
Sample records for actinium 227

  1. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources. (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R


    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development.

  2. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes. (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E


    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Thorium and actinium polyphosphonate compounds as bone-seeking alpha particle-emitting agents. (United States)

    Henriksen, Gjermund; Bruland, Oyvind S; Larsen, Roy H


    The present study explores the use of alpha-particle-emitting, bone-seeking agents as candidates for targeted radiotherapy. Actinium and thorium 1,4,7,10 tetraazacyclododecane N,N',N'',N''' 1,4,7,10-tetra(methylene) phosphonic acid (DOTMP) and thorium-diethylene triamine N,N',N'' penta(methylene) phosphonic acid (DTMP) were prepared and their biodistribution evaluated in conventional Balb/C mice at four hours after injection. All three bone-seeking agents showed a high uptake in bone and a low uptake in soft tissues. Among the soft tissue organs, only kidney had a relatively high uptake. The femur/kidney ratios for 227Th-DTMP, 228-Ac-DOTMP and 227Th-DOTMP were 14.2, 7.6 and 6.0, respectively. A higher liver uptake of 228Ac-DOTMP was seen than for 227Th-DTMP and 227Th-DOTMP. This suggests that some demetallation of the 228Ac-DOTMP complex had occurred. The results indicate that 225Ac-DOTMP, 227Th-DOTMP and 227Th-DTMP have promising properties as potential therapeutic bone-seeking agents.

  4. Report for General Research September 18 to December 11, 1950 (Actinium Volume)

    Energy Technology Data Exchange (ETDEWEB)

    Haring, M.M.


    The purpose of the research work presented in this volume is to develop a process for the separation and purification of actinium-227 produced by neutron bombardment of radium-226 and to develop methods by which uniform films of actinium metal may be deposited on metallic surfaces. The design work on the cave structure and mechanical equipment used in the actinium separation is proceeding on schedule. As the mechanical design phase is nearing completion the emphasis is being directed toward processing equipment. The process as well as the mechanical equipment has been adapted from the research work of F. T. Hagemann and the Remote Control Group at Argonne National Laboratory. Consequently, one of the first objectives is to become familiary with the chemistry of the process and the operation of the mechanical equipment. Cold runs have been made on the T.T.A. benzene extraction using lanthanum and barium in place of actinium and radium. No difficulty with the operation was observed. The formation of precipitates was one of the difficulties encountered with the process as the precipitates carry radium. It has been found that metals such as nickel cause these precipitates to form and should, therefore, be avoided in the construction of equipment. it was also found that a T.T.A. solution exposed to 0.5 curie of polonium over a period of days develops a precipitate. Some new mechanical features hav eshown promise. The use of copper-coated glassware which will hold together even though the glass is cracked has made it possible to replace custom-built heaters with standard heating mantles. A new graphite, silicone grease mixture appears to hold up in stopcocks handling benzene and, as a result, may eliminate the necessary of entering the cave for regreasing. Tests on the preparation of dense concrete have given results which meet the shielding requirements for the cave. A strippable paint and tape combination has been studied and specified to provide for decontamination of

  5. Spectroscopic and computational investigation of actinium coordination chemistry (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1- ligands (3.2+/-1.1) than AmIII (0.8+/-0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour.

  6. Spectroscopic and computational investigation of actinium coordination chemistry (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac–Cl and Ac–OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1– ligands (3.2±1.1) than AmIII (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour. PMID:27531582

  7. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    CERN Document Server

    Fry, C


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  8. Relativistic small-core pseudopotentials for actinium, thorium, and protactinium. (United States)

    Weigand, Anna; Cao, Xiaoyan; Hangele, Tim; Dolg, Michael


    Small-core pseudopotentials for actinium, thorium, and protactinium have been energy-adjusted to multiconfiguration Dirac-Hartree-Fock reference data based on the Dirac-Coulomb-Breit Hamiltonian and the Fermi nucleus model. Corresponding optimized valence basis sets of polarized valence quadruple-ζ quality are presented. Atomic test calculations for the first four ionization potentials show satisfactory results at both the Hartree-Fock and the multireference averaged coupled-pair functional level. Highly correlated Fock-space coupled cluster calculations demonstrate that the new pseudopotentials yield ionization potentials, which are in excellent agreement with corresponding all-electron results and experimental data. The pseudopotentials and basis sets supplement a similar set previously published for uranium.

  9. Effects of spin-orbit coupling on actinium under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Rubio-Ponce, A.; Rivera, J. [Departamento de Ciencias Basicas, Universidad Autonoma Metropolitana-Azcapotzalco, Mexico (Mexico); Olguin, D. [Departamento de Fi sica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Mexico (Mexico)


    Actinium (Ac) is a radioactive metal and the first element of the actinide series. At ambient conditions Ac crystallizes in the fcc lattice, however, up to date its phase diagram is unknown. In the present work, we have studied the structural and electronic properties of Ac under hydrostatic pressure assuming the fcc structure as well as three hypothetical structures, namely the hcp, bcc, and sc, and for pressures up to 100 GPa. From our calculations, we found only one structural transition allowed, from the fcc to hcp, our calculated pressure was 39.85 GPa. The calculations were performed by means of the full potential linearized augmented plane wave (FLAPW) method and the generalized gradient approximation (GGA) for the exchange-correlation energy, where we have included in our study the spin-orbit coupling which is important for heavy elements. The total energy results were fitted to the third order Birch-Murnaghan's equation of state. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Proposition 227: What Now? (United States)

    Ward, Ben


    Provides background on and discusses the significance of Proposition 227, the California ballot initiative designed to reform the state's bilingual-education program that was approved by voters in 1998. Reactions to its approval by California voters are provided by Ron Unz, Stephen Krashen, and Mauro Mujica. (Author/VWL)

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  13. AAS 227: Day 1 (United States)

    Kohler, Susanna


    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

  14. AAS 227: Day 3 (United States)

    Kohler, Susanna


    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

  15. AAS 227: Day 4 (United States)

    Kohler, Susanna


    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  16. AAS 227: Day 2 (United States)

    Kohler, Susanna


    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  17. AAS 227: Welcome! (United States)

    Kohler, Susanna


    Greetings from the 227th American Astronomical Society meeting in Kissimmee, Florida! This week, along with several fellow authors from astrobites, Iwill bewritingupdates on selectedevents at themeeting and posting at the end of each day. You can follow along here or, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.If youre an author or referee (or plan to be!) and youre here at the meeting, consider joining us at our Author and Referee Workshop on Wednesday in the Tallahassee room, where well be sharingsome of the exciting new features of the AAS journals. You can drop intoeither of the two-hour sessions(10 AM 12 PM or 1 PM 3 PM), and there will be afree buffet lunch at noon.Heres the agenda:Morning SessionTopic Speaker10:00 am 10:05 amIntroductionsJulie Steffen10:05 am 10:35 amChanges at AAS Journals; How to Be a Successful AAS AuthorEthan Vishniac10:35 am 11:00 amThe Peer Review ProcessButler Burton11:00 am 11:15 amAAS Nova: Sharing AAS Authors Research with the Broader CommunitySusanna Kohler11:15 am 11:30 amFixing Software and Instrumentation Publishing: New Paper Styles in AAS JournalsChris Lintott11:30 am 11:45 amMaking Article Writing Easier with the New AASTeX v6.0Greg Schwarz11:45 am 12:00 pmBringing JavaScript and Interactivity to Your AAS Journal FiguresGus MuenchLunch SessionTopic Speaker12:00 pm 12:15 pmUnified Astronomy ThesaurusKatie Frey12:15 pm 12:30 pmAAS/ADS ORCID Integration ToolAlberto Accomazzi12:30 pm 12:45 pmWorldWide Telescope and Video AbstractsJosh Peek12:45 pm 01:00 pmArizona Astronomical Data Hub (AADH)Bryan HeidornAfternoon SessionTopic Speaker01:00 pm 01:05 pmIntroductionsJulie Steffen01:05 pm 01:35 pmChanges at AAS Journals; How to Be a Successful AAS AuthorEthan Vishniac01:35 pm 02:00 pmThe Peer Review ProcessButler Burton02:00 pm 02:15 pmAAS Nova: Sharing AAS Authors Research with the Broader CommunitySusanna Kohler02:15 pm 02:30 pm

  18. 7 CFR 227.5 - Program funding. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program funding. 227.5 Section 227.5 Agriculture... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.5 Program funding. (a... agencies shall maintain their present level of funding for existing nutrition education and...

  19. 50 CFR 600.227 - Lobbying. (United States)


    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Lobbying. 600.227 Section 600.227 Wildlife..., DEPARTMENT OF COMMERCE MAGNUSON-STEVENS ACT PROVISIONS Council Membership § 600.227 Lobbying. (a) Council... Commerce implementing regulations published at 15 CFR part 28, “New Restrictions on Lobbying.”...

  20. 25 CFR 227.23 - Wells. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Wells. 227.23 Section 227.23 Indians BUREAU OF INDIAN... RESERVATION, WYOMING, FOR OIL AND GAS MINING Operations § 227.23 Wells. The lessee shall agree (a) to drill and produce all wells necessary to offset or protect the leased land from drainage by wells...

  1. 49 CFR 238.227 - Suspension system. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Suspension system. 238.227 Section 238.227 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.227 Suspension system. On or after November 8, 1999— (a) All passenger equipment...

  2. 33 CFR 136.227 - Proof. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Proof. 136.227 Section 136.227 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION... SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.227 Proof. In addition to...

  3. 7 CFR 227.3 - Administration. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 227.3 Section 227.3 Agriculture... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program....

  4. The release of dissolved actinium to the ocean: A global comparison of different end-members (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.


    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry

  5. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  6. 36 CFR 223.227 - Sale advertisement. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale advertisement. 223.227... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.227 Sale advertisement. (a) The Forest Service shall advertise any special forest products sales with an appraised...

  7. 27 CFR 44.227 - Customs procedure. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Customs procedure. 44.227..., WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Drawback of Tax § 44.227 Customs procedure. The customs... having inspected the articles and supervised the lading thereof on the export carrier, the...

  8. 49 CFR 227.115 - Hearing protectors. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing protectors. 227.115 Section 227.115 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad...

  9. 30 CFR 22.7 - Specific requirements. (United States)


    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Specific requirements. 22.7 Section 22.7 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND... on a wood floor from a height of 3 feet. Parts that are strapped to the user may be subjected to...

  10. 7 CFR 1280.227 - Confidentiality. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidentiality. 1280.227 Section 1280.227 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidentiality. All information obtained from books, records, or reports under the Act, this subpart, and the...

  11. 40 CFR 227.4 - Criteria for evaluating environmental impact. (United States)


    ... impact. 227.4 Section 227.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN... Impact § 227.4 Criteria for evaluating environmental impact. This subpart B sets specific environmental... of direct environmental impact. ...

  12. Dicty_cDB: SFA227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFA227 (Link to dictyBase) - - - Contig-U16368-1 SFA227P (Link... to Original site) SFA227F 327 SFA227Z 592 SFA227P 919 - - Show SFA227 Library SF (Link to library) Clone ID SFA227 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict... Acid sequence PPRPPVDQCRNQHCPHGYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVC VRNYVPPHPPPPPQICGSVNCGPGYICTIING...rsilclk *csiiisfkfsciisckxrk Frame C: PPRPPVDQCRNQHCPHGYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVC VRNYVPPHPPPPPQICGSVNCGPGYICT

  13. Dicty_cDB: VHI227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI227 (Link to dictyBase) - - - Contig-U16260-1 VHI227P (Link to Original site) VHI2...27F 617 VHI227Z 710 VHI227P 1307 - - Show VHI227 Library VH (Link to library) Clone ID VHI2...e URL Representative seq. ID VHI2...27P (Link to Original site) Representative DNA sequence >VHI227 (VHI227Q) /CSM/VH/VHI2-B/VHI2...DNA clone:ddv63k21, 3' ... 1382 0.0 1 ( BJ446797 ) Dictyostelium discoideum cDNA clone:ddv63i24, 3' ... 1382

  14. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  15. 25 CFR 227.19 - Division orders. (United States)


    ... INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF CERTAIN LANDS IN WIND RIVER INDIAN RESERVATION, WYOMING, FOR OIL AND GAS MINING Rents and Royalties § 227.19 Division orders. (a... it to the supervisor for his consideration. The right is reserved for the supervisor to cancel...

  16. 40 CFR 227.22 - Assessment of impact. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Assessment of impact. 227.22 Section 227.22 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA... Dumping on Other Uses of the Ocean § 227.22 Assessment of impact. The assessment of impact on other uses...

  17. 48 CFR 2453.227 - Patents, data, and copyrights. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Patents, data, and copyrights. 2453.227 Section 2453.227 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.227 Patents, data, and copyrights....

  18. 48 CFR 252.227-7004 - License grant. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License grant. 252.227... Clauses 252.227-7004 License grant. As prescribed at 227.7009-3(a), insert the following clause in patent releases, license agreements, and assignments: License Grant (AUG 1984) (a) The Contractor hereby grants...

  19. 48 CFR 252.227-7005 - License term. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License term. 252.227-7005... Clauses 252.227-7005 License term. As prescribed at 227.7009-3(b), insert one of the following clauses in patent releases, license agreements, and assignments: License Term (OCT 2001) Alternate I (AUG 1984)....

  20. 48 CFR 227.7103-6 - Contract clauses. (United States)


    ... technical data to the Government. Do not use the clause when the only deliverable items are computer software or computer software documentation (see 227.72), commercial items (see 227.7102-3), existing works...-engineer and construction contracts. (b)(1) Use the clause at 252.227-7013 with its Alternate I in research...

  1. 34 CFR 300.227 - Direct services by the SEA. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Direct services by the SEA. 300.227 Section 300.227... CHILDREN WITH DISABILITIES Local Educational Agency Eligibility § 300.227 Direct services by the SEA. (a) General. (1) An SEA must use the payments that would otherwise have been available to an LEA or to a...

  2. 48 CFR 1552.227-76 - Project employee confidentiality agreement. (United States)


    ... confidentiality agreement. 1552.227-76 Section 1552.227-76 Federal Acquisition Regulations System ENVIRONMENTAL... Clauses 1552.227-76 Project employee confidentiality agreement. As prescribed in 1527.409, insert the following clause: Project Employee Confidentiality Agreement (MAY 1994) (a) The Contractor recognizes that...

  3. 22 CFR Appendix A to Part 227 - Certification Regarding Lobbying (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certification Regarding Lobbying A Appendix A to Part 227 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NEW RESTRICTIONS ON LOBBYING Pt. 227, App. A Appendix A to Part 227—Certification Regarding Lobbying Certification for...

  4. 25 CFR 227.6 - Corporations and corporate information. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Corporations and corporate information. 227.6 Section 227... § 227.6 Corporations and corporate information. (a) If the applicant for a lease is a corporation, it... the lands are located, evidence showing compliance with the corporation laws thereof. Statements...

  5. Production of actinium, thorium and radium isotopes from natural thorium irradiated with protons up to 141 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Ermolaev, S.V.; Zhuikov, B.L.; Kokhanyuk, V.M.; Matushko, V.L. [Russian Academy of Sciences, Moscow (Russian Federation). Inst. of Nuclear Research; Kalmykov, S.N. [Lomonosov Moscow State Univ., Moscow (Russian Federation). Chemistry Dept.; Aliev, R.A. [Lomonosov Moscow State Univ., Moscow (Russian Federation). Skobeltsyn Inst. of Nuclear Physics; Tananaev, I.G.; Myasoedov, B.F. [Russian Academy of Sciences, Moscow (Russian Federation). A.N. Frumkin Inst. of Physical Chemistry and Electrochemistry


    Cross sections of {sup 225}Ac, {sup 227}Ac, {sup 227}Th and {sup 228}Th in thorium-232 targets irradiated with protons in the energy range 21-141 MeV have been measured. Based on these data, production yields of {sup 225}Ac and {sup 223}Ra in thick thorium targets have been calculated. It is possible to produce in proton energy range 60-140 MeV about 96 GBq (2.6 Ci) {sup 225}Ac per 10-d irradiation with 100 {mu}A proton beam current and 10-d decay, and much higher amount of {sup 223}Ra. The impurities of {sup 227}Ac and {sup 224}Ra are important and need to be assessed for further medical applications. (orig.)

