č. 3 (2003), s. 205-229 ISSN 0011-2240 Institutional research plan: CEZ:AV0Z6093917 Keywords : cryopreservation * cryoprotectants Subject RIV: EE - Microbiology, Virology Impact factor: 1.445, year: 2003

  4. Pesticide knowledge, practice and attitude and how it affects the ...

    African Journals Online (AJOL)

    2014-06-02

    scale farmers in Uganda: a cross-sectional ... protective equipment (PPE (e.g. mask, boots, gloves, long sleeved shirt, overalls, hat)) ..... What do you wear doing pesticide spraying (PPE)?. Ordinary clothing. 229 (73) 105 (70).

  5. Gypsum and hydrohalite dynamics in sea ice brines

    Science.gov (United States)

    Butler, Benjamin M.; Papadimitriou, Stathys; Day, Sarah J.; Kennedy, Hilary

    2017-09-01

    Mineral authigenesis from their dissolved sea salt matrix is an emergent feature of sea ice brines, fuelled by dramatic equilibrium solubility changes in the large sub-zero temperature range of this cryospheric system on the surface of high latitude oceans. The multi-electrolyte composition of seawater results in the potential for several minerals to precipitate in sea ice, each affecting the in-situ geochemical properties of the sea ice brine system, the habitat of sympagic biota. The solubility of two of these minerals, gypsum (CaSO4 ·2H2O) and hydrohalite (NaCl · 2H2O), was investigated in high ionic strength multi-electrolyte solutions at below-zero temperatures to examine their dissolution-precipitation dynamics in the sea ice brine system. The gypsum dynamics in sea ice were found to be highly dependent on the solubilities of mirabilite and hydrohalite between 0.2 and - 25.0 ° C. The hydrohalite solubility between - 14.3 and - 25.0 ° C exhibits a sharp change between undersaturated and supersaturated conditions, and, thus, distinct temperature fields of precipitation and dissolution in sea ice, with saturation occurring at - 22.9 ° C. The sharp changes in hydrohalite solubility at temperatures ⩽-22.9 °C result from the formation of an ice-hydrohalite aggregate, which alters the structural properties of brine inclusions in cold sea ice. Favourable conditions for gypsum precipitation in sea ice were determined to occur in the region of hydrohalite precipitation below - 22.9 ° C and in conditions of metastable mirabilite supersaturation above - 22.9 ° C (investigated at - 7.1 and - 8.2 ° C here) but gypsum is unlikely to persist once mirabilite forms at these warmer (>-22.9 °C) temperatures. The dynamics of hydrohalite in sea ice brines based on its experimental solubility were consistent with that derived from thermodynamic modelling (FREZCHEM code) but the gypsum dynamics derived from the code were inconsistent with that indicated by its

  6. Tra Albania e Italia: storie solide e confini liquidi

    Directory of Open Access Journals (Sweden)

    Lorenzo Mari

    2014-10-01

    Full Text Available Recensione di: Emma Bond e Daniele Comberiati (a cura di, Il confine liquido. Rapporti interculturali fra Italia e Albania, Nardò, Besa, 2013, 229 p., ISBN: 9788849708950, € 18,00.

  7. Material effect in the nuclear fuel-coolant interaction: Analyses of prototypic melt fragmentation and solidification in the KROTOS facility

    Czech Academy of Sciences Publication Activity Database

    Tyrpekl, V.; Piluso, P.; Bakardjieva, Snejana; Dugne, O.

    2014-01-01

    Roč. 186, č. 2 (2014), s. 229-240 ISSN 0029-5450 Institutional support: RVO:61388980 Keywords : fuel-coolant interaction * melt fragmentation * KROTOS facility Subject RIV: CA - Inorganic Chemistry Impact factor: 0.725, year: 2014

  8. 40 CFR 52.1670 - Identification of plans.

    Science.gov (United States)

    2010-07-01

    ... regulations. (x) February 20, 1980, dealing with public hearings to revise Parts 229 and 231 of 6 NYCRR... Corporation. (2) October 17, 1996 letter to Mr. Ted Gardella, EPA from Mr. Patrick Lentlie, supplementing the...

  9. 76 FR 31579 - Designation for the State of Georgia and State of Montana Areas

    Science.gov (United States)

    2011-06-01

    ... agency Headquarters location and telephone start end Georgia Atlanta, GA (229) 386-3141......... 7/1/2011 6/30/2014. Additional Location: Tifton, GA.... Montana Helena, MT (406) 761-2141 7/1/2011 6/30/2014...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 229 ... Vol 17, No 1 (2005), Obtaining the green's function for electromagnetic waves propagating in layered in-homogeneous thin film media of spherical ... screens within Benue State University, Makurdi, Nigeria, Abstract.

  11. a stochastic assessment of the effect of global warming on rainfall

    African Journals Online (AJOL)

    PROF EKWUEME

    KEYWORDS: Global Warming; Rainfall; Markov Process; Time Series; Agriculture. INTRODUCTION ... Central Region of Nigeria in the last three decades using .... r. Time. MSD: MAD: MAPE: Length: Moving Average. 68492.0. 229.3. 3806.2. 4.

  12. Genetic variation of Phoma sorghina isolates from southern Africa and Texas

    Czech Academy of Sciences Publication Activity Database

    Pažoutová, Sylvie

    2009-01-01

    Roč. 54, č. 3 (2009), s. 217-229 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : phoma sorghina * phytopathogen * originating Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009

  13. The Figure of Yan Zhuoju 顏涿聚 in Ancient Chinese Literature

    Czech Academy of Sciences Publication Activity Database

    Weingarten, Oliver

    2015-01-01

    Roč. 63, č. 2 (2015), s. 229-261 ISSN 0254-9948 Institutional support: RVO:68378009 Keywords : Confucius * Confucius's Disciples * Yan Zhuoju * Anecdotes * Early Chinese History * Philology * Historiography * Rhetoric Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. Conservation of farmland birds faces different challenges in Western and Central-Eastern Europe

    Czech Academy of Sciences Publication Activity Database

    Tryjanowski, P.; Hartel, T.; Báldi, A.; Szymański, P.; Tobolka, M.; Herzon, I.; Goławski, A.; Konvička, Martin; Hromada, M.; Jerzak, L.; Kujawa, K.; Lenda, M.; Orłowski, G.; Panek, M.; Skórka, P.; Sparks, T. H.; Tworek, S.; Wuczyński, A.; Zmihorski, M.