  6. Danish Media coverage of 22/7

    DEFF Research Database (Denmark)

    Hervik, Peter; Boisen, Sophie


    When the two terrorist attacks in Norway took place and the identity of terrorist, Anders Behring Breivik (ABB) was revealed, attention turned to his network relations and shared ideas with Danish radical right wing communities, including the Danish People’s Party. In this article, we focus on ABB...... positions that have little to do with the event 22/7. Instead, they have everything to do with an attempt to contain domestic adversaries, if not enemies, such as “multiculturalists” and feminists, who were fiercely attacked by rightwingers, while left-wingers saw the radical right wing as the real enemy...

  7. Canadair CL-227 Remotely Piloted Vehicle (United States)

    Clark, Andrew S.


    The Canadair CL-227 is a rotary winged Remotely Piloted Vehicle (RPV) intended initially as the air-vehicle for a medium range battlefield surveillance and target acquisition system. The concept on which this vehicle is based brings together in-house expertise as a designer and manufacturer of surveillance drones (AN-USD-50l -MIDGE-) with experience in rigid rotor technology from the CL-84 tilt wing VTOL program. The vehicle is essentially modular in design with a power module containing the engine, fuel and related systems, a rotor module containing the two counter-rotating rotors and control actuators, and a control module containing the autopilot, data link and sensor system. The vehicle is a true RPV (as opposed to a drone) as it is flown in real time by an operator on the ground and requires relatively little skill to pilot.

  8. 48 CFR 227.7102-2 - Rights in technical data. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in technical data... Technical Data 227.7102-2 Rights in technical data. (a) The clause at 252.227-7015, Technical Data—Commercial Items, provides the Government specific license rights in technical data pertaining to commercial...

  9. 22 CFR 227.600 - Semi-annual compilation. (United States)


    ... Relations of the Senate and the Committee on Foreign Affairs of the House of Representatives or the... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Semi-annual compilation. 227.600 Section 227.600 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NEW RESTRICTIONS ON LOBBYING Agency Reports...

  10. 12 CFR 22.7 - Forced placement of flood insurance. (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Forced placement of flood insurance. 22.7... HAVING SPECIAL FLOOD HAZARDS § 22.7 Forced placement of flood insurance. If a bank, or a servicer acting... or mobile home and any personal property securing the designated loan is not covered by...

  11. 48 CFR 52.227-3 - Patent Indemnity. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patent Indemnity. 52.227-3... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.227-3 Patent Indemnity. As prescribed in 27.201-2(c)(1), insert the following clause: Patent Indemnity (APR 1984) (a)...

  12. 48 CFR 227.7203-4 - License rights. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License rights. 227.7203-4... Software and Computer Software Documentation 227.7203-4 License rights. (a) Grant of license. The... license, under an irrevocable license granted or obtained by the contractor which developed the...

  13. 48 CFR 227.7103-4 - License rights. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License rights. 227.7103-4... 227.7103-4 License rights. (a) Grant of license. The Government obtains rights in technical data, including a copyright license, under and irrevocable license granted or obtained for the Government by...

  14. 14 CFR 125.227 - Cockpit voice recorders. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cockpit voice recorders. 125.227 Section... Requirements § 125.227 Cockpit voice recorders. (a) No certificate holder may operate a large turbine engine... cockpit voice recorder is installed in that airplane and is operated continuously from the start of...

  15. 12 CFR 227.25 - Unfair balance computation method. (United States)


    ... under 12 CFR 226.12 or 12 CFR 226.13; or (2) Adjustments to finance charges as a result of the return of... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Unfair balance computation method. 227.25... Practices Rule § 227.25 Unfair balance computation method. (a) General rule. Except as provided in...

  16. 25 CFR 227.12 - Mineral reserves in nonmineral entries. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Mineral reserves in nonmineral entries. 227.12 Section 227.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF CERTAIN LANDS IN WIND RIVER INDIAN RESERVATION, WYOMING, FOR OIL AND GAS MINING How to Acquire...

  17. 20 CFR 227.2 - Initial supplemental annuity rate. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Initial supplemental annuity rate. 227.2... COMPUTING SUPPLEMENTAL ANNUITIES § 227.2 Initial supplemental annuity rate. The supplemental annuity rate, before reduction for the railroad retirement family maximum or any private pension, is $23 for...

  18. 20 CFR 227.4 - Reduction for employer pension. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Reduction for employer pension. 227.4 Section... COMPUTING SUPPLEMENTAL ANNUITIES § 227.4 Reduction for employer pension. (a) General. The supplemental annuity for each month is reduced by the amount of any private pension the employee is receiving for that...

  19. 42 CFR 93.227 - Secretary or HHS. (United States)



  20. 25 CFR 227.22 - Diligence and prevention of waste. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Diligence and prevention of waste. 227.22 Section 227.22... prevention of waste. The lessee shall exercise diligence in drilling and operating wells for oil and gas on... prevention of waste of oil or gas developed on the land, or the entrance of water through wells drilled...

  1. 13 CFR 134.227 - Finality of decisions. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Finality of decisions. 134.227 Section 134.227 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... decisions. (a) Initial decisions. Except as otherwise provided in paragraph (b) of this section, a...

  2. 7 CFR 227.43 - Participation of adults. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Participation of adults. 227.43 Section 227.43 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM Miscellaneous §...

  3. 48 CFR 227.7203-5 - Government rights. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Government rights. 227..., DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Computer Software and Computer Software Documentation 227.7203-5 Government rights. The standard license rights...

  4. 48 CFR 1952.227-77 - Rights in shop drawings. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Rights in shop drawings. 1952.227-77 Section 1952.227-77 Federal Acquisition Regulations System BROADCASTING BOARD OF GOVERNORS... Rights in shop drawings. As prescribed in 1927.405(h), insert the following clause: Rights in...

  5. Research on Transport Properties of HFC-227ea

    Institute of Scientific and Technical Information of China (English)

    Lin Shi; Xiaojun Liu; Yuanyuan Duan; Lizhong Han; Mingshan Zhu


    HFC-227ea(1,1,1,2,3,3,3-heptafluoropropane) is considered as a promising refrigerant alternative, especially as a component in mixtures, to replace to CFC-12, HCFC-22 and R502. But reliable transport properties data for HFC-227ea are very limited. In this paper, experimental data of viscosity along the saturation line and gaseous thermal conductivity of HFC-227ea are given. The viscosity of HFC-227ea was measured with a capillary viscometer at temperatures between 263.15 K and 333.15 K along the saturation line and its uncertainty of the results is estimated to be no more than +3%. The thermal conductivity of gaseous HFC-227ea was also measured with a transient hot-wire instrument at temperatures between 259.28 K and 341.75 K and pressures up to 1.289MPa, and its uncertainty of the results is estimated to be less than +1%.

  6. 49 CFR 227.117 - Hearing protector attenuation. (United States)


    ... exposure to an 8-hour TWA of 90 decibels or lower, as required by § 227.115. (c) For employees who have...-weighted average of 85 decibels or lower. (d) The adequacy of hearing protector attenuation shall be...

  7. 40 CFR 227.19 - Assessment of impact. (United States)


    ... Dumping on Esthetic, Recreational and Economic Values § 227.19 Assessment of impact. An overall assessment... on the effect on esthetic, recreational and economic values based on the factors set forth in this... profitability of other commercial enterprises....

  8. 18 CFR 284.227 - Certain transportation by intrastate pipelines. (United States)


    ... Interstate Pipelines on Behalf of Others and Services by Local Distribution Companies § 284.227 Certain... interstate pipeline or local distribution company served by an interstate pipeline. (e) Pregrant...

  9. 48 CFR 227.7206 - Contracts for architect-engineer services. (United States)


    ... Rights in Computer Software and Computer Software Documentation 227.7206 Contracts for architect-engineer services. Follow 227.7107 when contracting for architect-engineer services. ...-engineer services. 227.7206 Section 227.7206 Federal Acquisition Regulations System DEFENSE ACQUISITION...

  10. 48 CFR 227.7103-2 - Acquisition of technical data. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition of technical... Rights in Technical Data 227.7103-2 Acquisition of technical data. (a) Contracting officers shall work... personnel are responsible for identifying the Government's minimum needs for technical data. Data needs must...

  11. 40 CFR 227.30 - High-level radioactive waste. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-level radioactive waste. 227.30...-level radioactive waste. High-level radioactive waste means the aqueous waste resulting from the operation of the first cycle solvent extraction system, or equivalent, and the concentrated waste from...

  12. 50 CFR 665.227 - Allowable gear and gear restrictions. (United States)


    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.227 Allowable gear and gear restrictions. (a) Hawaii coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun;...

  13. 48 CFR 1852.227-84 - Patent rights clauses. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Patent rights clauses. 1852... 1852.227-84 Patent rights clauses. The contracting officer shall insert the following provision as prescribed in 1827.303-70(e): Patent Rights Clauses (DEC 1989) This solicitation contains the patent...

  14. 48 CFR 3452.227-72 - Advertising of awards. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Advertising of awards... Clauses 3452.227-72 Advertising of awards. As prescribed in 3427.472, insert the following clause in all solicitations and contracts other than purchase orders: Advertising of Awards (AUG 1987) The contractor...

  15. 48 CFR 1852.227-70 - New technology. (United States)


    ... organization, as used in this clause, means a domestic university or other institution of higher education or... case of a composition or product; to practice, in the case of a process or method; or to operate, in... experimental, developmental, or research work; and (ii) Include the clause at FAR 52.227-11 (suitably...

  16. 7 CFR 227.35 - Responsibilities of State coordinator. (United States)


    ... 227.35 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Coordinator... implementation of the State Plan, (f) Coordination of the Program with the Child Nutrition Programs at the...

  17. 49 CFR 227.113 - Noise operational controls. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating Employees. § 227.113 Noise operational controls. (a) Railroads may use noise operational controls at any sound level to reduce exposures to levels below those required by Table A-1 of appendix A...

  18. 49 CFR 227.107 - Hearing conservation program. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating Employees. § 227.107 Hearing conservation program. (a) Consistent with the requirements of the... exposure shall be computed in accordance with the tables in appendix A of this part, and without regard...

  19. 49 CFR 227.111 - Audiometric test requirements. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating Employees. § 227.111 Audiometric test requirements. (a) Audiometric tests shall be pure tone, air... with 5 U.S.C. 552(a) and 1 CFR part 51. You may obtain a copy of the incorporated standard from...

  20. 49 CFR 234.227 - Train detection apparatus. (United States)


    ..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.227 Train detection apparatus. (a) Train detection apparatus shall be maintained to detect a train or railcar in any part of a train detection circuit,...

  1. 20 CFR 227.5 - Employer tax credits. (United States)


    ... SUPPLEMENTAL ANNUITIES § 227.5 Employer tax credits. Employers are entitled to tax credits if they pay non-negotiated pensions to former employees whose supplemental annuities are reduced because of the pensions. Non-negotiated pensions are paid under pension plans that are not established by collective bargaining...

  2. 49 CFR 227.101 - Scope and applicability. (United States)


    ..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating Employees. § 227.101 Scope and applicability. (a) This subpart shall apply to the noise-related working... service laws governing “train employees” (see 49 U.S.C. 21101(5) and 21103), but, subject to a...

  3. 40 CFR 227.31 - Applicable marine water quality criteria. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicable marine water quality... § 227.31 Applicable marine water quality criteria. Applicable marine water quality criteria means the criteria given for marine waters in the EPA publication “Quality Criteria for Water” as published in 1976...

  4. 48 CFR 1952.227-76 - Government rights (unlimited). (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government rights... 1952.227-76 Government rights (unlimited). As prescribed in 1927.405(g), insert the following clause: Government Rights (Unlimited) (FEB 1985) The Government shall have unlimited rights, in all drawings,...

  5. 40 CFR 227.27 - Limiting permissible con-cen-tra-tion (LPC). (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Limiting permissible con-cen-tra-tion (LPC). 227.27 Section 227.27 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Definitions § 227.27 Limiting permissible con-cen-tra-tion (LPC). (a) The limiting permissible concentration...

  6. 48 CFR 227.7104 - Contracts under the Small Business Innovation Research (SBIR) Program. (United States)


    ... Business Innovation Research (SBIR) Program. 227.7104 Section 227.7104 Federal Acquisition Regulations... Data and Computer Software—Small Business Innovation Research (SBIR) Program, when technical data or... PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7104 Contracts under the Small...

  7. 40 CFR 227.32 - Liquid, suspended particulate, and solid phases of a material. (United States)


    ... MATERIALS Definitions § 227.32 Liquid, suspended particulate, and solid phases of a material. (a) For the... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Liquid, suspended particulate, and solid phases of a material. 227.32 Section 227.32 Protection of Environment ENVIRONMENTAL...

  8. 48 CFR 1852.227-71 - Requests for waiver of rights to inventions. (United States)


    ... rights to inventions. 1852.227-71 Section 1852.227-71 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.227-71 Requests for waiver of rights to inventions. As prescribed in 1827.30-70(c... Technology: Requests for Waiver of Rights to Inventions (APR 1984) (a) In accordance with the NASA Patent...

  9. 30 CFR 227.301 - What are a State's responsibilities if it performs audits? (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What are a State's responsibilities if it performs audits? 227.301 Section 227.301 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... Functions § 227.301 What are a State's responsibilities if it performs audits? If you perform audits...

  10. 40 CFR 227.16 - Basis for determination of need for ocean dumping. (United States)


    ... ocean dumping. 227.16 Section 227.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Need for Ocean Dumping § 227.16 Basis for determination of need for ocean dumping. (a) A need for...

  11. 48 CFR 227.7103-12 - Government right to establish conformity of markings. (United States)


    ... establish conformity of markings. 227.7103-12 Section 227.7103-12 Federal Acquisition Regulations System..., DATA, AND COPYRIGHTS Rights in Technical Data 227.7103-12 Government right to establish conformity of... correct the nonconformity and return the corrected data within 60 days following the person's receipt...

  12. 22 CFR Appendix B to Part 227 - Disclosure Form To Report Lobbying (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disclosure Form To Report Lobbying B Appendix B to Part 227 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NEW RESTRICTIONS ON LOBBYING Pt. 227, App. B Appendix B to Part 227—Disclosure Form To Report Lobbying EC06OC91.012...

  13. 40 CFR 227.10 - Hazards to fishing, navigation, shorelines or beaches. (United States)


    ..., shorelines or beaches. 227.10 Section 227.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Environmental Impact § 227.10 Hazards to fishing, navigation, shorelines or beaches. (a) Wastes which may... present a hazard to shorelines or beaches may be dumped only at sites and under conditions which...

  14. 48 CFR 52.227-10 - Filing of Patent Applications-Classified Subject Matter. (United States)


    ... Applications-Classified Subject Matter. 52.227-10 Section 52.227-10 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.227-10 Filing of Patent Applications—Classified Subject Matter. As prescribed at 27.203-2, insert the following clause: Filing of Patent Applications—Classified Subject...

  15. 28 CFR 2.27 - Petition for reconsideration of original jurisdiction decisions. (United States)


    ... jurisdiction decisions. 2.27 Section 2.27 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.27 Petition for reconsideration of original jurisdiction decisions. (a) A...

  16. 48 CFR 1852.227-14 - Rights in data-General. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Rights in data-General. 1852.227-14 Section 1852.227-14 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE... 1852.227-14 Rights in data—General. As prescribed in 1827.409(a), add the following subparagraph (3)...

  17. What Shaped Elias 2-27's Disk? (United States)

    Kohler, Susanna


    The young star Elias 2-27 is surrounded by a massive disk with spectacular spiral arms. A team of scientists from University of Cambridges Institute of Astronomy has now examined what might cause this disks appearance.Top: ALMA 1.3-mm observations of Elias 2-27s spiral arms, processed with an unsharp masking filter. Two symmetric spiral arms, a bright inner ellipse, and two dark crescents are clearly visible. Bottom: a deprojection of the top image (i.e., what the system would look like face-on). [Meru et al. 2017]ALMA-Imaged Spiral ArmsWith the dawn of new telescopes such as the Atacama Large Millimeter/submillimeter Array, were now able to study the birth of young stars and their newly forming planetary systems in more detail than ever before. But these new images require new models and interpretations!Case in point: Elias 2-27 is a low-mass star thats only a million years old and is surrounded by an unusually massive disk of gas and dust. Recent spatially-resolved ALMA observations of Elias 2-27 have revealed the stunning structure of the stars disk: it contains two enormous, symmetric spiral arms, as well as additional features interior to the spirals.What caused the disk to develop this structure? Led by Farzana Meru, a group of Institute of Astronomy researchers has run a series of simulations that explore different ways that Elias 2-27s disk might have evolved into the shape we see today.Modeling a DiskMeru and collaborators performed a total of 72 three-dimensional smoothed particle hydrodynamics simulations tracking 250,000 gas particles in a model disk around a star like Elias 2-27. They then modeled the transfer of energy through these simulated disks and produced synthetic ALMA observations based on the outcomes.Left: Synthetic ALMA observations of disks shaped by an internal companion (top), an external companion (middle), and gravitational instability within the disk (bottom). Right: Deprojections of the images on the left. Scales are the same as in

  18. 7 CFR Appendix to Part 227 - Apportionment of Funds for Nutrition Education and Training (United States)


    ... PROGRAM Pt. 227, App. Appendix to Part 227—Apportionment of Funds for Nutrition Education and Training...,551 6,307 390,237 New Mexico 108,673 5,448 235 2,619 116,975 Oklahoma 229,166 3,969 1,916 8,639 243...

  19. 25 CFR 227.14 - Government reserves right to purchase oil and gas. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Government reserves right to purchase oil and gas. 227.14... CERTAIN LANDS IN WIND RIVER INDIAN RESERVATION, WYOMING, FOR OIL AND GAS MINING How to Acquire Leases § 227.14 Government reserves right to purchase oil and gas. In time of war or other public emergency...

  20. 48 CFR 252.227-7012 - Patent license and release contract. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent license and release... of Provisions And Clauses 252.227-7012 Patent license and release contract. As prescribed at 227.7012, insert the following clause in patent releases, license agreements, and assignments: (Contract...

  1. 48 CFR 252.227-7039 - Patents-reporting of subject inventions. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patents-reporting of... CLAUSES Text of Provisions And Clauses 252.227-7039 Patents—reporting of subject inventions. As prescribed in 227.303(1), use the following clause: Patents—Reporting of Subject Inventions (APR 1990)...

  2. 48 CFR 252.227-7014 - Rights in noncommercial computer software and noncommercial computer software documentation. (United States)


    ... container and each page, or portions thereof, of printed material containing computer software for which... computer software and noncommercial computer software documentation. 252.227-7014 Section 252.227-7014... Rights in noncommercial computer software and noncommercial computer software documentation....

  3. 25 CFR 227.10 - Minerals other than oil and gas. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Minerals other than oil and gas. 227.10 Section 227.10... Minerals other than oil and gas. Unreserved, unwithdrawn, and unallotted lands which have not been leased... therefor, are subject to mineral application or mineral entry, for minerals other than oil and gas,...

  4. 7 CFR 227.37 - State plan for nutrition education and training. (United States)


    ...) Plans, including a timetable, for reaching all children in the State with instruction in the nutritional... 7 Agriculture 4 2010-01-01 2010-01-01 false State plan for nutrition education and training. 227... PROGRAM State Coordinator Provisions § 227.37 State plan for nutrition education and training. (a)...

  5. 48 CFR 227.7203-12 - Government right to establish conformity of markings. (United States)


    ... establish conformity of markings. 227.7203-12 Section 227.7203-12 Federal Acquisition Regulations System... Government right to establish conformity of markings. (a) Nonconforming markings. (1) Authorized markings are... expense. If that person fails to correct the nonconformity and return the corrected software...

  6. 30 CFR 227.108 - How will MMS notify a State of its decision? (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will MMS notify a State of its decision? 227.108 Section 227.108 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... of its decision? MMS will notify you in writing of its decision on your delegation proposal. If...

  7. 48 CFR 952.227-84 - Notice of right to request patent waiver. (United States)


    ... patent waiver. 952.227-84 Section 952.227-84 Federal Acquisition Regulations System DEPARTMENT OF ENERGY... Notice of right to request patent waiver. Include this provision in all appropriate solicitations in accordance with 48 CFR 927.409(t). Right To Request Patent Waiver (FEB 1998) Offerors have the right to...

  8. 48 CFR 227.7009-3 - Additional clauses-contracts except running royalty contracts. (United States)


    ...-contracts except running royalty contracts. 227.7009-3 Section 227.7009-3 Federal Acquisition Regulations...—contracts except running royalty contracts. The following clauses are examples for use in patent release and settlement agreements, and license agreements not providing for payment by the Government of a...

  9. 48 CFR 252.227-7006 - License grant-running royalty. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License grant-running... of Provisions And Clauses 252.227-7006 License grant—running royalty. As prescribed at 227.7009-4(a...—Running Royalty (AUG 1984) (a) The Contractor hereby grants to the Government, as represented by...

  10. 48 CFR 252.227-7007 - License term-running royalty. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License term-running... of Provisions And Clauses 252.227-7007 License term—running royalty. As prescribed at 227.7009-4(b), insert the following clause in patent releases, license agreements, and assignments: License...

  11. 48 CFR 227.7202 - Commercial computer software and commercial computer software documentation. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Commercial computer software and commercial computer software documentation. 227.7202 Section 227.7202 Federal Acquisition... REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Computer Software and Computer Software Documentation...

  12. 30 CFR 227.401 - What are a State's responsibilities if it processes production reports or royalty reports? (United States)


    ... processes production reports or royalty reports? 227.401 Section 227.401 Mineral Resources MINERALS...' Responsibilities to Perform Delegated Functions § 227.401 What are a State's responsibilities if it processes production reports or royalty reports? In processing production reports or royalty reports you must:...

  13. 40 CFR 227.14 - Criteria for evaluating the need for ocean dumping and alternatives to ocean dumping. (United States)


    ... ocean dumping and alternatives to ocean dumping. 227.14 Section 227.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Need for Ocean Dumping § 227.14 Criteria for evaluating the need for...

  14. 27 CFR 70.227 - Suspension of running of period of limitation; wrongful seizure of property of third party. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Suspension of running of period of limitation; wrongful seizure of property of third party. 70.227 Section 70.227 Alcohol, Tobacco... Limitations § 70.227 Suspension of running of period of limitation; wrongful seizure of property of third...

  15. In vivo detection of prion amyloid plaques using [{sup 11}C]BF-227 PET

    Energy Technology Data Exchange (ETDEWEB)

    Okamura, Nobuyuki; Yanai, Kazuhiko [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Shiga, Yusei; Itoyama, Yasuhito [Tohoku University School of Medicine, Department of Neurology, Sendai (Japan); Furumoto, Shozo [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Tashiro, Manabu [Tohoku University, Division of Cyclotron Nuclear Medicine, Cyclotron and Radioisotope Center, Sendai (Japan); Tsuboi, Yoshio [Fukuoka University School of Medicine, Department of Neurology, Fukuoka (Japan); Furukawa, Katsutoshi; Arai, Hiroyuki [Institute of Development, Aging, and Cancer, Tohoku University, Department of Geriatrics and Gerontology, Division of Brain Sciences, Sendai (Japan); Iwata, Ren [Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Kudo, Yukitsuka [Tohoku University, Innovation of New Biomedical Engineering Center, Sendai (Japan); Doh-ura, Katsumi [Tohoku University School of Medicine, Department of Prion Research, 2-1 Seiryo-machi, Aoba-ku, Sendai (Japan)


    In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [{sup 11}C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [{sup 11}C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)

  16. Surgical intervention for advanced valvular heart disease in 227 cases

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xi; ZHONG Fo-tian; XU Zhe; XU Ying-qi; WANG Zhi-ping; WU Zhong-kai; TANG Bai-yun; XIONG Mai; YAO Jian-ping; SUN Pei-wu


    Background Although the results of surgical treatment in cardiac valve disease continue to improve, the postoperative mortality rate and the rate of complications in patients with advanced valvular heart disease (AVHD) are still very high. We did this retrospective study to summarize the surgical experience of heart valve replacement for patients with AVHD and discuss effective ways to improve the surgical outcome.Results The operative mortality rate was 13.2% (30/227). The main causes of death included multiple organ dysfunction syndrome (MODS), low cardiac output syndrome and ventricular fibrillation. From the results of the binary noncounterpart multivariate logistic regression, the following statistically significant factors were found to influence the operative mortality rate: redo operation, age ≥55 years, preoperative NYHA cardiac function grading, extracorporeal circulation time ≥120 minutes and postoperative usage of GIK (glucose, insulin and potassium) solution. All factors were risk ones except postoperative application of GIK. The Hosmer-Lemeshow goodness of fit coefficient of this model was 0.976.Conclusions The risk factors associated with postoperative mortality rate in the patients with AVHD were redo operation, age ≥55 years, preoperative NYHA cardiac function grading and extracorporeal circulation time ≥120 minutes. Postoperative usage of GIK acted as a kind of metabolic therapy and will improve the recovery for patients with AVHD. Active perioperative management and care will play a very important role in reducing the operative risk and improving the short term outcome of surgical treatment for the patients with AVHD.

  17. Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology


    The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)

  18. Malus pumila 'Spy 227' and Apple stem pitting virus: graft incompatibility and epinasty. (United States)

    Brakta, Ajay; Handa, Anil; Thakur, P D; Tomar, Manica; Kumar, Pardeep


    Apple stem pitting foveavirus (ASPV) is one of the most important and widespread virus infecting apples in the world. Of late, the virus has been found to be invariably associated with most of the apple plantations of Shimla district of Himachal Pradesh based on DAS-ELISA results. Bioassay of viruses in vegetatively propagated crops including apple is considered to be an essential component in indexing programmes for the production of virus free propagating material. Woody indicator Malus pumila 'Spy 227' was used for the detection of ASPV through double grafting method. Graft incompatibility and epinasty symptoms were observed on Malus pumila Spy 227 indicator plants. Further, molecular identification of the virus isolate was done by cloning and sequencing of the test isolate. Partial sequence analysis of the coat protein gene showed 89 % nucleotide identity in BLASTN analysis with ASPV isolate from China (Accession No. JF895517). This is the first record of ASPV producing Graft incompatibility on Spy 227 indicator plants.

  19. 49 CFR 173.227 - Materials poisonous by inhalation, Division 6.1, Packing Group I, Hazard Zone B. (United States)


    ..., Packing Group I, Hazard Zone B. 173.227 Section 173.227 Transportation Other Regulations Relating to..., Packing Group I, Hazard Zone B. (a) In packagings as authorized in § 173.226 and seamless and welded... conform to the performance test requirements of subpart M of part 178 of this subchapter at the...

  20. 48 CFR 227.7009-4 - Additional clauses-contracts providing for payment of a running royalty. (United States)


    ...-contracts providing for payment of a running royalty. 227.7009-4 Section 227.7009-4 Federal Acquisition... clauses—contracts providing for payment of a running royalty. The clauses set forth below are examples... desired to cover the subject matter thereof and the contract provides for payment of a running royalty....

  1. Has California's Passage of Proposition 227 Made a Difference in the Way We Teach? (United States)

    Arellano-Houchin, Anna; Flamenco, Claudia; Merlos, Moises M.; Segura, Lorena


    Examined how teachers were impacted by California's Proposition 227, highlighting changes in teaching styles and beliefs about the proposition and its effectiveness. Teachers had to change their teaching strategies to accommodate the new curriculum. They were not sufficiently trained for immediate implementation of English-only education. Teaching…

  2. 48 CFR 1852.227-85 - Invention reporting and rights-Foreign. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Invention reporting and... Provisions and Clauses 1852.227-85 Invention reporting and rights—Foreign. As prescribed in 1827.303-70(f), insert the following clause: Invention Reporting and Rights—Foreign (APR 1986) (a) As used in this clause...

  3. 48 CFR 3053.227-70 - Conveyance of invention rights acquired by the Government. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Conveyance of invention... Prescription of Forms 3053.227-70 Conveyance of invention rights acquired by the Government. The following form is prescribed for including a means for contractors to report inventions made in the course of...

  4. 48 CFR 52.227-7 - Patents-Notice of Government Licensee. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patents-Notice of... Clauses 52.227-7 Patents—Notice of Government Licensee. As prescribed at 27.202-5(b), insert the following provision: Patents—Notice of Government Licensee (APR 1984) The Government is obligated to pay a...

  5. 48 CFR 227.7009 - Patent releases, license agreements, and assignments. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent releases, license... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Infringement Claims, Licenses, and Assignments 227.7009 Patent releases, license agreements,...

  6. 48 CFR 52.227-4 - Patent Indemnity-Construction Contracts. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patent Indemnity... Clauses 52.227-4 Patent Indemnity—Construction Contracts. As prescribed in 27.201-2(d)(1), insert the following clause: Patent Indemnity—Construction Contracts (DEC 2007) Except as otherwise provided,...

  7. Jesu, meine Freude BWV 227 van Johann Sebastian Bach : een praedicatio sonora

    NARCIS (Netherlands)

    Eikelboom, Arie


    In the oeuvre of Johann Sebastian Bach the motets take only a modest position. According to Bach's early biographers he must have written many motets, but only few have been preserved. Among these motets Jesu, meine Freude BWV 227 occupies a special position. It is the only one which combines a comp

  8. 48 CFR 227.7103-14 - Conformity, acceptance, and warranty of technical data. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Conformity, acceptance..., DATA, AND COPYRIGHTS Rights in Technical Data 227.7103-14 Conformity, acceptance, and warranty of... requirements of the contract pertaining to the delivery of technical data. (b) Conformity and acceptance....

  9. The Political Discourse of the Campaign against Bilingual Education: From "Proposition 227" to "Horne v. Flores" (United States)

    Yamagami, Mai


    Using the frameworks of critical discourse analysis, representation theory, and legitimization theory, this study examines the political discourse of the campaign for Proposition 227 in California--particularly, the key social representations of languages, their speakers, and the main political actors in the campaign. The analysis examines the…

  10. 48 CFR 227.7107 - Contracts for architect-engineer services. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracts for architect... Rights in Technical Data 227.7107 Contracts for architect-engineer services. This section sets forth... of construction and architect-engineer services....

  11. 25 CFR 227.4 - Sale of oil and gas leases. (United States)


    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF CERTAIN LANDS IN WIND RIVER INDIAN RESERVATION, WYOMING, FOR OIL AND GAS MINING How to Acquire Leases § 227.4 Sale of oil and... sales of oil and gas leases shall reserve to the Secretary of the Interior the right to reject all...

  12. 25 CFR 227.25 - Inspection of premises, books and accounts. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books and accounts. 227.25... Inspection of premises, books and accounts. Lessee shall agree to allow the lessor and his agents or any... Department; and their books and records, showing manner of operations and persons interested, shall be...

  13. An ISO far-infrared survey of line and continuum emission for 227 galaxies (United States)

    Brauher, J. R.


    Far-infrared line and continuum fluxes are presented for a sample of 227 galaxies observed with the Long Wavelength Spectrometer on the Infrared Space Observatory, selected from the ISO Data Archive and having an IRAS 60/100 mu m color ration of 0.2-1.4 and IRAS 60 mu m flux density between 0.1 Jy and 1300 Jy.

  14. 30 CFR 227.102 - What royalty management functions will MMS not delegate? (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What royalty management functions will MMS not... MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Delegation of Mms Royalty Functions § 227.102 What royalty management functions will MMS not delegate? This section lists the principal royalty management functions...