    2011-01-01

    Roč. 46, č. 1 (2011), s. 1-12 ISSN 0001-6454 Institutional research plan: CEZ:AV0Z50070508 Keywords : landscape ecology * habitat * matrix Subject RIV: EH - Ecology, Behaviour Impact factor: 1.229, year: 2011

  15. Outcome of Emergency Abdominal Surgery at Kigali University ...

    African Journals Online (AJOL)

    There is little information regarding the clinical spectrum of disease in these patients ... was a case series study of 229 patients who underwent emergency abdominal ... The most common operative findings were peritonitis (41.5%), intestinal ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 229 ... ... of Parental Socioeconomic Status on Caries Prevalence Among Children Seen at ... Vol 9, No 1 (2011), Knowledge about complications and practice of ... of asthma: Facing challenges in special situations (pregnancy, ...

  17. Fungal Systematics and Evolution: FUSE 3

    Czech Academy of Sciences Publication Activity Database

    Krisai-Greilhuber, I.; Chen, Y.; Jabeen, S.; Madrid, H.; Marincowitz, S.; Razaq, A.; Ševčíková, H.; Voglmayr, H.; Yazici, K.; Aptroot, A.; Aslan, A.; Boekhout, T.; Borovička, Jan; Crous, P.W.; Ilyas, S.; Jami, F.; Jiang, Y. L.; Khalid, A. N.; Kolecká, A.; Konvalinková, T.; Norphanphoun, C.; Shaheen, S.; Wang, Y.; Wingfield, M. J.; Wu, S. P.; Wu, Y. M.; Yu, J. Y.

    2017-01-01

    Roč. 36, 29 December 2017 (2017), s. 229-264 ISSN 0082-0598 Institutional support: RVO:67985831 Keywords : biodiversity * ITS varcodes * phylogeny * systematics Subject RIV: EF - Botanics OBOR OECD: Mycology Impact factor: 0.896, year: 2016

  18. 48 CFR 1652.229-70 - Taxes-Foreign Negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... security or other employment taxes, net income and franchise taxes, excess profits taxes, capital stock taxes, transportation taxes, unemployment compensation taxes, and property taxes. “Excepted tax” does...

  19. 48 CFR 52.229-6 - Taxes-Foreign Fixed-Price Contracts.

    Science.gov (United States)

    2010-10-01

    ... social security or other employment taxes, net income and franchise taxes, excess profits taxes, capital stock taxes, transportation taxes, unemployment compensation taxes, and property taxes. Excepted tax...

  20. 17 CFR 229.1004 - (Item 1004) Terms of the transaction.

    Science.gov (United States)

    2010-04-01

    ... to the accounting treatment of the transaction, if material; and (xii) The federal income tax... security holders as a result of the transaction, if material; (vi) A brief statement as to the accounting... access to the corporate files of the filing person or to obtain counsel or appraisal services at the...

  1. People and things. CERN Courier, November 1982, v. 22(9)

    International Nuclear Information System (INIS)

    Anon.

    1982-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The 11th International Symposium on Lepton-Photon Interactions at High Energies will be held at Cornell University, Ithaca, New York, from 4-9 August 1983. According to our present understanding of the quark forces acting deep inside strongly interacting particles (hadrons), these forces are communicated by the exchange of gluons. These new force carriers thus appear high up on experimenters' want lists. The contest to measure the lifetime of the positive muon to high accuracy has a new entry. A group from the College of William and Mary in Virginia, using a muon beam at the TRIUMF cyclotron in Vancouver has recently measured the positive muon lifetime to one part in 36 000. Early in September, first circulating beam was achieved in the X-ray ring of the US National Synchrotron Light Source at Brookhaven, just over a year after the first beams were obtained in the vacuum ultraviolet ring

  2. Zoológico de Cali. (pág. 224-229

    Directory of Open Access Journals (Sweden)

    Ingrit Pineda

    2010-07-01

    Full Text Available Es un importante centro de conservación de especies en peligro de extinción, en el se encuentra gran cantidad de fauna perteneciente a nuestro continente y algunas otras traídas del África. Los animales se encuentran agrupadosy distribuidos de acuerdo al grupo taxonómico en el que se ubican; es decir encontraremos en lugares diferentes a los primates, reptiles y anfibios, aves, felinos, algunosotros mamíferos. Lavariedad de formas, colores y conductas de los animales, han hecho de este lugar un importante centro educativo, tanto de diversiónpara adultos y niños.Está catalogado como uno de los mejoreszoológicos deLatinoamérica.

  3. 17 CFR 229.202 - (Item 202) Description of registrant's securities.

    Science.gov (United States)

    2010-04-01

    ... other securities as will enable investors to understand such limitations or qualifications. No... enable investors to understand the rights evidenced by the securities; to the extent not otherwise... in the country in which the registrant is organized affecting the remittance of dividends, interest...

  4. 17 CFR 229.910 - (Item 910) Fairness of the transaction.

    Science.gov (United States)

    2010-04-01

    ... transaction is fair or unfair to investors and the reasons for such belief. Such discussion must address the fairness of the roll-up transaction to investors in each of the partnerships and as a whole. If the roll-up... the general partner that may affect materially the value of the consideration to be received by...

  5. 17 CFR 229.1113 - (Item 1113) Structure of the transaction.

    Science.gov (United States)

    2010-04-01

    ... principal distributions from the cash flows and other factors that will affect the timing or amount of..., amortization, performance or similar triggers or events, and the rights of investors or changes to the... suitability requirements regarding potential investors in purchasing the securities or any restrictions on...

  6. Controlled low strength materials (CLSM), reported by ACI Committee 229

    International Nuclear Information System (INIS)

    Rajendran, N.

    1997-01-01

    Controlled low-strength material (CLSM) is a self-compacted, cementitious material used primarily as a backfill in lieu of compacted fill. Many terms are currently used to describe this material including flowable fill, unshrinkable fill, controlled density fill, flowable mortar, flowable fly ash, fly ash slurry, plastic soil-cement, soil-cement slurry, K-Krete and other various names. This report contains information on applications, material properties, mix proportioning, construction and quality-control procedures. This report's intent is to provide basic information on CLSM technology, with emphasis on CLSM material characteristics and advantages over conventional compacted fill. Applications include backfills, structural fills, insulating and isolation fills, pavement bases, conduit bedding, erosion control, void filling, and radioactive waste management

  7. Small-angle scattering investigation of silica xerogels and sonogels prepared with ionic liquid pyridinium tetrafluoroborate

    Czech Academy of Sciences Publication Activity Database

    Almásy, L.; Putz, A.-M.; Len, A.; Pleštil, Josef; Savii, C.