  15. 30 CFR 227.101 - What royalty management functions may MMS delegate to a State? (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What royalty management functions may MMS... THE INTERIOR MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Delegation of Mms Royalty Functions § 227.101 What royalty management functions may MMS delegate to a State? (a) If there are oil and gas...

  16. Jesu, meine Freude BWV 227 van Johann Sebastian Bach : een praedicatio sonora

    NARCIS (Netherlands)

    Eikelboom, A.


    In the oeuvre of Johann Sebastian Bach the motets take only a modest position. According to Bach's early biographers he must have written many motets, but only few have been preserved. Among these motets Jesu, meine Freude BWV 227 occupies a special position. It is the only one which combines a


    Energy Technology Data Exchange (ETDEWEB)



    This report presents the results of the bench-scale test, PB-10, performed at HTI's facilities under DOE contract (HTI Run No. 227-109). This bench test continues the work that was started in PDU testing 260-007. Previous bench test (PB-09, HTI 227-106) was performed on different seams of Chinese coal (Shenhua Ningtiaota Coal No.2 and No.3). Since another coal, Shangwan coal was selected for the liquefaction plant, PB-10 was made as approved by DOE/COR. The objective of this test was to evaluate the liquefaction performance of Shangwan coal utilizing various backend processing and recycle schemes. Additionally, this test was to collect available process data to allow for the best scale-up process design possible from this particular unit.

  18. Human Cystathionine-β-Synthase Phosphorylation on Serine227 Modulates Hydrogen Sulfide Production in Human Urothelium.

    Directory of Open Access Journals (Sweden)

    Roberta d'Emmanuele di Villa Bianca

    Full Text Available Urothelium, the epithelial lining the inner surface of human bladder, plays a key role in bladder physiology and pathology. It responds to chemical, mechanical and thermal stimuli by releasing several factors and mediators. Recently it has been shown that hydrogen sulfide contributes to human bladder homeostasis. Hydrogen sulfide is mainly produced in human bladder by the action of cystathionine-β-synthase. Here, we demonstrate that human cystathionine-β-synthase activity is regulated in a cGMP/PKG-dependent manner through phosphorylation at serine 227. Incubation of human urothelium or T24 cell line with 8-Bromo-cyclic-guanosine monophosphate (8-Br-cGMP but not dibutyryl-cyclic-adenosine monophosphate (d-cAMP causes an increase in hydrogen sulfide production. This result is congruous with the finding that PKG is robustly expressed but PKA only weakly present in human urothelium as well as in T24 cells. The cGMP/PKG-dependent phosphorylation elicited by 8-Br-cGMP is selectively reverted by KT5823, a specific PKG inhibitor. Moreover, the silencing of cystathionine-β-synthase in T24 cells leads to a marked decrease in hydrogen sulfide production either in basal condition or following 8-Br-cGMP challenge. In order to identify the phosphorylation site, recombinant mutant proteins of cystathionine-β-synthase in which Ser32, Ser227 or Ser525 was mutated in Ala were generated. The Ser227Ala mutant cystathionine-β-synthase shows a notable reduction in basal biosynthesis of hydrogen sulfide becoming unresponsive to the 8-Br-cGMP challenge. A specific antibody that recognizes the phosphorylated form of cystathionine-β-synthase has been produced and validated by using T24 cells and human urothelium. In conclusion, human cystathionine-β-synthase can be phosphorylated in a PKG-dependent manner at Ser227 leading to an increased catalytic activity.

  19. RE170、RE170/R227ea与矿物油的互溶性评价%Miscibility evaluation of RE170 and RE170/R227ea with a mineral oil

    Institute of Scientific and Technical Information of China (English)

    田田; 杨昭; 吴曦; 余壮壮


    Refrigerant R22 is scheduled to be phased out and new and environmentally friendly refrigerants RE170 and RE170/R227ea have promising application. Miscibility of these refrigerants with lubricants has a large influence on working effect of the refrigerating system. For this reason, an experimental apparatus for testing miscibility of new refrigerants with lubricants was established based on standard SH/T 0699—2000. The miscibility values of promising refrigerants RE170 and mixed refrigerant RE170/R227ea with a mineral oil were studied. RE170 and the mineral oil were completely miscible at−50℃, as oil proportion changed from 10%to 60%. When R227ea mass fraction in mixed refrigerant RE170/R227ea changed from 35% to 60% and oil proportion was specified at 14.6%±0.5%, low phase separation temperature increased with increasing R227ea. When R227ea mass fraction was below 38%, the mixed refrigerant and mineral oil became miscible even at−50℃. When R227ea mass fraction was over 55%, the mixed refrigerant and mineral oil were immiscible even at room temperature. Finally, by combining the methods of empirical equation and solubility parameter, a new evaluation method was proposed to evaluate the miscibility of pure refrigerants and binary refrigerant mixtures with the mineral oil.%随着制冷剂R22逐步淘汰,RE170、RE170/R227ea新型环保制冷剂有应用前景,其和润滑油能否互溶直接影响制冷系统的使用效果。根据标准SH/T 0699—2000建立了一套制冷剂和润滑油的互溶性测试系统,对RE170、RE170/R227ea和矿物油的互溶性进行了试验研究。结果表明:RE170的矿物油溶液在含油率为10%~60%时,当温度低至−50℃时没有出现分层或絮状物,二者互溶性非常好;混合制冷剂RE170/R227ea的矿物油溶液在含油率为14.6%±0.5%的基准情况下,当R227ea的质量分数在35%~60%变动时RE170/R227ea和矿物油的低温两相分离温度随R227ea含量增加而

  20. On the Origin of the Spiral Morphology in the Elias 2-27 Circumstellar Disk (United States)

    Meru, Farzana; Juhász, Attila; Ilee, John D.; Clarke, Cathie J.; Rosotti, Giovanni P.; Booth, Richard A.


    The young star Elias 2-27 has recently been observed to posses a massive circumstellar disk with two prominent large-scale spiral arms. In this Letter, we perform three-dimensional Smoothed Particle Hydrodynamics simulations, radiative transfer modeling, synthetic ALMA imaging, and an unsharped masking technique to explore three possibilities for the origin of the observed structures—an undetected companion either internal or external to the spirals, and a self-gravitating disk. We find that a gravitationally unstable disk and a disk with an external companion can produce morphology that is consistent with the observations. In addition, for the latter, we find that the companion could be a relatively massive planetary-mass companion (≲10-13 M Jup) and located at large radial distances (between ≈300-700 au). We therefore suggest that Elias 2-27 may be one of the first detections of a disk undergoing gravitational instabilities, or a disk that has recently undergone fragmentation to produce a massive companion.

  1. Renal Biopsy and Clinical Pathological Features in 227 Infants%婴幼儿227例肾穿刺及临床病理学特点

    Institute of Scientific and Technical Information of China (English)

    黄丹琳; 易著文; 党西强; 吴小川; 何小解; 曹艳; 莫双红; 何庆南


    目的 分析婴幼儿肾脏疾病临床病理的特点及婴幼儿肾穿刺安全进行的方法和意义.方法 对临床诊断为肾脏疾病的227例婴幼儿进行经皮肾穿刺活检,肾脏病理组织分别进行光镜、免疫荧光和电镜观察.光镜标本做苏木精-伊红(HE)、过碘酸雪夫反应(PAS)、六胺银(PASM)和Masson染色,免疫荧光检测其肾组织中的IgG、IgM、IgA、C3、C4、C1q、Fibrin,204例标本同时行电镜检查.结果 所有患儿肾穿刺均获成功,术后无明显并发症.有肾穿刺适应证的227例婴幼儿肾脏疾病中最常见的是肾病综合征(38.3%)、孤立性血尿(37.0%)和急性肾炎综合征(9.3%),继发性肾脏疾病相对较少(5.3%).肾脏病理类型中最常见的是系膜增生性肾小球肾炎(62.6%)、IgA肾病(8.4%)和局灶节段性肾小球硬化(5.7%).87例肾病综合征病理类型最常见的是系膜增生性肾小球肾炎(50例)、微小病变(11例)和局灶节段性肾小球硬化(9例);84例孤立性血尿病理类型最常见的是系膜增生性肾小球肾炎(68例)和IgA肾病(9例).结论 在不盲目扩大适应证的基础上,安全有效地进行婴幼儿肾穿刺,可以提高婴幼儿肾脏疾病的诊治水平.%Objective To analyze the clinical and pathological features of children under 3 years with renal disease, and summarize the methods and significance of renal biopsy in infants.Methods Percutaneous renal biopsy was performed on 227 infants who were diagnosed as kidney diseases.The specimens were divided into 3 parts for light microscope, electron microscope and immunofluorescence examination respectively and processed by hematoxylin - eosin ( HE ), periodic acid - schiff( PAS ) , periodic acid - sliver methenamine ( PASM ) , and Masson staining.Immunofluorescence was used to detect the deposition of IgG, IgM, IgA, C3 , C4 , C 1q, and Fibrin in the renal tissues.Altogether 204 of the specimens were examined by electron microscope.Results All the renal

  2. A compiled catalogue of reference stars around 227 ICRF extragalactic radio sources. (United States)

    Ryl'kov, V. P.; Narizhnaya, N. V.; Dement'eva, A. A.; Pinigin, G. I.; Maigurova, N. V.; Martinov, M. V.

    A compiled catalogue of21440 stars with magnitudes from 10 to 17 is prepared on the basis of original observations made from the end of the 20th to the beginning of the 21th century. The catalogue con tains 227 fields of the cetes tial sphere around extragalactic radio sources in a declination zone from -17 to +89°. The field size is 40' for both right ascension and declination. The internal accuracy of positions for both coordinates is not worse than 0.1". The comparison of stellar positions with the use of the UCAC2 and CMC13 catalogues shows that the average external accuracy is about 0.05-0.15" for the majority ofchosenfields of the compiled catalogue. The positions of 10795 stars up to +50° in declination are given at epoch J2000.0, whereas the positions of other stars are given at the epoch of an observation.

  3. Transit Timing Variation analysis with Kepler light curves of KOI 227 and Kepler 93b (United States)

    Dulz, Shannon; Reed, Mike


    By searching for transit signals in approximately 150,000 stars, NASA’s Kepler Space telescope found thousands of exoplanets over its primary mission from 2009 to 2013 (Tenenbaum et al. 2014, ApJS, 211, 6). Yet, a detailed follow-up examination of Kepler light curves may contribute more evidence on system dynamics and planetary atmospheres of these objects. Kepler’s continuous observing of these systems over the mission duration produced light curves of sufficient duration to allow for the search for transit timing variations. Transit timing variations over the course of many orbits may indicate a precessing orbit or the existence of a non-transiting third body such as another exoplanet. Flux contributions of the planet just prior to secondary eclipse may provide a measurement of bond albedo from the day-side of the transiting planet. Any asymmetries of the transit shape may indicate thermal asymmetries which can measure upper atmosphere motion of the planet. These two factors can constrain atmospheric models of close orbiting exoplanets. We first establish our procedure with the well-documented TTV system, KOI 227 (Nesvorny et al. 2014, ApJ, 790, 31). Using the test case of KOI 227, we analyze Kepler-93b for TTVs and day-side flux contributions. Kepler-93b is likely a rocky planet with R = 1.50 ± 0.03 Earth Radii and M = 2.59 ± 2.0 Earth Masses (Marcy et al. 2014, ApJS, 210, 20). This research is funded by a NASA EPSCoR grant.

  4. Statistical analysis and optimization of direct metal laser deposition of 227-F Colmonoy nickel alloy (United States)

    Angelastro, A.; Campanelli, S. L.; Casalino, G.


    This paper presents a study on process parameters and building strategy for the deposition of Colmonoy 227-F powder by CO2 laser with a focal spot diameter of 0.3 mm. Colmonoy 227-F is a nickel alloy especially designed for mold manufacturing. The substrate material is a 10 mm thick plate of AISI 304 steel. A commercial CO2 laser welding machine was equipped with a low-cost powder feeding system. In this work, following another one in which laser power, scanning speed and powder flow rate had been studied, the effects of two important process parameters, i.e. hatch spacing and step height, on the properties of the built parts were analysed. The explored ranges of hatch spacing and step height were respectively 150-300 μm and 100-200 μm, whose dimensions were comparable with that of the laser spot. The roughness, adhesion, microstructure, microhardness and density of the manufactured specimens were studied for multi-layer samples, which were made of 30 layers. The statistical significance of the studied process parameters was assessed by the analysis of the variance. The process parameters used allowed to obtain both first layer-to-substrate and layer-to-layer good adhesions. The microstructure was fine and almost defect-free. The microhardness of the deposited material was about 100 HV higher than that of the starting powder. The density as high as 98% of that of the same bulk alloy was more than satisfactory. Finally, simultaneous optimization of density and roughness was performed using the contour plots.

  5. 48 CFR 252.227-7018 - Rights in noncommercial technical data and computer software-Small Business Innovation Research... (United States)


    ... Clauses 252.227-7018 Rights in noncommercial technical data and computer software—Small Business... the Rights in Noncommercial Technical Data and Computer Software—Small Business Innovative Research... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in...

  6. 48 CFR 227.7203-14 - Conformity, acceptance, and warranty of computer software and computer software documentation. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Conformity, acceptance... Software Documentation 227.7203-14 Conformity, acceptance, and warranty of computer software and computer...) Conformity and acceptance. Solicitations and contracts requiring the delivery of computer software...

  7. 27 CFR 28.227 - Removals of beer by persons other than the brewer or agent of the brewer. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removals of beer by... ALCOHOL Exportation of Beer With Benefit of Drawback Execution of Claims § 28.227 Removals of beer by persons other than the brewer or agent of the brewer. Where there is a removal of taxpaid beer by a...

  8. Accelerating growth of HFC-227ea (1,1,1,2,3,3,3-heptafluoropropane) in the atmosphere

    NARCIS (Netherlands)

    Laube, J.C.; Martinerie, P.; Witrant, E.; Brenninkmeijer, C.A.M.; Bolder, M.; Rockmann, T.; van der Veen, C; Sturges, W.T.


    We report the first measurements of 1,1,1,2,3,3,3-heptafluoropropane (HFC-227ea), a substitute for ozone depleting compounds, in air samples originating from remote regions of the atmosphere and present evidence for its accelerating growth. Observed mixing ratios ranged from below 0.01 ppt in deep f

  9. Synthesis, properties and drug potential of the photosensitive alkyl- and alkylsiloxy-ligated silicon phthalocyanine Pc 227. (United States)

    Li, Jun; Yang, Yang; Zhang, Ping; Sounik, James R; Kenney, Malcolm E


    The photosensitive, alkyl- and alkylsiloxy-ligated silicon phthalocyanine, SiPc[(CH2)3SH][OSi(CH3)2(CH2)3N(CH3)2], Pc 227, has been prepared and characterized. This phthalocyanine yields the experimental photodynamic therapy (PDT) drug Pc 4, SiPc[OH][OSi(CH3)2(CH2)3N(CH3)2], when irradiated with red light. To provide an understanding of the process by which Pc 227 and other alkyl-alkylsiloxysilicon phthalocyanines such as Pc 227 are photolyzed, bond dissociation energy, natural bond orbital (NBO) charge distribution, spin density distribution, nucleus-independent chemical shift (NICS), and electron localization function (ELF) calculations have been carried out on two models related to it. These show that the lowest energy pathway for the photolysis of Pc 227 is a homolysis involving a phthalocyanine π radical having a low SiPc-C bond dissociation energy. The promise of the results of this study for synthetic chemistry and drug development is discussed.

  10. Complete genome sequence of Lactobacillus plantarum LZ227, a potential probiotic strain producing B-group vitamins. (United States)

    Li, Ping; Zhou, Qingqing; Gu, Qing


    B-group vitamins play an important role in human metabolism, whose deficiencies are associated with a variety of disorders and diseases. Certain microorganisms such as Lactic acid bacteria (LAB) have been shown to have capacities for B-group vitamin production and thus could potentially replace chemically synthesized vitamins for food fortification. A potential probiotic strain named Lactobacillus plantarum LZ227, which was isolated from raw cow milk in this study, exhibits the ability to produce B-group vitamins. Complete genome sequencing of LZ227 was performed to gain insights into the genetic elements involved in B-group vitamin production. The genome of LZ227 contains a circular 3,131,750-bp chromosome, three circular plasmids and two predicted linear plasmids. LZ227 also contains gene clusters for biosynthesis of both riboflavin and folate. This genome sequence provides a basis for further elucidation of its molecular genetics and probiotic functions, and will facilitate its applications as starter cultures in food industry.

  11. 48 CFR 227.7107-1 - Architectural designs and data clauses for architect-engineer or construction contracts. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Architectural designs and... construction involving architect-engineer services, is to obtain a unique architectural design of a building, a... CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7107-1 Architectural...

  12. 48 CFR 227.7203-16 - Providing computer software or computer software documentation to foreign governments, foreign... (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Providing computer software or computer software documentation to foreign governments, foreign contractors, or international... Rights in Computer Software and Computer Software Documentation 227.7203-16 Providing computer...

  13. Analysis of drug resistance for 227 strains enterococci%227株肠球菌细菌耐药性分析

    Institute of Scientific and Technical Information of China (English)

    李怀先; 黄素荣


    Objective To study the enterococcal distribution in clinical samples and their drug resistance to commonly use antibiotic and provide the guidance for rational administration. Methods Adopting paper diffusion method to observe the drug resistance of enterococci isolated from clinical samples in our hospital and analyzing their distribution in the samples. Results En-terococcus faecalis accounts for 44. 1 % in 227 strains and Enterococcus faeciura accounts for 37. 9% , the other kinds of enterococci were rare. There was no statistical difference between drug resistance of Enterococcus faecium and that of enterococcus faecalis. Vancomycin was the most potent antimicrobial. Penicillin,ampicillin,and nitrofurantion showed good antibacterial activity against enterococcus faecalis. Enterococcus faecium displayed high-level resistance against antibiotics in addition to glycopeptides. Conclusion Doctor should pay attention to the drug resistance about clinically common pathogenic bacterium. Continual surveillance of resistance rate of enterococcus is important to direct the treatment of enterococcus infections.%目的 了解肠球菌在临床标本中的分布及对常用的抗菌药物的耐药现状,指导临床合理用药.方法 对临床标本中分离出的细菌进行系统检验,采用纸片法对分离鉴定后的肠球菌进行药物敏感性试验.结果 肠球菌可在临床常见的多种标本中检出,粪肠球菌(44.1%)与屎肠球菌(37.9%)常见,其他肠球菌(18%)少见.对常用抗菌药物的耐药性,粪肠球菌和屎肠球菌之间的差异无统计学意义.万古霉素是敏感性最高的抗生素.青霉素、氨苄西林和呋喃妥因对粪肠球菌具有较好的抗菌活性.屎肠球菌对除糖肽类抗生素以外的所有临床常用抗菌药物显示高水平耐药.结论 临床医生应关注临床常见病原菌的耐药性研究,动态监测肠球菌的耐药状况对指导临床治疗具有重要意义.

  14. Interannual variation of the quasi-two-day wave at 22.7 S (United States)

    Lima, Lourivaldo; Jacobi, Christoph; Batista, Paulo; Rodrigues de Araujo, Luciana; Rodrigues, Chayenny E. S.; Lilienthal, Friederike


    In the present investigation, the mesosphere/lower thermosphere winds at Cachoeira Paulista (22.7° S, 45.0° W) obtained by a VHF all sky interferometric meteor radar have been used to investigate the interannual variability of the quasi-two-day wave (QTDW) amplitudes at a low latitude in the Southern Hemisphere. The wind data were obtained from December 1999 to July 2006, from September 2007 to October 2008 and from December 2013 to April 2015. The analysis shows that meridional amplitudes for QTDW are larger than zonal amplitudes and the strongest amplitudes occur after austral summer solstice in January-February. Besides semiannual and annual oscillations, the QTDW amplitudes in the meridional winds also show weak quasi-biennial oscillation (QBO). The summer QTDW in the meridional winds also shows a possible correlation with solar activity. The amplitudes are nearly in phase with the 11 year solar cycle, and the solar maxima leads the QTDW maxima by one year. Finally, larger QTDW amplifications have been observed during 2003, 2004, 2006 and 2015 summers. The unusual major sudden stratospheric warming (SSW) event suggests a coupling between QTDW amplification and SSW during Jan-Feb 2006. The mechanistic global circulation model MUAM of the middle and upper atmosphere has been used to simulate the dynamic configuration during January major and minor SSW events.

  15. Study on the Relationship between Blood Stasis Syndrome and Clinical Pathology in 227 Patients with Primary Glomerular Disease

    Institute of Scientific and Technical Information of China (English)

    李深; 饶向荣; 王素霞; 张改华; 李晓玫; 戴希文; 陈可冀


    To investigate the relationship between the severity of Chinese medicine(CM) bloodstasis syndrome(BSS) with clinical features and renal lesion indexes of the primary glomerular disease. Methods:An epidemiological survey was conducted to collect the data of 227 patients diagnosed as chronic primary glomerular diseases,and their severity of BSS were scored three days before renal biopsies were performed.The following clinical indexes were analyzed:age,course of glomerular diseases,24-h urine protein ration...

  16. Interaction between supernova remnant G22.7–0.2 and the ambient molecular clouds

    Energy Technology Data Exchange (ETDEWEB)

    Su, Yang; Yang, Ji; Zhou, Xin [Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing 210008 (China); Zhou, Ping; Chen, Yang [Department of Astronomy, Nanjing University, 163 Xianlin Avenue, Nanjing 210093 (China)


    We have carried out {sup 12}CO (J = 1-0 and 2-1), {sup 13}CO (J = 1-0), and C{sup 18}O (J = 1-0) observations in the direction of the supernova remnant (SNR) G22.7–0.2. A filamentary molecular gas structure, which is likely part of a larger molecular complex with V {sub LSR} ∼ 75-79 km s{sup –1}, is detected and is found to surround the southern boundary of the remnant. In particular, the high-velocity wing (77-110 km s{sup –1}) in the {sup 12}CO (J = 1-0 and J = 2-1) emission shows convincing evidence of the interaction between SNR G22.7–0.2 and the 75-79 km s{sup –1} molecular clouds (MCs). Spectra with redshifted profiles, a signature of shocked molecular gas, are seen in the southeastern boundary of the remnant. The association between the remnant and the 77 km s{sup –1} MCs places the remnant at the near distance of 4.4 ± 0.4 kpc, which agrees with a location on the Scutum-Crux arm. We suggest that SNR G22.7–0.2, SNR W41, and H II region G022.760-0.485 are at the same distance and are associated with GMC G23.0–0.4.

  17. Three subgroups of pain profiles identified in 227 women with arthritis: a latent class analysis. (United States)

    de Luca, Katie; Parkinson, Lynne; Downie, Aron; Blyth, Fiona; Byles, Julie


    The objectives were to identify subgroups of women with arthritis based upon the multi-dimensional nature of their pain experience and to compare health and socio-demographic variables between subgroups. A latent class analysis of 227 women with self-reported arthritis was used to identify clusters of women based upon the sensory, affective, and cognitive dimensions of the pain experience. Multivariate multinomial logistic regression analysis was used to determine the relationship between cluster membership and health and sociodemographic characteristics. A three-class cluster model was most parsimonious. 39.5 % of women had a unidimensional pain profile; 38.6 % of women had moderate multidimensional pain profile that included additional pain symptomatology such as sensory qualities and pain catastrophizing; and 21.9 % of women had severe multidimensional pain profile that included prominent pain symptomatology such as sensory and affective qualities of pain, pain catastrophizing, and neuropathic pain. Women with severe multidimensional pain profile have a 30.5 % higher risk of poorer quality of life and a 7.3 % higher risk of suffering depression, and women with moderate multidimensional pain profile have a 6.4 % higher risk of poorer quality of life when compared to women with unidimensional pain. This study identified three distinct subgroups of pain profiles in older women with arthritis. Women had very different experiences of pain, and cluster membership impacted significantly on health-related quality of life. These preliminary findings provide a stronger understanding of profiles of pain and may contribute to the development of tailored treatment options in arthritis.

  18. Structural basis for nematode eIF4E binding an m(2,2,7)G-Cap and its implications for translation initiation. (United States)

    Liu, Weizhi; Jankowska-Anyszka, Marzena; Piecyk, Karolina; Dickson, Laura; Wallace, Adam; Niedzwiecka, Anna; Stepinski, Janusz; Stolarski, Ryszard; Darzynkiewicz, Edward; Kieft, Jeffrey; Zhao, Rui; Jones, David N M; Davis, Richard E


    Metazoan spliced leader (SL) trans-splicing generates mRNAs with an m(2,2,7)G-cap and a common downstream SL RNA sequence. The mechanism for eIF4E binding an m²²⁷G-cap is unknown. Here, we describe the first structure of an eIF4E with an m(2,2,7)G-cap and compare it to the cognate m⁷G-eIF4E complex. These structures and Nuclear Magnetic Resonance (NMR) data indicate that the nematode Ascaris suum eIF4E binds the two different caps in a similar manner except for the loss of a single hydrogen bond on binding the m(2,2,7)G-cap. Nematode and mammalian eIF4E both have a low affinity for m(2,2,7)G-cap compared with the m⁷G-cap. Nematode eIF4E binding to the m⁷G-cap, m(2,2,7)G-cap and the m(2,2,7)G-SL 22-nt RNA leads to distinct eIF4E conformational changes. Additional interactions occur between Ascaris eIF4E and the SL on binding the m(2,2,7)G-SL. We propose interactions between Ascaris eIF4E and the SL impact eIF4G and contribute to translation initiation, whereas these interactions do not occur when only the m(2,2,7)G-cap is present. These data have implications for the contribution of 5'-UTRs in mRNA translation and the function of different eIF4E isoforms.

  19. Outcomes From AAS Hack Day at the 227th AAS Meeting (United States)

    Kohler, Susanna


    Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

  20. Accelerating growth of HFC-227ea (1,1,1,2,3,3,3-heptafluoropropane) in the atmosphere

    DEFF Research Database (Denmark)

    Laube, J.C.; Martinerie, P.; Witrant, E.


    We report the first measurements of 1,1,1,2,3,3,3-heptafluoropropane (HFC-227ea), a substitute for ozone depleting compounds, in air samples originating from remote regions of the atmosphere and present evidence for its accelerating growth. Observed mixing ratios ranged from below 0.01 ppt in deep...... firn air to 0.59 ppt in the current northern mid-latitudinal upper troposphere. Firn air samples collected in Greenland were used to reconstruct a history of atmospheric abundance. Year-on-year increases were deduced, with acceleration in the growth rate from 0.029 ppt per year in 2000 to 0.056 ppt per...

  1. Combined renin inhibition/(prorenin receptor blockade in diabetic retinopathy--a study in transgenic (mREN227 rats.

    Directory of Open Access Journals (Sweden)

    Wendy W Batenburg

    Full Text Available Dysfunction of renin-angiotensin system (RAS contributes to the pathogenesis of diabetic retinopathy (DR. Prorenin, the precursor of renin is highly elevated in ocular fluid of diabetic patients with proliferative retinopathy. Prorenin may exert local effects in the eye by binding to the so-called (prorenin receptor ((PRR. Here we investigated the combined effects of the renin inhibitor aliskiren and the putative (PRR blocker handle-region peptide (HRP on diabetic retinopathy in streptozotocin (STZ-induced diabetic transgenic (mRen227 rats (a model with high plasma prorenin levels as well as prorenin stimulated cytokine expression in cultured Müller cells. Adult (mRen227 rats were randomly divided into the following groups: (1 non-diabetic; (2 diabetic treated with vehicle; (3 diabetic treated with aliskiren (10 mg/kg per day; and (4 diabetic treated with aliskiren+HRP (1 mg/kg per day. Age-matched non-diabetic wildtype Sprague-Dawley rats were used as control. Drugs were administered by osmotic minipumps for three weeks. Transgenic (mRen227 rat retinas showed increased apoptotic cell death of both inner retinal neurons and photoreceptors, increased loss of capillaries, as well as increased expression of inflammatory cytokines. These pathological changes were further exacerbated by diabetes. Aliskiren treatment of diabetic (mRen227 rats prevented retinal gliosis, and reduced retinal apoptotic cell death, acellular capillaries and the expression of inflammatory cytokines. HRP on top of aliskiren did not provide additional protection. In cultured Müller cells, prorenin significantly increased the expression levels of IL-1α and TNF-α, and this was completely blocked by aliskiren or HRP, their combination, (PRR siRNA and the AT1R blocker losartan, suggesting that these effects entirely depended on Ang II generation by (PRR-bound prorenin. In conclusion, the lack of effect of HRP on top of aliskiren, and the Ang II-dependency of the ocular

  2. Standardized, systemic phenotypic analysis of Umod(C93F and Umod(A227T mutant mice.

    Directory of Open Access Journals (Sweden)

    Elisabeth Kemter

    Full Text Available Uromodulin-associated kidney disease (UAKD summarizes different clinical features of an autosomal dominant heritable disease syndrome in humans with a proven uromodulin (UMOD mutation involved. It is often characterized by hyperuricemia, gout, alteration of urine concentrating ability, as well as a variable rate of disease progression inconstantly leading to renal failure and histological alterations of the kidneys. We recently established the two Umod mutant mouse lines Umod(C93F and Umod(A227T on the C3H inbred genetic background both showing kidney defects analogous to those found in human UAKD patients. In addition, disease symptoms were revealed that were not yet described in other published mouse models of UAKD. To examine if further organ systems and/or metabolic pathways are affected by Umod mutations as primary or secondary effects, we describe a standardized, systemic phenotypic analysis of the two mutant mouse lines Umod(A227T and Umod(C93F in the German Mouse Clinic. Different genotypes as well as different ages were tested. Beside the already published changes in body weight, body composition and bone metabolism, the influence of the Umod mutation on energy metabolism was confirmed. Hematological analysis revealed a moderate microcytic and erythropenic anemia in older Umod mutant mice. Data of the other analyses in 7-10 month-old mutant mice showed single small additional effects.

  3. Effects of carbon and nitrogen sources on fatty acid contents and composition in the green microalga, Chlorella sp. 227. (United States)

    Cho, Sunja; Lee, Dukhaeng; Luong, Thao Thanh; Park, Sora; Oh, You-Kwan; Lee, Taeho


    In order to investigate and generalize the effects of carbon and nitrogen sources on the growth of and lipid production in Chlorella sp. 227, several nutritional combinations consisting of different carbon and nitrogen sources and concentrations were given to the media for cultivation of Chlorella sp. 227, respectively. The growth rate and lipid content were affected largely by concentration rather than by sources. The maximum specific growth was negatively affected by low concentrations of carbon and nitrogen. There is a maximum allowable inorganic carbon concentration (less than 500~1,000 mM bicarbonate) in autotrophic culture, but the maximum lipid content per gram dry cell weight (g DCW) was little affected by the concentration of inorganic carbon within the concentration. The lipid content per g DCW was increased when the microalga was cultured with the addition of glucose and bicarbonate (mixotrophic) at a fixed nitrogen concentration and with the lowest nitrogen concentration (0.2 mM), relatively. Considering that lipid contents per g DCW increased in those conditions, it suggests that a high ratio of carbon to nitrogen in culture media promotes lipid accumulation in the cells. Interestingly, a significant increase of the oleic acid amount to total fatty acids was observed in those conditions. These results showed the possibility to induce lipid production of high quality and content per g DCW by modifying the cultivation conditions.

  4. A synchrotron study of Na2.27Ho7.73(SiO46O0.72

    Directory of Open Access Journals (Sweden)

    Luis Fuentes


    Full Text Available A well crystallized powder sample of sodium holmium orthosilicate oxyapatite, Na2.27Ho7.73(SiO46O0.72, was obtained after mechanical milling and thermal treatment at 1123 K. Crystal structure analysis was performed from the results of Rietveld refinement of the synchrotron diffraction data. As in other rare-earth orthosilicate apatites, sodium cations appear located sharing with holmium the 4f Wyckoff position at the center of a tricapped trigonal prism. In its turn, holmium almost fully occupies the 6h position at the center of a seven-coordinated pentagonal bipyramid. A small quantity of Na atoms was found at this site. No vacancies are present in the two independent crystallographic sites available for Ho and Na atoms.