    2017-01-01

    Roč. 11, č. 3 (2017), s. 229-233 ISSN 1820-6131 Institutional support: RVO:61389013 Keywords : silica * sol-gel processing * sonocatalysis Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.070, year: 2016

  8. Sociolinguistic Bibliography of European Countries for 2006: CZ

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr

    2008-01-01

    Roč. 22, - (2008), s. 220-229 ISSN 0933-1883 R&D Projects: GA ČR GA405/06/1468 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistics * bibliography * Czech Republic Subject RIV: AI - Linguistics

  9. Digital bedrock geologic map of the Mount Holly and Ludlow quadrangles, Vermont

    Data.gov (United States)

    Vermont Center for Geographic Information — Digital Data from VG94-229A Walsh, G.J., Ratcliffe, N.M., Dudley, J.B., and Merrifield, T., 1994,�Digital bedrock geologic map of the Mount Holly and Ludlow...

  10. Intraocular Pressure in Pregnant and Non-Pregnant Nigerian Women

    African Journals Online (AJOL)

    Erah

    . ... ocular diseases and these were used as the exclusion ... between groups with student's t-test. ... SD = standard deviation, SEM = standard error of mean, N= .... 38(4):229-34. 26. Qureshi IA. Intraocular pressure and pregnancy. Clin. Med.

  11. Insights into chameleons of the genus Trioceros (Squamata: Chamaeleonidae) in Cameroon, with the resurrection of Chamaleon serratus Mertens, 1922

    Czech Academy of Sciences Publication Activity Database

    Barej, M. F.; Ineich, I.; Gvoždík, Václav; Lhermitte-Vallarino, N.; Gonwouo, N.L.; Le Breton, M.; Bott, U.; Schmitz, A.

    2010-01-01

    Roč. 57, č. 2 (2010), s. 211-229 ISSN 2190-7307 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Chameleon serratus * Cameroon * insights Subject RIV: EG - Zoology

  12. Methods of separating short half-life radionuclides from a mixture of radionuclides

    International Nuclear Information System (INIS)

    Bray, L.A.; Ryan, J.L.

    1998-01-01

    The present invention is a method of obtaining a radionuclide product selected from the group consisting of 223 Ra and 225 Ac, from a radionuclide ''cow'' of 227 Ac or 229 Th respectively. The method comprises the steps of (a) permitting ingrowth of at least one radionuclide daughter from said radionuclide ''cow'' forming an ingrown mixture; (b) insuring that the ingrown mixture is a nitric acid ingrown mixture; (c) passing the nitric acid ingrown mixture through a first nitrate form ion exchange column which permits separating the ''cow'' from at least one radionuclide daughter; (d) insuring that the at least one radionuclide daughter contains the radionuclide product; (e) passing the at least one radionuclide daughter through a second ion exchange column and separating the at least one radionuclide daughter from the radionuclide product and (f) recycling the at least one radionuclide daughter by adding it to the ''cow''. In one embodiment the radionuclide ''cow'' is the 227 Ac, the at least one daughter radionuclide is a 227 Th and the product radionuclide is the 223 Ra and the first nitrate form ion exchange column passes the 227 Ac and retains the 227 Th. In another embodiment the radionuclide ''cow'' is the 229 Th, the at least one daughter radionuclide is a 225 Ra and said product radionuclide is the 225 Ac and the 225 Ac and nitrate form ion exchange column retains the 229 Th and passes the 225 Ra/Ac. 8 figs

  13. Hypertension Prevalence, Awareness and Control Levels among Ghawarna: An African-Descendant Ethnic Minority in the Jordan Valley.

    Science.gov (United States)

    Kheirallah, Khalid A; Liswi, Mohammed; Alazab, Rami; Bataineh, Zeyad; Alzyoud, Sukaina; Alsulaiman, Jomana; Jaddou, Hashem

    2015-08-07

    Treatment and control of hypertension (HTN) is a challenging issue as undiagnosed HTN prevalence seems to be high among certain ethnic groups, such as African-descendant populations. The current study attempted to measure HTN prevalence, awareness and control levels among Ghawarna, an African-descendant ethnic group living in the Jordan Valley (Al-Ghawr). A cross-sectional study was conducted in a community of Ghawarna between March and June 2013 in Ghawr Al-Mazraa Village in the southern part of the Jordan Valley. A total of 517 participants, aged >25 years, were randomly selected using cluster random sampling technique. Data were collected using an interviewer-administrated questionnaire and on-location measurement of blood pressure (BP), height, and weight. Prevalence rates were compared by sex and age groups using chi-square test while backward selection logistic regression analysis was used to identify predictors of HTN. We found 229 (44.3%) of the 517 participants had HTN. Of those 229 hypertensives, 146 (28.2%) participants were discovered to have HTN for the "first time." Only 23 of the 83 who were aware of their hypertension had their BP controlled. When we added the undiagnosed HTN (n=146) to the uncontrolled HTN (n=60), the prevalence of uncontrolled HTN became 90% (206/229). Older age, higher BMI, diabetes mellitus, and dyslipidemia were associated with having HTN. HTN prevalence, awareness and control levels are alarming among Ghawarna.

  14. Dicty_cDB: VFE615 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mal product. 70 4e-29 4 AF480920 |AF480920.1 Nyctotherus ovalis from Periplaneta ...d:none) Nyctotherus ovalis from Periplanet... 229 5e-59 AF401758_1( AF401758 |pid:none) Ethmostigmus rubripe

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 229 ... Vol 8 (2011), Prevalence of HIV/AIDS among Breast Cancer Patients and the ... Vol 11, No 2 (2014), Receptor Status and Associated Clinico- ... Vol 7 (2011), Spontaneous Intra-Peritoneal Urinary Bladder Rupture ...

  16. Download this PDF file

    African Journals Online (AJOL)

    USER

    In recent times, veterinarians and animal scientists have ... Fish farming otherwise known as fish culture is a ... farmers identified lack of finance, lack of good ... Vol. 32(3): 2011; 226 - 229. ARTICLE. Fish Production In Nigeria: An Update.