  5. Dissociation of blood pressure reduction from end-organ damage in TGR(mREN2)27 transgenic hypertensive rats

    NARCIS (Netherlands)

    Teisman, ACH; Pinto, YM; Buikema, H; Flesch, M; Bohm, M; Paul, M; van Gilst, WH


    Objective Since the biochemical disturbance underlying hypertension may be an important determinant of patient outcome, we compared the effects of early treatment with different antihypertensive drugs on end-organ damage in the TGR(mREN2)27 transgenic rat (REN-P), In these REN-P rats, hypertension i

  6. Activation of angiotensin-(1-7)/Mas axis in the brain lowers blood pressure and attenuates cardiac remodeling in hypertensive transgenic (mRen2)27 rats. (United States)

    Kangussu, Lucas M; Guimaraes, Priscila S; Nadu, Ana Paula; Melo, Marcos B; Santos, Robson A S; Campagnole-Santos, Maria Jose


    Activation of the peripheral angiotensin-(1-7)/Mas axis of the renin-angiotensin system produces important cardioprotective actions, counterbalancing the deleterious actions of an overactivity of Ang II/AT1 axis. In the present study we evaluated whether the chronic increase in Ang-(1-7) levels in the brain could ameliorate cardiac disorders observed in transgenic (mRen2)27 hypertensive rats through actions on Mas receptor. Sprague Dawley (SD) and transgenic (mRen2)27 hypertensive rats, instrumented with telemetry probe for arterial pressure (AP) measurement were subjected to 14 days of ICV infusion of Ang-(1-7) (200 ng/h) or Ang-(1-7) associated with Mas receptor antagonist (A779, 1 μg/h) or 0.9% sterile saline (0.5 μl/h) through osmotic mini-pumps. Ang-(1-7) infusion in (mRen2)27 rats reduced blood pressure, normalized the baroreflex control of HR, restored cardiac autonomic balance, reduced cardiac hypertrophy and pre-fibrotic alterations and decreased the altered imbalance of Ang II/Ang-(1-7) in the heart. In addition, there was an attenuation of the increased levels of atrial natriuretic peptide, brain natriuretic peptide, collagen I, fibronectin and TGF-β in the heart of (mRen2)27 rats. Furthermore, most of these effects were mediated in the brain by Mas receptor, since were blocked by its selective antagonist, A779. These data indicate that increasing Ang-(1-7) levels in the brain can attenuate cardiovascular disorders observed in (mRen2)27 hypertensive rats, probably by improving the autonomic balance to the heart due to centrally-mediated actions on Mas receptor. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Structural insights into parasite eIF4E binding specificity for m7G and m2,2,7G mRNA caps. (United States)

    Liu, Weizhi; Zhao, Rui; McFarland, Craig; Kieft, Jeffrey; Niedzwiecka, Anna; Jankowska-Anyszka, Marzena; Stepinski, Janusz; Darzynkiewicz, Edward; Jones, David N M; Davis, Richard E


    The eukaryotic translation initiation factor eIF4E recognizes the mRNA cap, a key step in translation initiation. Here we have characterized eIF4E from the human parasite Schistosoma mansoni. Schistosome mRNAs have either the typical monomethylguanosine (m(7)G) or a trimethylguanosine (m(2,2,7)G) cap derived from spliced leader trans-splicing. Quantitative fluorescence titration analyses demonstrated that schistosome eIF4E has similar binding specificity for both caps. We present the first crystal structure of an eIF4E with similar binding specificity for m(7)G and m(2,2,7)G caps. The eIF4E.m(7)GpppG structure demonstrates that the schistosome protein binds monomethyl cap in a manner similar to that of single specificity eIF4Es and exhibits a structure similar to other known eIF4Es. The structure suggests an alternate orientation of a conserved, key Glu-90 in the cap-binding pocket that may contribute to dual binding specificity and a position for mRNA bound to eIF4E consistent with biochemical data. Comparison of NMR chemical shift perturbations in schistosome eIF4E on binding m(7)GpppG and m(2,2,7)GpppG identified key differences between the two complexes. Isothermal titration calorimetry demonstrated significant thermodynamics differences for the binding process with the two caps (m(7)G versus m(2,2,7)G). Overall the NMR and isothermal titration calorimetry data suggest the importance of intrinsic conformational flexibility in the schistosome eIF4E that enables binding to m(2,2,7)G cap.

  8. Modifications in Dynamic Contrast-Enhanced Magnetic Resonance Imaging Parameters After α-Particle-Emitting {sup 227}Th-trastuzumab Therapy of HER2-Expressing Ovarian Cancer Xenografts

    Energy Technology Data Exchange (ETDEWEB)

    Heyerdahl, Helen, E-mail: [Department of Radiation Biology, Institute for Cancer Research, Oslo University Hospital - The Norwegian Radium Hospital, Oslo (Norway); Røe, Kathrine [Department of Oncology, Division of Medicine, Akershus University Hospital, Lørenskog (Norway); Brevik, Ellen Mengshoel [Department of Research and Development, Algeta ASA, Oslo (Norway); Dahle, Jostein [Nordic Nanovector AS, Oslo (Norway)


    Purpose: The purpose of this study was to investigate the effect of α-particle-emitting {sup 227}Th-trastuzumab radioimmunotherapy on tumor vasculature to increase the knowledge about the mechanisms of action of {sup 227}Th-trastuzumab. Methods and Materials: Human HER2-expressing SKOV-3 ovarian cancer xenografts were grown bilaterally in athymic nude mice. Mice with tumor volumes 253 ± 36 mm{sup 3} (mean ± SEM) were treated with a single injection of either {sup 227}Th-trastuzumab at a dose of 1000 kBq/kg body weight (treated group, n=14 tumors) or 0.9% NaCl (control group, n=10 tumors). Dynamic T1-weighted contrast-enhanced magnetic resonance imaging (DCEMRI) was used to study the effect of {sup 227}Th-trastuzumab on tumor vasculature. DCEMRI was performed before treatment and 1, 2, and 3 weeks after therapy. Tumor contrast-enhancement curves were extracted voxel by voxel and fitted to the Brix pharmacokinetic model. Pharmacokinetic parameters for the tumors that underwent radioimmunotherapy were compared with the corresponding parameters of control tumors. Results: Significant increases of k{sub ep}, the rate constant of diffusion from the extravascular extracellular space to the plasma (P<.05), and k{sub el,} the rate of clearance of contrast agent from the plasma (P<.01), were seen in the radioimmunotherapy group 2 and 3 weeks after injection, compared with the control group. The product of k{sub ep} and the amplitude parameter A, associated with increased vessel permeability and perfusion, was also significantly increased in the radioimmunotherapy group 2 and 3 weeks after injection (P<.01). Conclusions: Pharmacokinetic modeling of MRI contrast-enhancement curves evidenced significant alterations in parameters associated with increased tumor vessel permeability and tumor perfusion after {sup 227}Th-trastuzumab treatment of HER2-expressing ovarian cancer xenografts.

  9. 10 CFR Appendix E to Part 20 - Nationally Tracked Source Thresholds (United States)


    ... Category 1(TBq) Category 1(Ci) Category 2(TBq) Category 2(Ci) Actinium-227 20 540 0.2 5.4 Americium-241 60... 2 54 Strontium-90 1,000 27,000 10 270 Thorium-228 20 540 0.2 5.4 Thorium-229 20 540 0.2 5.4...

  10. Restricted diversity of antigen binding residues of antibodies revealed by computational alanine scanning of 227 antibody-antigen complexes. (United States)

    Robin, Gautier; Sato, Yoshiteru; Desplancq, Dominique; Rochel, Natacha; Weiss, Etienne; Martineau, Pierre


    Antibody molecules are able to recognize any antigen with high affinity and specificity. To get insight into the molecular diversity at the source of this functional diversity, we compiled and analyzed a non-redundant aligned collection of 227 structures of antibody-antigen complexes. Free energy of binding of all the residue side chains was quantified by computational alanine scanning, allowing the first large-scale quantitative description of antibody paratopes. This demonstrated that as few as 8 residues among 30 key positions are sufficient to explain 80% of the binding free energy in most complexes. At these positions, the residue distribution is not only different from that of other surface residues but also dependent on the role played by the side chain in the interaction, residues participating in the binding energy being mainly aromatic residues, and Gly or Ser otherwise. To question the generality of these binding characteristics, we isolated an antibody fragment by phage display using a biased synthetic repertoire with only two diversified complementarity-determining regions and solved its structure in complex with its antigen. Despite this restricted diversity, the structure demonstrated that all complementarity-determining regions were involved in the interaction with the antigen and that the rules derived from the natural antibody repertoire apply to this synthetic binder, thus demonstrating the robustness and universality of our results. Copyright © 2014. Published by Elsevier Ltd.

  11. MUC1 (CD227) interacts with lck tyrosine kinase in Jurkat lymphoma cells and normal T cells. (United States)

    Mukherjee, P; Tinder, T L; Basu, G D; Gendler, S J


    MUC1 (CD227) is a large transmembrane epithelial mucin glycoprotein, which is aberrantly overexpressed in most adenocarcinomas and is a target for immune therapy for epithelial tumors. Recently, MUC1 has been detected in a variety of hematopoietic cell malignancies including T and B cell lymphomas and myelomas; however, its function in these cells is not clearly defined. Using the Jurkat T cell lymphoma cell line and normal human T cells, we demonstrate that MUC1 is not only expressed in these cells but is also phosphorylated upon T cell receptor (TCR) ligation and associates with the Src-related T cell tyrosine kinase, p56lck. Upon TCR-mediated activation of Jurkat cells, MUC1 is found in the low-density membrane fractions, where linker of T cell activation is contained. Abrogation of MUC1 expression in Jurkat cells by MUC1-specific small interfering RNA resulted in defects in TCR-mediated downstream signaling events associated with T cell activation. These include reduction in Ca2+ influx and extracellular signal-regulated kinase 1/2 phosphorylation, leading to a decrease in CD69 expression, proliferation, and interleukin-2 production. These results suggest a regulatory role of MUC1 in modulating proximal signal transduction events through its interaction with proteins of the activation complex.

  12. Biosynthesis of high yield fatty acids from Chlorella vulgaris NIES-227 under nitrogen starvation stress during heterotrophic cultivation. (United States)

    Shen, Xiao-Fei; Chu, Fei-Fei; Lam, Paul K S; Zeng, Raymond J


    In this study the heterotrophic cultivation of Chlorella vulgaris NIES-227 fed with glucose was investigated systematically using six media types; combinations of nitrogen repletion/depletion and phosphorus repletion/limitation/depletion. It was found that a high yield of fatty acids (0.88 of fed glucose-COD) and a high content of fatty acid methyl esters (FAMEs) (89% of dry weight) were obtained under nitrogen starved conditions. To our knowledge it is the first report on such high COD conversion yield and FAME content in microalgae. The dominant fatty acid (>50%) was methyl oleate (C18:1), a desirable component for biodiesel synthesis. FAME content under nitrogen starved conditions was significantly higher than under nitrogen sufficient conditions, while phosphorus had no significant influence, indicating that nitrogen starvation was the real "fatty acids trigger" in heterotrophic cultivation. These findings could simplify the downstream extraction process, such as the extrusion of oil from soybeans, and could reduce operating costs by improving the fatty acid yield from waste COD.

  13. MOA-2016-BLG-227Lb: A Massive Planet Characterized by Combining Light-curve Analysis and Keck AO Imaging (United States)

    Koshimoto, N.; Shvartzvald, Y.; Bennett, D. P.; Penny, M. T.; Hundertmark, M.; Bond, I. A.; Zang, W. C.; Henderson, C. B.; Suzuki, D.; Rattenbury, N. J.; Sumi, T.; and; Abe, F.; Asakura, Y.; Bhattacharya, A.; Donachie, M.; Evans, P.; Fukui, A.; Hirao, Y.; Itow, Y.; Li, M. C. A.; Ling, C. H.; Masuda, K.; Matsubara, Y.; Matsuo, T.; Muraki, Y.; Nagakane, M.; Ohnishi, K.; Ranc, C.; Saito, To.; Sharan, A.; Shibai, H.; Sullivan, D. J.; Tristram, P. J.; Yamada, T.; Yamada, T.; Yonehara, A.; MOA Collaboration; Gelino, C. R.; Beichman, C.; Beaulieu, J.-P.; Marquette, J.-B.; Batista, V.; Keck Team; Friedmann, M.; Hallakoun, N.; Kaspi, S.; Maoz, D.; Wise Group; Bryden, G.; Calchi Novati, S.; Howell, S. B.; UKIRT Team; Wang, T. S.; Mao, S.; Fouqué, P.; Microlensing Survey, CFHT-K2C9; Korhonen, H.; Jørgensen, U. G.; Street, R.; Tsapras, Y.; Dominik, M.; Kerins, E.; Cassan, A.; Snodgrass, C.; Bachelet, E.; Bozza, V.; Bramich, D. M.; VST-K2C9 Team


    We report the discovery of a microlensing planet—MOA-2016-BLG-227Lb—with a large planet/host mass ratio of q ≃ 9 × 10-3. This event was located near the K2 Campaign 9 field that was observed by a large number of telescopes. As a result, the event was in the microlensing survey area of a number of these telescopes, and this enabled good coverage of the planetary light-curve signal. High angular resolution adaptive optics images from the Keck telescope reveal excess flux at the position of the source above the flux of the source star, as indicated by the light-curve model. This excess flux could be due to the lens star, but it could also be due to a companion to the source or lens star, or even an unrelated star. We consider all these possibilities in a Bayesian analysis in the context of a standard Galactic model. Our analysis indicates that it is unlikely that a large fraction of the excess flux comes from the lens, unless solar-type stars are much more likely to host planets of this mass ratio than lower mass stars. We recommend that a method similar to the one developed in this paper be used for other events with high angular resolution follow-up observations when the follow-up observations are insufficient to measure the lens-source relative proper motion.

  14. 49 CFR 40.227 - May employers use the ATF for non-DOT tests, or non-DOT forms for DOT tests? (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false May employers use the ATF for non-DOT tests, or..., Equipment and Supplies Used in Alcohol Testing § 40.227 May employers use the ATF for non-DOT tests, or non-DOT forms for DOT tests? (a) No, as an employer, BAT, or STT, you are prohibited from using the ATF...

  15. Production of actinium-225 for alpha particle mediated radioimmunotherapy. (United States)

    Boll, Rose A; Malkemus, Dairin; Mirzadeh, Saed


    The initial clinical trials for treatment of acute myeloid leukemia have demonstrated the effectiveness of the alpha emitter (213)Bi in killing cancer cells. Bismuth-213 is obtained from a radionuclide generator system from decay of 10-days (225)Ac parent. Recent pre-clinical studies have also shown the potential application of both (213)Bi, and the (225)Ac parent radionuclide in a variety of cancer systems and targeted radiotherapy. This paper describes our five years of experience in production of (225)Ac in partial support of the on-going clinical trials. A four-step chemical process, consisting of both anion and cation exchange chromatography, is utilized for routine separation of carrier-free (225)Ac from a mixture of (228)Th, (229)Th and (232)Th. The separation of Ra and Ac from Th is achieved using the marcoporous anion exchange resin MP1 in 8M HNO(3) media. Two sequential MP1/NO(3) columns provide a separation factor of approximately 10(6) for Ra and Ac from Th. The separation of Ac from Ra is accomplished on a low cross-linking cation exchange resin AG50-X4 using 1.2M HNO(3) as eluant. Two sequential AG50/NO(3) columns provide a separation factor of approximately 10(2) for Ac from Ra. A 60-day processing schedule has been adopted in order to reduce the processing cost and to provide the highest levels of (225)Ac possible. Over an 8-week campaign, a total of approximately 100 mCi of (225)Ac (approximately 80% of the theoretical yield) is shipped in 5-6 batches, with the first batch typically consisting of approximately 50 mCi. After the initial separation and purification of Ac, the Ra pool is re-processed on a bi-weekly schedule or as needed to provide smaller batches of (225)Ac. The averaged radioisotopic purity of the (225)Ac was 99.6 +/- 0.7% with a (225)Ra content of < or =0.6%, and an average (229)Th content of (4(-4)(+5)) x 10(-5)%.