  17. Resonance assignments of the myristoylated Y28F/Y67F mutant of the Mason-Pfizer monkey virus matrix protein

    Czech Academy of Sciences Publication Activity Database

    Doležal, Michal; Hrabal, R.; Ruml, T.; Rumlová, Michaela

    2015-01-01

    Roč. 9, č. 2 (2015), s. 229-233 ISSN 1874-2718 Institutional support: RVO:61388963 Keywords : isotopic labeling * matrix protein * M-PMV * myristoylation * resonance assignment * reverse labeling Subject RIV: CE - Biochemistry Impact factor: 0.687, year: 2015

  18. Renversements de l'intentionnalité: Jean-Luc Marion et la mise en question de la subjectivité de l'apparaître

    Czech Academy of Sciences Publication Activity Database

    Novotný, Karel

    2015-01-01

    Roč. 25, č. 2 (2015), s. 217-229 ISSN 1591-9625 R&D Projects: GA ČR(CZ) GA15-10832S Institutional support: RVO:67985955 Keywords : phenomenon * reduction * givenness * interpretation * hermeneutics Subject RIV: AA - Philosophy ; Religion

  19. Skeletomusculature of Scelionidae (Hymenoptera: Platygastroidea): head and mesosoma

    DEFF Research Database (Denmark)

    Miko, I.; Vilhelmsen, Lars; Johnson, N.F.

    2007-01-01

    is proposed. External characters are redescribed and correlated with corresponding apodemes, muscles and putative exocrine gland openings; their phylogenetic importance is discussed. 229 skeletal structures were termed and defined, from which 84 are newly established or redefined. 67 muscles of the head...... of the site of origin of the mesopleuro-mesobasalare muscle. The term speculum is adopted from Ichneumonidae and Cynipoidea taxonomy on the basis of the site of origin of the mesopleuro-mesofurcal muscle. The remnants of the mesopleural ridge, sulcus and mesopleural arm and pit and the putative border between...... with corresponding apodemes, muscles and putative exocrine gland openings; their phylogenetic importance is discussed. 229 skeletal structures were termed and defined, from which 84 are newly established or redefined. 67 muscles of the head and mesosoma are examined and homologized with those present in other...

  20. File Cryptography with AES and RSA for Mobile Based on Android

    Science.gov (United States)

    laia, Yonata; Nababan, Marlince; Sihombing, Oloan; Aisyah, Siti; Sitanggang, Delima; Parsaoran, Saut; Zendato, Niskarto

    2018-04-01

    The users of mobile based on android were increasing currently even now mobile was almost the same computer one of which could be used to be done by every users mobile was save the individual important data.Saving the data on mobile was very risk because become hackers’ target. That was the reason of researchers want to add cryptography which the combination between Advance Encryption System (AES) dan Ron Rivest, Adi Shamir dan Len Adleman (RSA). The result of the second method above could do cryptography data on mobile. With different encryption time where the file size; 25.44 KB, encryption time 4 second, 200 KB, 5 second, 600 KB 7 second, 2.29 MB, 10 second. Where decryption 25.44 KB, encryption 2 second, 200 KB, 1.5 second, 600 KB 2.5 second, 2.29 MB, 2.7 second.

  1. Coronaviruses in brain tissue from patients with multiple sclerosis

    DEFF Research Database (Denmark)

    Dessau, R B; Lisby, G; Frederiksen, J L

    2001-01-01

    Brain tissue from 25 patients with clinically definite multiple sclerosis (MS) and as controls brain tissue from 36 patients without neurological disease was tested for the presence of human coronaviral RNA. Four PCR assays with primers specific for N-protein of human coronavirus strain 229E...... and three PCR assays with primers specific for the nucleocapsid protein of human coronavirus strain OC43 were performed. Sporadic positive PCR assays were observed in both patients and controls in some of the PCR assays. However, these results were not reproducible and there was no difference...... in the proportion of positive signals from the MS patients compared to controls. Evidence for a chronic infection with the human coronaviruses strain 229E or OC43 in brain tissue from patients with MS or controls has not been found in this study....

  2. N2 Fixation by Grain Legume Varieties as Affected By Rhizobia ...

    African Journals Online (AJOL)

    acer

    [*Author of Correspondence: hyakubu2009@g-mail.com]. 229. ABSTRACT: ... Yusuf et al, (2006) reported that cowpea fixed. 16-34kgN/ha and ... fixation of legume crops (Michiels et al.,. 1994). ..... Robert, M.B. (1995). ... nitrogen fixation), John.

  3. Ohlasy filozofie Georga Wilhelma Friedricha Hegela v hudebněteoretickém díle Moritze Hauptmanna

    Czech Academy of Sciences Publication Activity Database

    Myslivcová, Eva

    2015-01-01

    Roč. 52, č. 2 (2015), s. 221-229 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Georg Wilhelm Friedrich Hegel * Moritz Hauptmann * Die Natur der Harmonik und der Metrik * music theory Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Effect of electrical stimulation on consumer acceptance of mutton ...

    African Journals Online (AJOL)

    MarianaD

    -voltage electrical stimulation, HVES – high-voltage electrical stimulation, ... Electrical stimulation varied between 21 V – 1100 V. The drop in pH was significantly faster in the .... Table 2 Gender and age distribution of consumer panel (n=229).

  5. Classical and adaptive clinical trial designs using ExpDesign Studio

    National Research Council Canada - National Science Library

    Chang, Mark

    2008-01-01

    ... Relationship 2.2.9 Parallel Design 17 2.2.10 Crossover Design 17 2.2.11 Factorial Design 18 Selection of a Trial Design 18 2.3.1 Balanced Versus Unbalanced Designs 18 2.3.2 Crossover Versus Parallel...

  6. 76 FR 2837 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2011-01-18

    ... Herald-Gazette. Barnesville, 109 Forsyth Street, Barnesville, GA 30204. Georgia: Tift City of Tifton (09..., Chairman, Tift County The Tifton Gazette. Board of Commissioners, P.O. Box 229, Tifton, GA 31793. Georgia... Tift Avenue, Tifton, GA 31794. [[Page 2839

  7. 852-IJBCS-Article-Dr Sinzogan Antonio A C

    African Journals Online (AJOL)

    DR GATSING

    1CIRAD-Persyst, UPR Production Fruitière, IITA, 08 BP 0932, Cotonou, Benin. Tél. (229) ... 8.74%). These results are significant for the decision-making process for effective monitoring and management ...... Inventory of the fruit fly species.

  8. Gérard Genette, Günther Müller a Rozprava o vyprávění s Henrym Fieldingem

    Czech Academy of Sciences Publication Activity Database

    Jedličková, Alice

    -, 28/29/30 (2004), s. 229-234 ISSN 0862-8440 R&D Projects: GA ČR(CZ) GA405/04/1095 Institutional research plan: CEZ:AV0Z9056905 Keywords : narratology * narrative Subject RIV: AJ - Letters, Mass-media, Audiovision

  9. Threadfin shad Dorosoma petenense density and biomass of four Puerto Rico reservoirs – seasonal differences and comparison among temperate and tropical reservoirs

    Czech Academy of Sciences Publication Activity Database

    Wesley Neal, J.; Prchalová, Marie

    2014-01-01

    Roč. 78, 3-4 (2014), s. 229-240 ISSN 1211-376X R&D Projects: GA ČR(CZ) GPP505/12/P647 Institutional support: RVO:60077344 Keywords : trawl * sampling * variability * seasonal effect Subject RIV: EH - Ecology, Behaviour

  10. How Alzheimer's Changes the Brain

    Medline Plus

    Full Text Available ... 4-minute video shows how Alzheimer’s affects the human brain and looks at promising ideas to treat ... views 2:29 The resistant brain: nourishing our bodies against Alzheimer’s | Owen Carmichael | TEDxLSU - Duration: 12:17. ...

  11. "Normalizace" literární vědy v zrcadle časopisu Česká literatura

    Czech Academy of Sciences Publication Activity Database

    Šámal, Petr

    2002-01-01

    Roč. 50, č. 3 (2002), s. 229-241 ISSN 0009-0468 R&D Projects: GA MŠk LN00A041 Institutional research plan: CEZ:AV0Z9056905 Keywords : Czech literature * normalization Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Dead wood dependent organisms in one of the oldest protected forests of Europe: Investigating the contrasting effects of within-stand variation in a highly diversified environment

    Czech Academy of Sciences Publication Activity Database

    Horák, J.; Kout, J.; Vodka, Štěpán; Donato, D. C.

    2016-01-01

    Roč. 363, MAR 1 (2016), s. 229-236 ISSN 0378-1127 Institutional support: RVO:60077344 Keywords : biodiversity * gaps * microenvironment variation Subject RIV: EH - Ecology, Behaviour Impact factor: 3.064, year: 2016 http://www.sciencedirect.com/science/article/pii/S0378112715007744

  13. Exchange rate regimes and shocks asymmetry: the case of the accession countries

    Czech Academy of Sciences Publication Activity Database

    Babetskii, Ian; Boone, J.; Maurel, M.

    2004-01-01

    Roč. 32, č. 2 (2004), s. 212-229 ISSN 0147-5967 Institutional research plan: CEZ:AV0Z7085904 Keywords : EU enlargement * exchange rate regimes * optimal currency area criteria Subject RIV: AH - Economics Impact factor: 0.836, year: 2004

  14. Attention Problems in Very Preterm Children from Childhood to Adulthood: The Bavarian Longitudinal Study

    Science.gov (United States)

    Breeman, Linda D.; Jaekel, Julia; Baumann, Nicole; Bartmann, Peter; Wolke, Dieter

    2016-01-01

    Background: Very preterm (VP; gestational age attention problems in childhood and adulthood. The stability of these problems into adulthood is not known. Methods: The Bavarian Longitudinal Study is a prospective cohort study that followed 260 VP/VLBW and 229 term-born…

  15. Hypersexual Disorder According to the Hypersexual Disorder Screening Inventory in Help-Seeking Swedish Men and Women With Self-Identified Hypersexual Behavior

    Directory of Open Access Journals (Sweden)

    Katarina Görts Öberg, PhD

    2017-12-01

    Öberg KG, Hallberg J, Kaldo V, et al. Hypersexual Disorder According to the Hypersexual Disorder Screening Inventory in Help-Seeking Swedish Men and Women With Self-Identified Hypersexual Behavior. Sex Med 2017;5:e229–e236.

  16. Optimization of CeO2-ZrO2 mixed oxide catalysts for ethyl acetate combustion

    Czech Academy of Sciences Publication Activity Database

    Dimitrov, M.; Ivanova, R.; Štengl, Václav; Henych, Jiří; Kovacheva, D.; Tsoncheva, T.

    2015-01-01

    Roč. 47, č. 1 (2015), s. 323-329 ISSN 0324-1130 Institutional support: RVO:61388980 Keywords : nanosized CeO2-ZrO2 * mixed oxide phase * ethyl acetate combustion Subject RIV: CA - Inorganic Chemistry Impact factor: 0.229, year: 2015

  17. Prevalence, Reasons, and Perceived Effects of Khat Chewing ...

    African Journals Online (AJOL)

    Background: The estimate of the number of people chewing Khat globally ranges from 5 to. 10 million people. ..... Math. 50 (12.5). Physical education. 38 (9.5). Shift of study. Regular. 229 (57.2) ..... Health Studies: A Practical Manual. Geneva: ...

  18. Albicans candidiasis amongs women and infants at two health ...

    African Journals Online (AJOL)

    Albicans candidiasis amongs women and infants at two health facilities in Port ... and in infants – Oral Thrush (OT) was investigated in Port Harcourt, Rivers State. ... UPTH (28.6%) had more infection rate than BMSH (22.9%), pregnant women ...

  19. The Luzula comosa complex (Luzula section Luzula, Juncaceae) in western North America

    Czech Academy of Sciences Publication Activity Database

    Zika, P. F.; Wilson, B. A.; Kirschner, Jan

    2015-01-01

    Roč. 192, č. 4 (2015), s. 201-229 ISSN 1179-3155 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Luzula * Pacific North America * taxonomy Subject RIV: EF - Botanics Impact factor: 1.087, year: 2015

  20. Personality disorders in previously detained adolescent females: a prospective study

    NARCIS (Netherlands)

    Krabbendam, A.; Colins, O.F.; Doreleijers, T.A.H.; van der Molen, E.; Beekman, A.T.F.; Vermeiren, R.R.J.M.

    2015-01-01

    This longitudinal study investigated the predictive value of trauma and mental health problems for the development of antisocial personality disorder (ASPD) and borderline personality disorder (BPD) in previously detained women. The participants were 229 detained adolescent females who were assessed

  1. Translating extra-linguistic culture-bound concepts in Mofolo: a ...

    African Journals Online (AJOL)

    In other terms, words encoding cultural information are the most difficult to ... Mounin argues that it is impossible to arrive at a perfect literary translation, ..... in the Sesuto-English Dictionary (Mabille 229): “the eldest or strongest or the most ...