  16. Isolation of Actinium from Neutron-irradiated Thorium-I

    Institute of Scientific and Technical Information of China (English)


    Isolation of Actinium from Neutron-irradiated Thorium-I¥YangWeifan;YuanShuanggui;MuWantong;ZhangXueqian;LiZhongweiandZhaoLili...

  17. Occupational risk for male infertility: a case-control study of 218 infertile and 227 fertile men. (United States)

    Chia, S E; Tay, S K


    The aim of the study was to determine if certain occupations pose an increased risk for infertility (of no known cause) among a group of infertile men compared with a group of fertile men. A total of 640 consecutive men whose spouses were unable to conceive were recruited from an infertility clinic. Of these, 218 men (cases) were found to have no known cause for their infertility. A total of 227 men whose spouses were pregnant at the time of the study were recruited as controls. The Singapore Standard Occupational Classification was used to code the subjects' occupations. Semen parameters (density, total sperm counts, motility, viability, and normal morphology) in all of the cases were significantly poorer than those in the controls. The risk for infertility is associated with smoking adjusted odds ratio (OR) 2.85 and 95% confidence interval (CI) 1.91 to 4.24. Work, independently, is not a risk factor for infertility. Engineering technicians (adjusted OR, 2.75; 95% CI, 1.36 to 5.54), finance analysts (adjusted OR, 4.66; 95% CI, 1.90 to 11.40), corporate and computing managers (adjusted OR, 2.49; 95% CI, 1.04 to 5.98), and teachers (adjusted OR, 7.72; 95% CI, 1.86 to 32.10) were at a greater risk of infertility compared with "services and clerical workers." Using services and clerical workers as a reference group, certain occupations are at a higher risk for infertility. Higher work demands and possible electromagnetic field exposure could be contributory factors for infertility.

  18. Planetary wave seasonality from meteor wind measurements at 7.4° S and 22.7° S (United States)

    Araújo, L. R.; Lima, L. M.; Batista, P. P.; Clemesha, B. R.; Takahashi, H.


    In this study we have used wind observation data from the mesosphere and lower thermosphere (MLT) region, obtained from meteor radar measurements in São João do Cariri (7.4° S, 36.5° W) from July 2004 to December 2008 and in Cachoeira Paulista (22.7° S, 45.0° W) from January 2002 to July 2006 and from September 2007 to November 2008. From the spectral analysis it was possible to identify the presence of planetary-scale oscillations in the hourly winds for the two latitudes and to study their transient character, which allowed elaboration of a climatology of planetary oscillation signatures. Planetary waves with periods near 2-days, 6-7 days, and 16 days were focussed on in this study. The quasi-2-day waves in the meteoric winds showed a seasonal cycle, with intense amplitudes occurring after the austral summer solstice and extending until the end of the season. The vertical wavelengths of the 2-day wave over Cachoeira Paulista were larger than those at São João do Cariri. A possible modulation of the quasi-2-day wave amplitudes by the quasi-biennial oscillation (QBO) has been observed only at São João do Cariri. The 6-7 day oscillations presented more intense amplitudes during August-November but were present with lower amplitudes during March-April at both sites. The 6-7 day vertical wavelengths over São João do Cariri were larger than at Cachoeira Paulista. The 6-7 day amplitudes exhibited intra-seasonal and annual behavior, however, there was no clear evidence of QBO modulation. The 16-day oscillations showed a seasonal cycle at São João do Cariri, with amplifications from austral spring to mid-summer and weaker amplitudes from autumn until early winter, however, there was no clear seasonality over Cachoeira Paulista. The 16-day vertical wavelengths have assumed values of λz ~ 45-85 km over both sites. 16-day wave amplitudes at the two sites showed different long-term behaviors.

  19. Acute and chronic systemic CB1 cannabinoid receptor blockade improves blood pressure regulation and metabolic profile in hypertensive (mRen2)27 rats. (United States)

    Schaich, Chris L; Shaltout, Hossam A; Brosnihan, K Bridget; Howlett, Allyn C; Diz, Debra I


    We investigated acute and chronic effects of CB1 cannabinoid receptor blockade in renin-angiotensin system-dependent hypertension using rimonabant (SR141716A), an orally active antagonist with central and peripheral actions. In transgenic (mRen2)27 rats, a model of angiotensin II-dependent hypertension with increased body mass and insulin resistance, acute systemic blockade of CB1 receptors significantly reduced blood pressure within 90 min but had no effect in Sprague-Dawley rats. No changes in metabolic hormones occurred with the acute treatment. During chronic CB1 receptor blockade, (mRen2)27 rats received daily oral administration of SR141716A (10 mg/kg/day) for 28 days. Systolic blood pressure was significantly reduced within 24 h, and at Day 21 of treatment values were 173 mmHg in vehicle versus 149 mmHg in drug-treated rats (P < 0.01). This accompanied lower cumulative weight gain (22 vs. 42 g vehicle; P < 0.001), fat mass (2.0 vs. 2.9% of body weight; P < 0.05), and serum leptin (2.8 vs. 6.0 ng/mL; P < 0.05) and insulin (1.0 vs. 1.9 ng/mL; P < 0.01), following an initial transient decrease in food consumption. Conscious hemodynamic recordings indicate twofold increases occurred in spontaneous baroreflex sensitivity (P < 0.05) and heart rate variability (P < 0.01), measures of cardiac vagal tone. The beneficial actions of CB1 receptor blockade in (mRen2)27 rats support the interpretation that an upregulated endocannabinoid system contributes to hypertension and impaired autonomic function in this angiotensin II-dependent model. We conclude that systemic CB1 receptor blockade may be an effective therapy for angiotensin II-dependent hypertension and associated metabolic syndrome.

  20. An unusual patient with hypercalciuria, recurrent nephrolithiasis, hypomagnesemia and G227R mutation of Paracellin-1. An unusual patient with hypercalciuria and hypomagnesemia unresponsive to thiazide diuretics. (United States)

    Kutluturk, Faruk; Temel, Berna; Uslu, Bora; Aral, Ferihan; Azezli, Adil; Orhan, Yusuf; Konrad, Martin; Ozbey, Nese


    A 19-year-old female patient with hypercalciuria and recurrent nephrolithiasis/urinary tract infection unresponsive to thiazide type diuretics is presented. The patient first experienced nephrolithiasis at the age of 4 years. Afterwards, recurrent passages of stones and urinary tract infection occurred. On diagnostic evaluation at the age of 19 years, she also had hypocitraturia and hypomagnesemia. Her serum calcium concentrations were near the lower limit of normal (8.5-8.8 mg/dl; normal range: 8.5-10.5), her serum magnesium concentrations were 1.15-1.24 mg/dl (normal range: 1.4-2.5) and urinary calcium excretion was 900 mg/24 h. PTH concentrations were increased (110-156 pg/ml; normal range: 10-65). We tried to treat the patient with hydrochlorothiazide at a dose of 50 mg/day. During treatment with thiazide diuretics, PTH concentration remained high and the patient had recurrent urinary tract infections and passages of stones. Serum magnesium concentration did not normalize even under the parenteral magnesium infusion. Her mother had a history of nephrolithiasis 20 years ago. Severe hypomagnesemia in association with hypercalciuria/urinary stones is reported as a rare autosomal recessive disorder caused by impaired reabsorption of magnesium and calcium in the thick assending limp of Henle's loop. Recent studies showed that mutations in the CLDN16 gene encoding paracellin-1 cause the disorder. In exon 4, a homozygous nucleotide exchange (G679C) was identified for the patient. This results in a point mutation at position Glycine227, which is replaced by an Arginine residue (G227R). The mother was heterozygous for this mutation. G227 is located in the fourth transmembrane domain and is highly conserved in the claudin gene family. This case indicates the pathogenetic role of paracellin-1 mutation in familial hypomagnesemia with hypercalciuria and nephrocalcinosis and further underlines the risk of stone formation in heterozygous mutation carriers.

  1. In vivo expression of angiotensin-(1-7) lowers blood pressure and improves baroreflex function in transgenic (mRen2)27 rats. (United States)

    Garcia-Espinosa, Maria A; Shaltout, Hossam A; Gallagher, Patricia E; Chappell, Mark C; Diz, Debra I


    Transgenic (mRen2)27 rats are hypertensive with impaired baroreflex sensitivity for control of heart rate compared with Hannover Sprague-Dawley rats. We assessed blood pressure and baroreflex function in male hemizygous (mRen2)27 rats (30-40 weeks of age) instrumented for arterial pressure recordings and receiving into the cisterna magna either an Ang-(1-7) fusion protein or a control fusion protein (CTL-FP). The maximum reduction in mean arterial pressure achieved was -38 ± 7 mm Hg on day 3, accompanied by a 55% enhancement in baroreflex sensitivity in Ang-(1-7) fusion protein-treated rats. Both the high-frequency alpha index (HF-α) and heart rate variability increased, suggesting increased parasympathetic tone for cardiac control. The mRNA levels of several components of the renin-angiotensin system in the dorsal medulla were markedly reduced including renin (-80%), neprilysin (-40%), and the AT1a receptor (-40%). However, there was a 2-fold to 3-fold increase in the mRNA levels of the phosphatases PTP-1b and dual-specificity phosphatase 1 in the medulla of Ang-(1-7) fusion protein-treated rats. Our finding that replacement of Ang-(1-7) in the brain of (mRen2)27 rats reverses in part the hypertension and baroreflex impairment is consistent with a functional deficit of Ang-(1-7) in this hypertensive strain. We conclude that the increased mRNA expression of phosphatases known to counteract the phosphoinositol 3 kinase and mitogen-activated protein kinases, and the reduction of renin and AT1a receptor mRNA levels may contribute to the reduction in arterial pressure and improvement in baroreflex sensitivity in response to Ang-(1-7).

  2. Combined renin inhibition/(pro)renin receptor blockade in diabetic retinopathy--a study in transgenic (mREN2)27 rats. (United States)

    Batenburg, Wendy W; Verma, Amrisha; Wang, Yunyang; Zhu, Ping; van den Heuvel, Mieke; van Veghel, Richard; Danser, A H Jan; Li, Qiuhong


    Dysfunction of renin-angiotensin system (RAS) contributes to the pathogenesis of diabetic retinopathy (DR). Prorenin, the precursor of renin is highly elevated in ocular fluid of diabetic patients with proliferative retinopathy. Prorenin may exert local effects in the eye by binding to the so-called (pro)renin receptor ((P)RR). Here we investigated the combined effects of the renin inhibitor aliskiren and the putative (P)RR blocker handle-region peptide (HRP) on diabetic retinopathy in streptozotocin (STZ)-induced diabetic transgenic (mRen2)27 rats (a model with high plasma prorenin levels) as well as prorenin stimulated cytokine expression in cultured Müller cells. Adult (mRen2)27 rats were randomly divided into the following groups: (1) non-diabetic; (2) diabetic treated with vehicle; (3) diabetic treated with aliskiren (10 mg/kg per day); and (4) diabetic treated with aliskiren+HRP (1 mg/kg per day). Age-matched non-diabetic wildtype Sprague-Dawley rats were used as control. Drugs were administered by osmotic minipumps for three weeks. Transgenic (mRen2)27 rat retinas showed increased apoptotic cell death of both inner retinal neurons and photoreceptors, increased loss of capillaries, as well as increased expression of inflammatory cytokines. These pathological changes were further exacerbated by diabetes. Aliskiren treatment of diabetic (mRen2)27 rats prevented retinal gliosis, and reduced retinal apoptotic cell death, acellular capillaries and the expression of inflammatory cytokines. HRP on top of aliskiren did not provide additional protection. In cultured Müller cells, prorenin significantly increased the expression levels of IL-1α and TNF-α, and this was completely blocked by aliskiren or HRP, their combination, (P)RR siRNA and the AT1R blocker losartan, suggesting that these effects entirely depended on Ang II generation by (P)RR-bound prorenin. In conclusion, the lack of effect of HRP on top of aliskiren, and the Ang II-dependency of the ocular

  3. Analysis of the 227 bp short interspersed nuclear element (SINE) insertion of the promoter of the myostatin (MSTN) gene in different horse breeds. (United States)

    Dall'Olio, Stefania; Scotti, Emilio; Fontanesi, Luca; Tassinari, Marco


    The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs) generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot) and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81) and in the Thoroughbred (0.51), whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

  4. Analysis of the 227 bp short interspersed nuclear element (SINE insertion of the promoter of the myostatin (MSTN gene in different horse breeds

    Directory of Open Access Journals (Sweden)

    Stefania Dall'Olio


    Full Text Available The myostatin (MSTN gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic. The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81 and in the Thoroughbred (0.51, whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

  5. Development of separation technology for the removal of radium-223 from decayed thorium-227 in drug formulations. Material screening and method development. (United States)

    Frenvik, Janne Olsen; Kristensen, Solveig; Ryan, Olav B


    Targeted thorium conjugates are currently being investigated as a new class of alpha-radiopharmaceuticals. The natural decay of thorium-227 ((227)Th) results in the ingrowth of radium-223 ((223)Ra). Consideration must, therefore, be given to define acceptable limits of (223)Ra in the drug product at the time of dose administration. By effective sequestration of (223)Ra, we aim to improve the radiochemical purity and extend the effective user window of drug products containing (227)Th. (223)Ra is the first progeny of (227)Th and the only one with a long half-life (days). We have, therefore, focused on the removal of this specific species since the progenies of (223)Ra will have a very limited lifetime in the formulation once (223)Ra is removed. In this study, we investigated a multitude of materials for their ability to reduce the (223)Ra level by: (1) passive diffusion or (2) by cartridge filtration on gravity columns. In addition, we probe the compatibility of these materials in the presence of antibody trastuzumab to assess the level of protein binding and estimate the quenching of radiolysis by binding of radionuclides. A screening matrix of organic and inorganic materials was established, i.e. strontium and calcium alginate gel beads, distearoyl phosphatidylglycerol (DSPG) liposomes, ceramic hydroxyapatite, Zeolite UOP type 4A and cation exchange resins AG50W-X8 and SOURCE 30S. First, passive diffusional uptake of (223)Ra by suspended materials present in the formulation was measured as a decrease in sample radioactivity after separation. Second, selected materials were packed on gravity columns in order to evaluate the efficiency of column separation versus diffusional adsorption. The retention of (223)Ra and (227)Th were characterized by measuring the radioactivity in the eluate and on the columns. Finally, the compatibility between trastuzumab, as a selected model antibody, and suspensions of the binding materials was analyzed during storage of the drug

  6. Origem e avaliação de trigo 'Tapajós' (IAC 72, 'Anhumas' (IAC 227 e 'Yaco' (IAC 287 para o estado de São Paulo Evaluation of the agronomic and technologic characteristics of the wheat cultivars: IAC 72 Tapajós, IAC 227 Anhumas and IAC 287 Yaco in the State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    João Carlos Felício