  2. PRODUCTION HALIEUTIQUE DU LAC FAE (BASSIN DU SAN ...

    African Journals Online (AJOL)

    about 5.229 millions CFA for the shrimp production at the rate of 1500 Flkg. .... Figure 1 Lac Fae-Localisation geographique, zones de production, secteurs et ... embankment dam ; d : water intake for regulating the threshold level of water in the.

  3. Identification of critical time-consuming student support activities in e-learning

    NARCIS (Netherlands)

    De Vries, Fred; Kester, Liesbeth; Sloep, Peter; Van Rosmalen, Peter; Pannekeet, Kees; Koper, Rob

    2005-01-01

    Please cite the original publication: De Vries, F., Kester, L., Sloep, P., Van Rosmalen, P., Pannekeet, K., & Koper, R. (2005). Identification of critical time-consuming student support activities in e-learning. Research in Learning Technology (ALT-J), 13(3), 219-229.

  4. Demonstrating sustainable energy: A review-based model of sustainable energy demonstration projects

    NARCIS (Netherlands)

    Bossink, Bart

    2017-01-01

    This article develops a model of sustainable energy demonstration projects, based on a review of 229 scientific publications on demonstrations in renewable and sustainable energy. The model addresses the basic organizational characteristics (aim, cooperative form, and physical location) and learning

  5. Anna Dziemianko: User-friendliness of Verb Syntax in Pedagogical ...

    African Journals Online (AJOL)

    Abstract. Anna Dziemianko. User-friendliness of Verb Syntax in Pedagogical Dictionaries of English. 2006, XII + 229 pp. ISBN-13: 978-3-484-39130-7. ISBN- 10: 3-484-39130-8. Lexicographica. Series Maior 130. Tübingen: Max Niemeyer. Price: €124.

  6. Využití refrakce při difrakci (difrakčně-refrakční optika)

    Czech Academy of Sciences Publication Activity Database

    Hrdý, Jaromír; Oberta, Peter

    2012-01-01

    Roč. 62, - (2012), s. 225-229 ISSN 0009-0700 R&D Projects: GA MPO FR-TI1/412 Institutional research plan: CEZ:AV0Z10100522 Keywords : diffractive optics * refractive optics * diffractive-refractive optics Subject RIV: BH - Optics, Masers, Lasers

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 229 ... Vol 18, No 2 (2006), Design and development of solar still for ... the global solar radiation in Enugu using maximum temperature data, Abstract PDF ... Vol 21, No 1 (2009), Development of an electronic measurement circuit ...

  8. Understanding gene expression in coronary artery disease through ...

    Indian Academy of Sciences (India)

    Understanding gene expression in coronary artery disease through global profiling, network analysis ... A_33_P3249595 B-cell CLL/lymphoma 11A (zinc finger protein). BCL11A. 2.29 ..... It acts as a cytoplasmic sensor for viral infection and ...

  9. Ovoce, koření a léčiva z raně novověké jímky hradčanského špitálu

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    2008-01-01

    Roč. 60, č. 2 (2008), s. 229-260 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Prague-Hradčany * post-Medieval * carpological analyse * xylotomical analyse * imported species * introduced species Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Docetaxel-carboplatin in combination with erlotinib and/or bevacizumab in patients with non-small cell lung cancer

    Directory of Open Access Journals (Sweden)

    Boutsikou E

    2013-03-01

    Full Text Available Eftimia Boutsikou,1 Theodoros Kontakiotis,1 Paul Zarogoulidis,1 Kaid Darwiche,2 Ellada Eleptheriadou,1 Konstantinos Porpodis,1 Grammati Galaktidou,3 Leonidas Sakkas,4 Wolfgang Hohenforst-Schmidt,5 Kosmas Tsakiridis,6 Theodoros Karaiskos,7 Konstantinos Zarogoulidis11Pulmonary Department-Oncology Unit, G Papanikolaou General Hospital, Aristotle University of Thessaloniki, Greece; 2University Pulmonary Department-Interventional Unit, Ruhrland Klinic, University of Duisburg-Essen, Essen, Germany; 3Theagenio Anticancer Institute Research Laboratory, 4Department of Pathology, G Papanikolaou Hospital, Thessaloniki, Greece; 5II Medical Clinic, Hospital Coburg, University of Wuerzburg, Coburg, Germany; 6Cardiothoracic Surgery Department, Saint Luke Private Hospital, Panorama, 7Cardiothoracic Surgery Department, G Papanikolaou General Hospital, Aristotle University of Thessaloniki, Thessaloniki, GreeceBackground: Bevacizumab and erlotinib have been demonstrated to prolong overall survival in patients with non-squamous non-small cell lung cancer (NSCLC. We designed a four-arm Phase III trial to evaluate the efficacy and toxicity of the combination of docetaxel, carboplatin, bevacizumab, and erlotinib in the first-line treatment of patients with NSCLC.Methods: A total of 229 patients with stage IIIb/IV non-squamous NSCLC were treated with two cycles of carboplatin (area under the concentration-time curve 5.5 and docetaxel 100 mg/m2 as chemotherapy. After completion of two treatment cycles, patients were evaluated for response and divided into four groups: 61/229 continued with four more cycles of chemotherapy (control group, 52/229 received chemotherapy plus erlotinib 150 mg daily, 56/229 received chemotherapy plus bevacizumab 7.5 mg/kg, and 60/229 were treated with the combination of chemotherapy, erlotinib, and bevacizumab until disease progression. The primary endpoint was overall survival.Results: Over 4 years of follow-up, there was no statistically

  11. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    International Nuclear Information System (INIS)

    Segre, Nadia; Fagundes, Rosane Correa

    2013-01-01

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  12. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

    International Nuclear Information System (INIS)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung

    2014-01-01

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex

  13. Alpha-emitting nuclides in the marine environment

    Science.gov (United States)

    Pentreath, R. J.

    1984-06-01

    The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.

  14. Determination of radium in water

    International Nuclear Information System (INIS)

    Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

    1995-10-01

    These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)

  15. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    Energy Technology Data Exchange (ETDEWEB)

    Segre, Nadia; Fagundes, Rosane Correa, E-mail: nadia.segre@ctmsp.mar.mil.br [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  16. Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys

    International Nuclear Information System (INIS)

    Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.

    2006-01-01

    Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation

  17. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  18. Determination of radium in water

    Energy Technology Data Exchange (ETDEWEB)

    Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

    1995-10-01

    These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).

  19. Natural radionuclides in soils of a forest fragment of Atlantic Forest under ecological restoration process

    International Nuclear Information System (INIS)

    Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.

    2017-01-01

    The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide

  20. Search for resonances in the mass distribution of jet pairs with one or two jets identified as b-jets in proton--proton collisions at √s=13 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 759, Aug (2016), s. 229-246 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : ATLAS * upper limit * CERN LHC Coll * bottom * particle identification * cross section Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  1. Determinants of long acting and permanent contraceptive methods ...

    African Journals Online (AJOL)

    Introduction: in Ethiopia information on the level of utilization of the long-term and ... determinant factors of long-acting and permanent contraceptive methods use ... 95% CI: 1.46- 4.02), joint fertility related decision (AOR = 6.11, 95% CI: 2.29- ...

  2. Self-similarity of hard cumulative processes in fixed target experiment for BES-II at STAR

    Czech Academy of Sciences Publication Activity Database

    Tokarev, M. V.; Zborovský, Imrich; Aparin, A. A.

    2015-01-01

    Roč. 12, č. 2 (2015), s. 221-229 ISSN 1547-4771 R&D Projects: GA MŠk(CZ) LG13031 Institutional support: RVO:61389005 Keywords : critical point * cumulative process * heavy ions * high energy * phase transition * self-similarity Subject RIV: BE - Theoretical Physics

  3. histological alterations of the pancreas of wistar rats following ...

    African Journals Online (AJOL)

    bmjwa

    snuff) on the histological features of the pancreas of adult wistar rats. .... tobacco harvesters. J. Am. Med. Assoc. 229: 1880-8. Guyton, A. C. and Hall, J. E., 1996. Textbook of Medical. Physiology, 9th. Ed. W. B. Saunders Company,. Philadelphia, pp.

  4. Non-participation in systematic screening for osteoporosis-the ROSE trial

    DEFF Research Database (Denmark)

    Rothmann, M J; Möller, S; Holmberg, T

    2017-01-01

    Population-based screening for osteoporosis is still controversial and has not been implemented. Non-participation in systematic screening was evaluated in 34,229 women age 65-81 years. Although participation rate was high, non-participation was associated with comorbidity, aging other risk facto...

  5. 29 CFR 776.2 - Employee basis of coverage.

    Science.gov (United States)

    2010-07-01

    ... in covered work, their employer cannot avoid his obligations to them under the Act on the ground that.... Callus, 325 U.S. 578; Armour & Co. v. Wantock, 323 U.S. 126; Donovan v. Shell Oil Co., 168 F. 2d 229 (C.A...

  6. Frequency of mutations in Mediterranean fever gene, with gender ...

    Indian Academy of Sciences (India)

    (34.6%), fatigue (31.5%), anorexia (22.9%) and chest pain (19.0%) were the most prevalent clinical features in ... In this study, the medical records of 383 FMF patients were ..... ranean fever: a survey of 470 cases and review of the literature.

  7. 30 CFR 210.10 - What are the OMB-approved information collections?

    Science.gov (United States)

    2010-07-01

    ... information. 1010-0087, 30 CFR Parts 227, 228, and 229, Delegation to States and Cooperative Activities with... auditing and investigative activities. • Request for cooperative agreement and subsequent requirements...-4410, Accounting for Comparison [Dual Accounting]. Form MMS-4393, Request to Exceed Regulatory...

  8. AcEST: BP913262 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 81 LIGGLKWNDNTVRISETLQRFAWRSSHENGRPSFPSKQKRKMERTIKPE 229 >tr|B1MSJ6|B1MSJ6_9INFA Nonstructural protein 1 OS=Influenza A virus (A/equi...ne/California/4537/1997(H3N8)) GN=NS1 PE=4 SV=1 Length =

  9. Local adaptations in bryophytes revisited: the genetic structure of the calcium-tolerant peatmoss Sphagnum warnstorfii along geographic and pH gradients

    Czech Academy of Sciences Publication Activity Database

    Mikulášková, E.; Hájek, Michal; Veleba, A.; Johnson, M. G.; Hájek, Tomáš; Shaw, J. A.

    2015-01-01

    Roč. 5, č. 1 (2015), s. 229-242 ISSN 2045-7758 R&D Projects: GA ČR GAP505/10/0638 Institutional support: RVO:67985939 Keywords : Calcium tolerance * hybridization * population structure Subject RIV: EH - Ecology, Behaviour Impact factor: 2.537, year: 2015

  10. Research Article Genome-wide association study for economic traits ...

    Indian Academy of Sciences (India)

    Aiqiang Lin

    kept in 4 °C. The PCR products were run on an 8% polyacrylamide gel electrophoresis. Fragments. 103 ..... research reveals a conserved role of phosphorylation of the N terminus of BORA for Plk1. 229 ..... J. Food Compos Anal. 33, 1-5. 359.

  11. The Adoption of Information Technology in the Sales Force’

    NARCIS (Netherlands)

    Schillewaert, N.; Ahearne, M.; Frambach, R.T.; Moenaert, R.

    2005-01-01

    The purpose of this article is to explain why salespeople adopt information technology. The results from a cross-sectional study of 229 salespeople indicate that putting sales technology to use strongly depends on salespeople's perceptions about the technology enhancing their performance, their

  12. Sinha, Dr Somdatta

    Indian Academy of Sciences (India)

    Specialization: Theoretical Biology, Complex Systems in Biology and Nonlinear Dynamics, and Computational Biology Address: Professor of Biology, Indian Institute of Science Education and Research, Sector 81, Knowledge City, Manauli P.O., Mohali, SAS Nagar 140 306, Punjab Contact: Office: (0172) 229 3166

  13. 9-tolline rannamortiir M1877. Ühe Narva Hermanni kindluse läänehoovis seisva suurtüki lugu / Ilja Davõdov

    Index Scriptorium Estoniae

    Davõdov, Ilja

    2016-01-01

    Mortiiri loomisloost. Mortiiride kasutamisest lahingutes. Peeter Suure merekindlusest. Tallinna maarinde suurtükiväest. Mortiiridest 1918-1920. aastate sõjasündmustes. Suurtükiväest Narva kaitseliinil. 229-mm rannamortiiridest Teises maailmasõjas. Mortiiripatareidest pärast Teist maailmasõda

  14. Methodology and applications of eyetracking

    Directory of Open Access Journals (Sweden)

    Arkadiusz Rajs

    2016-05-01

    Garbary 2,85-229 Bydgoszcz, jacek.gospodarczyk@byd.pl   Summary Eyetracking gives great capability of computer’s systems control and study of usability applications. In this paper we show construction of eyetracker and range of applications.   Key words: eyetracker, computer vision.

  15. 12 CFR 563d.3b-6 - Liability for certain statements by savings associations.

    Science.gov (United States)

    2010-01-01

    ... 229.303), management's discussion and analysis of financial condition and results of operations, or... financial items; (2) A statement of management's plans and objectives for future operations; (3) A statement of future economic performance contained in management's discussion and analysis of financial...

  16. Polysaccharides from Portulaca oleracea L Improve Exercise ...

    African Journals Online (AJOL)

    HP

    Tropical Journal of Pharmaceutical Research February 2014; 13 (2): 229-234 ... 7.51 ± 0.78 mmol/L) were significantly lower than that of the control group (11.39 ± 1.17 mmol/L) (p <. 0.05). .... Biological Engineering Institute (Nanjing, China).

  17. Diagnostic accuracy of a clinical diagnosis of idiopathic pulmonary fibrosis

    DEFF Research Database (Denmark)

    Walsh, Simon L. F.; Maher, Toby M.; Kolb, Martin

    2017-01-01

    -index.A total of 404 physicians completed the study. Agreement for IPF diagnosis was higher among expert physicians (κw=0.65, IQR 0.53-0.72, pmeetings (κw=0.54, IQR 0.45-0.64, p....0001). The prognostic accuracy of academic physicians with >20 years of experience (C-index=0.72, IQR 0.0-0.73, p=0.229) and non-university hospital physicians with more than 20 years of experience, attending weekly MDT meetings (C-index=0.72, IQR 0.70-0.72, p=0.052), did not differ significantly (p=0.229 and p=0.......052 respectively) from the expert panel (C-index=0.74 IQR 0.72-0.75).Experienced respiratory physicians at university-based institutions diagnose IPF with similar prognostic accuracy to IPF experts. Regular MDT meeting attendance improves the prognostic accuracy of experienced non-university practitioners...

  18. Purification, crystallization and preliminary crystallographic analysis of histone lysine demethylase NO66 from Homo sapiens

    International Nuclear Information System (INIS)

    Zhou, Xing; Tao, Yue; Wu, Minhao; Zhang, Dandan; Zang, Jianye

    2012-01-01

    The JmjC domain-containing histone demethylase NO66 from H. sapiens was overproduced in E. coli, purified and crystallized. Diffraction data were collected to 2.29 Å resolution. NO66 is a JmjC domain-containing histone demethylase with specificity towards histone H3 methylated on both Lys4 and Lys36 in vitro and in vivo. A fragment of NO66 lacking the N-terminal 167 amino-acid residues was overexpressed in Escherichia coli, purified and crystallized using the sitting-drop vapour-diffusion method. X-ray diffraction data were collected to a resolution of 2.29 Å. NO66 crystallized in space group P3 1 or P3 2 , with unit-cell parameters a = 89.35, b = 89.35, c = 304.86 Å, α = β = 90, γ = 120°, and the crystal is likely to contain four molecules in the asymmetric unit

  19. Methods of separating short half-life radionuclides from a mixture of radionuclides

    Science.gov (United States)

    Bray, Lane A.; Ryan, Jack L.

    1998-01-01

    The present invention is a method of obtaining a radionuclide product selected from the group consisting of .sup.223 Ra and .sup.225 Ac, from a radionuclide "cow" of .sup.227 Ac or .sup.229 Th respectively. The method comprises the steps of a) permitting ingrowth of at least one radionuclide daughter from said radionuclide "cow" forming an ingrown mixture; b) insuring that the ingrown mixture is a nitric acid ingrown mixture; c) passing the nitric acid ingrown mixture through a first nitrate form ion exchange column which permits separating the "cow" from at least one radionuclide daughter; d) insuring that the at least one radionuclide daughter contains the radionuclide product; e) passing the at least one radionuclide daughter through a second ion exchange column and separating the at least one radionuclide daughter from the radionuclide product and f) recycling the at least one radionuclide daughter by adding it to the "cow". In one embodiment the radionuclide "cow" is the .sup.227 Ac, the at least one daughter radionuclide is a .sup.227 Th and the product radionuclide is the .sup.223 Ra and the first nitrate form ion exchange column passes the .sup.227 Ac and retains the .sup.227 Th. In another embodiment the radionuclide "cow"is the .sup.229 Th, the at least one daughter radionuclide is a .sup.225 Ra and said product radionuclide is the .sup.225 Ac and the .sup.225 Ac and nitrate form ion exchange column retains the .sup.229 Th and passes the .sup.225 Ra/Ac.

  20. Isolation and Characterization of Current Human Coronavirus Strains in Primary Human Epithelial Cell Cultures Reveal Differences in Target Cell Tropism

    Science.gov (United States)

    Dijkman, Ronald; Jebbink, Maarten F.; Koekkoek, Sylvie M.; Deijs, Martin; Jónsdóttir, Hulda R.; Molenkamp, Richard; Ieven, Margareta; Goossens, Herman; Thiel, Volker

    2013-01-01

    The human airway epithelium (HAE) represents the entry port of many human respiratory viruses, including human coronaviruses (HCoVs). Nowadays, four HCoVs, HCoV-229E, HCoV-OC43, HCoV-HKU1, and HCoV-NL63, are known to be circulating worldwide, causing upper and lower respiratory tract infections in nonhospitalized and hospitalized children. Studies of the fundamental aspects of these HCoV infections at the primary entry port, such as cell tropism, are seriously hampered by the lack of a universal culture system or suitable animal models. To expand the knowledge on fundamental virus-host interactions for all four HCoVs at the site of primary infection, we used pseudostratified HAE cell cultures to isolate and characterize representative clinical HCoV strains directly from nasopharyngeal material. Ten contemporary isolates were obtained, representing HCoV-229E (n = 1), HCoV-NL63 (n = 1), HCoV-HKU1 (n = 4), and HCoV-OC43 (n = 4). For each strain, we analyzed the replication kinetics and progeny virus release on HAE cell cultures derived from different donors. Surprisingly, by visualizing HCoV infection by confocal microscopy, we observed that HCoV-229E employs a target cell tropism for nonciliated cells, whereas HCoV-OC43, HCoV-HKU1, and HCoV-NL63 all infect ciliated cells. Collectively, the data demonstrate that HAE cell cultures, which morphologically and functionally resemble human airways in vivo, represent a robust universal culture system for isolating and comparing all contemporary HCoV strains. PMID:23427150

Some links on this page may take you to non-federal websites. Their policies may differ from this site.