    Full Text Available Estudou-se o comportamento de trigo 'Tapajós' (IAC 72, 'Anhumas' (IAC 227 e 'Yaco' (IAC 287 quanto à produtividade, às reações aos agentes causais das ferrugens-do-colmo e da-folha (em condição de campo e de casa de vegetação e à helmintosporiose, em experimentos instalados em solos corrigidos e não corrigidos em relação à acidez, em condição de sequeiro e de irrigação por aspersão, em diferentes regiões paulistas, no período de 1987-91. Os cultivares foram submetidos a testes para avaliação de tolerância a ferro, alumínio e manganês, empregando-se soluções nutritivas, em laboratório. Avaliaram-se também as qualidades físicas e reológicas das farinhas obtidas dos grãos desses cultivares e efetuou-se o teste final de panificação. Nas condições de sequeiro, os cultivares IAC 227 e IAC 72 foram mais produtivos em 20 e 5%, respectivamente, em relação ao BH 1146, tomado como controle. O IAC 287, nas mesmas condições de cultivo, apresentou uma produção de grãos 10% maior em relação à testemunha, Anahuac, e em condição de irrigação foi superior em 7 e 6% aos controles Anahuac e IAC 24 respectivamente. Para a ferrugem-do-colmo, em casa de vegetação, o IAC 72 demonstrou suscetibilidade às raças G20 e G21; o IAC 227, às raças G11, G15 e G17; o BH 1146 mostrou-se sensível e os cultivares IAC 287 e Anahuac, resistentes a todas as raças testadas. Os testes para reação a Puccinia recondita, em casa de vegetação, demonstraram suscetibilidade dos cultivares IAC 72, IAC 227, BH 1146 e Anahuac, enquanto o IAC 287 mostrou-se resistente. Esses resultados foram confirmados nos testes de campo. Todos os cultivares em estudo apresentaram-se sensíveis à ocorrência do agente causal da helmintosporiose. O IAC 72 revelou moderada suscetibilidade ao A1(3+ e Mn2+ e sensibilidade ao Fe2+; o IAC 227 foi tolerante a altas doses de A1(3+ e a Mn2+ e sensível ao Fe2+; o IAC 287, tolerante ao Fe2+ e Mn2+ e sens

  7. Central angiotensin-(1-7) improves vagal function independent of blood pressure in hypertensive (mRen2)27 rats. (United States)

    Nautiyal, Manisha; Shaltout, Hossam A; de Lima, Daniel C; do Nascimento, Kenia; Chappell, Mark C; Diz, Debra I


    Hypertensive transgenic (mRen2)27 rats with overexpression of the mRen2 gene have impaired baroreflex sensitivity for heart rate control and high nicotinamide adenine dinucleotide phosphate oxidase and kinase-to-phosphatase signaling activity in medullary tissue compared with normotensive Hannover Sprague-Dawley control rats. They also exhibit insulin resistance at a young age. To determine whether blocking angiotensin II actions, supplementing angiotensin-(1-7), or scavenging reactive oxygen species in brain differentially alters mean arterial pressure, baroreflex sensitivity, or metabolic function, while altering medullary signaling pathways in these animals, we compared intracerebroventricular infusions of the angiotensin II type 1 receptor antagonist candesartan (4 μg/5 μL/h), angiotensin-(1-7) (0.1 μg/5 μL/h), a reactive oxygen species scavenger tempol (25 μg/5 μL/h), or artificial cerebrospinal fluid (5 μL/h) for 2 weeks. Mean arterial pressure was reduced in candesartan-treated rats without significantly improving the vagal components of baroreflex function or heart rate variability. In contrast, angiotensin-(1-7) treatment significantly improved the vagal components of baroreflex function and heart rate variability at a dose that did not significantly lower mean arterial pressure. Tempol significantly reduced nicotinamide adenine dinucleotide phosphate oxidase activity in brain dorsal medullary tissue but had no effect on mean arterial pressure or autonomic function. Candesartan tended to reduce fat mass, but none of the treatments significantly altered indices of metabolic function or mitogen-activated protein kinase signaling pathways in dorsal medulla. Although additional dose response studies are necessary to determine the potential maximal effectiveness of each treatment, the current findings demonstrate that blood pressure and baroreflex function can be essentially normalized independently of medullary nicotinamide adenine dinucleotide

  8. Experimental determination of the specific heat capacity c sub p and the differential Joule-Thomson effect. mu. of FFC R227 (C sub 3 HF sub 7 ). Experimentelle Bestimmung der spezifischen Waermekapazitaet c sub p und des differentiellen Joule-Thomson-Effektes. mu. des chlorfreien Arbeitsstoffes R227 (C sub 3 HF sub 7 )

    Energy Technology Data Exchange (ETDEWEB)

    Wirbser, H.; Ernst, G.; Braeuning, G. (Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Technische Thermodynamik)


    To prove the suitability of R227 (C{sub 3}HF{sub 7}) as a substitute for chlorinated hydrocarbons, exact measurements of its c{sub p} and {mu} were performed at temperatures between -20deg C and 150deg C and at pressures up to 15.0 MPa at Institut fuer Technische Thermodynamik (University of Karlsruhe). Measurements to determine the ideal share of the specific heat capacity c{sub p}{sup 0} were performed using low-pressure equipment. All other measurements were performed using high-pressure and high-temperature systems. Using the high-pressure system, the specific heat capacity c{sub p} of R227 in the liquid and supercritical phases was measured at 117 points, and the differential Joule-Thomson effect {mu} in the liquid and supercritical phases was measured at 66 points. These selectively chosen phase points allowed an easy calculation of the enthalpy function h(p, T). (orig./HW).

  9. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)



    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  10. Chronic estrogen treatment in female transgenic (mRen2)27 hypertensive rats augments endothelium-derived nitric oxide release. (United States)

    Li, P; Ferrario, C M; Ganten, D; Brosnihan, K B


    Postmenopausal estrogen replacement therapy is associated with a reduction in cardiovascular events in women, but the mechanisms for this protection are unclear, especially in hypertensive subjects. In this study we investigated the effects of 17beta-estradiol (E2) treatment on blood pressure and endothelial function of transgenic [(mRen2)27] hypertensive and normotensive rats. Thirty female transgenic negative [Tg(-)] and hypertensive positive [Tg(+)] rats were ovariectomized and received either E2 (1.5 mg/rat, subcutaneously, for 3 weeks) or placebo. Chronic 17beta-estradiol treatment lowered mean blood pressure in both Tg hypertensive (159 +/- 4 v 145 +/- 4 mm Hg, P calcium ionophore (A23187)-induced endothelium-dependent relaxation was less potent in Tg(+) as compared to Tg(-) rats and was enhanced by E2 treatment only in Tg(+) animals. There were no differences in the vasodilator responses elicited by sodium nitroprusside. Removal of endothelium and blockade of NO production abolished the endothelium-dependent vasodilation. The selective NO synthase inhibitor, N(G)-monomethyl-L-arginine (LMMNA), was used to evaluate indirectly the basal contribution of NO in vascular rings. The response to LMMNA was attenuated in untreated Tg(+) as compared to Tg(-) rats. E2 treatment augmented the contraction response to NOS inhibition in both Tg(+) and Tg(-) rats, resulting in a response in Tg(+) rats that was no different from Tg(-) rats. These results indicate that untreated, surgically ovariectomized hypertensive rats show deficiencies in endothelial function, which can be improved by estrogen replacement.

  11. Discovery of Soft Spectral Component and Transient 22.7s Quasi Periodic Oscillations of SAX J2103.5+4545

    CERN Document Server

    Inam, S C; Swank, J H; Stark, M J


    XMM-Newton observed SAX J2103.5+4545 on January 6, 2003, while RXTE was monitoring the source. Using RXTE-PCA dataset between December 3, 2002 and January 29, 2003, the spin period and spin-up rate at the date of XMM-Newton observations were found to be $\\simeq 354.794$ s and $\\simeq 7.4\\times 10^{-13}$ Hz/s, respectively. The XMM-Newton observation revealed a quasi-periodic oscillation (QPO) corresponding to a mean period of 22.7s, the first QPO reported for this source, enabling us to estimate the Keplerian frequency at the inner radius of the disk to be $\\simeq 4.40\\times 10^{-3}$ Hz or $\\simeq 4.12\\times 10^{-3}$ Hz using a Keplerian or a beat frequency model. Using these frequencies, and a simple accretion disk model, for which the total accretion torque is similar to the material torque, we found the magnetic field of the neutron star to be $\\sim 7\\times 10^{12}$ Gauss and and the distance to the source to be $\\sim 3.2$ kpc. We also discovered a soft component modeled as a blackbody with kT $\\sim 1.90$ ...

  12. Urothelium muscarinic activation phosphorylates CBS(Ser227) via cGMP/PKG pathway causing human bladder relaxation through H2S production. (United States)

    d'Emmanuele di Villa Bianca, Roberta; Mitidieri, Emma; Fusco, Ferdinando; Russo, Annapina; Pagliara, Valentina; Tramontano, Teresa; Donnarumma, Erminia; Mirone, Vincenzo; Cirino, Giuseppe; Russo, Giulia; Sorrentino, Raffaella


    The urothelium modulates detrusor activity through releasing factors whose nature has not been clearly defined. Here we have investigated the involvement of H2S as possible mediator released downstream following muscarinic (M) activation, by using human bladder and urothelial T24 cell line. Carbachol stimulation enhances H2S production and in turn cGMP in human urothelium or in T24 cells. This effect is reversed by cysthationine-β-synthase (CBS) inhibition. The blockade of M1 and M3 receptors reverses the increase in H2S production in human urothelium. In T24 cells, the blockade of M1 receptor significantly reduces carbachol-induced H2S production. In the functional studies, the urothelium removal from human bladder strips leads to an increase in carbachol-induced contraction that is mimicked by CBS inhibition. Instead, the CSE blockade does not significantly affect carbachol-induced contraction. The increase in H2S production and in turn of cGMP is driven by CBS-cGMP/PKG-dependent phosphorylation at Ser(227) following carbachol stimulation. The finding of the presence of this crosstalk between the cGMP/PKG and H2S pathway downstream to the M1/M3 receptor in the human urothelium further implies a key role for H2S in bladder physiopathology. Thus, the modulation of the H2S pathway can represent a feasible therapeutic target to develop drugs for bladder disorders.

  13. Vapor-liquid Equilibrium Properties of New Binary Mixture Refrigerant(R290+R227ea)%新型二元混合制冷剂(R290+R227ea)气液相平衡研究

    Institute of Scientific and Technical Information of China (English)

    陈秀萍; 祁影霞; 赵胜喜; 张华


    混合制冷剂气液相平衡数据是新型制冷剂的热力学参数的重要组成部分。理论预测和实验测定混合工质的气液相平衡数据成为研究混合工质替代问题的一项迫切需要。本文基于量子化学理论,采用真实溶剂似导体模型( COSMO-RS)模拟了二元混合制冷剂(R290+R227ea)气液相平衡性质,模拟的结果与实验结果有很好的一致性。表明运用COSMO-RS模型预测混合制冷剂的气液相平衡是可行的。%The vapor-liquid equilibrium data is an important part of thermodynamic parameters of a new refrigerant. Theoretical predic-tions and experimental measurements of vapor-liquid equilibrium data of a new mixed working fluid become an urgent need for alternative refrigerant researches. The article is based on the theory of quantum chemistry . The vapor-liquid equilibrium properties of binary refriger-ant(R290+R227ea)were modeled by COSMO-RS simulations. The simulation results could accord with the data of experiments well. It shows that COSMO-RS simulation method is feasible to predict the vapor-liquid equilibrium properties of mixture refrigerants.

  14. Sex differences in baroreflex sensitivity, heart rate variability, and end organ damage in the TGR(mRen2)27 rat. (United States)

    Johnson, Megan S; DeMarco, Vincent G; Heesch, Cheryl M; Whaley-Connell, Adam T; Schneider, Rebecca I; Rehmer, Nathan T; Tilmon, Roger D; Ferrario, Carlos M; Sowers, James R


    The aim of this investigation was to evaluate sex differences in baroreflex and heart rate variability (HRV) dysfunction and indexes of end-organ damage in the TG(mRen2)27 (Ren2) rat, a model of renin overexpression and tissue renin-angiotensin-aldosterone system overactivation. Blood pressure (via telemetric monitoring), blood pressure variability [BPV; SD of systolic blood pressure (SBP)], spontaneous baroreflex sensitivity, HRV [HRV Triangular Index (HRV-TI), standard deviation of the average NN interval (SDNN), low and high frequency power (LF and HF, respectively), and Poincaré plot analysis (SD1, SD2)], and cardiovascular function (pressure-volume loop analysis and proteinuria) were evaluated in male and female 10-wk-old Ren2 and Sprague Dawley rats. The severity of hypertension was greater in Ren2 males (R2-M) than in Ren2 females (R2-F). Increased BPV, suppression of baroreflex gain, decreased HRV, and associated end-organ damage manifested as cardiac dysfunction, myocardial remodeling, elevated proteinuria, and tissue oxidative stress were more pronounced in R2-M compared with R2-F. During the dark cycle, HRV-TI and SDNN were negatively correlated with SBP within R2-M and positively correlated within R2-F; within R2-M, these indexes were also negatively correlated with end-organ damage [left ventricular hypertrophy (LVH)]. Furthermore, within R2-M only, LVH was strongly correlated with indexes of HRV representing predominantly vagal (HF, SD1), but not sympathetic (LF, SD2), variability. These data demonstrated relative protection in females from autonomic dysfunction and end-organ damage associated with elevated blood pressure in the Ren2 model of hypertension.

  15. Testing nuclear forces by polarization transfer coefficients in d(p,p)d and d(p,d)p reactions at Ep=22.7 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Evgeny Epelbaum


    The proton to proton polarization transfer coefficients K{sub x}{sup x'}, K{sub y}{sup y'}, K{sub z}{sup x'} and the proton to deuteron polarization transfer coefficients K{sub x}{sup x'}, K{sub y}{sup y'}, K{sub z}{sup x'}, K{sub x}{sup y'z'}, K{sub y}{sup z'z'}, K{sub z}{sup y'z'}, K{sub y}{sup x'z'} and K{sub y}{sup x'x'-y'y'} have been measured in d({rvec p}, {rvec p})d and d({rvec p}, {rvec d})p reactions at E{sub p}{sup lab} = 22.7 MeV, respectively. The data have been compared to predictions of modern nuclear forces obtained by solving the three-nucleon Faddeev equations in momentum space. Realistic (semi) phenomenological nucleon-nucleon potentials combined with model three-nucleon forces and modern chiral nuclear forces have been used. The AV18, CD Bonn, Nijm I and II nucleon-nucleon interactions have been applied alone or combined with the Tucson-Melbourne 99 three-nucleon force, adjusted separately for each potential to reproduce the triton binding energy. For the AV18 potential also the Urbana IX three-nucleon force have been used. In addition chiral NN potentials in the next-to-leading-order and chiral two- and three-nucleon forces in the next-to-next-to-leading-order have been applied. Only when three-nucleon forces are included a satisfactory description of all data results. For the chiral approach the restriction to the forces in the next-to-leading order is insufficient. Only when going over to the next-to-next-to-leading order one gets a satisfactory description of the data, similar to the one obtained with the (semi) phenomenological forces.

  16. The functional role of PI3K in maintenance of blood pressure and baroreflex suppression in (mRen2)27 and mRen2.Lewis rat. (United States)

    Logan, Exazevia M; Aileru, Azeez A; Shaltout, Hossam A; Averill, David B; Diz, Debra I


    The phosphatidylinositol 3-kinase (PI3K)-dependent signaling pathway in brain of spontaneously hypertensive rats, but not Wistar-Kyoto (WKY) rats, contributes to elevated mean arterial pressure (MAP). The role of PI3K in the regulation of blood pressure or autonomic function in the nucleus tractus solitarii (NTS) is yet to be established in other Ang II-dependent models of hypertension. Thus, we microinjected PI3K inhibitors, wortmannin or LY294002, into the NTS, and measured MAP, baroreflex sensitivity (BRS) for heart rate (HR) control, and HR variability (HRV) in mRen2.Lewis congenic and (mRen2)27 transgenic rats. Bilateral NTS microinjections of wortmannin (100 nmol/L; 50 nL) reduced MAP in (mRen2)27 and mRen2.Lewis rats (33 ± 5 mm Hg, n = 7, and 32 ± 6 mm Hg, n = 9, respectively) for approximately 90 minutes. Spectral and sequence analysis showed improvements in spontaneous BRS and HRV (50%-100%) after treatment in both hypertensive strains. Injections of wortmannin into NTS of Hannover Sprague-Dawley or Lewis control rats failed to alter MAP, BRS, or HRV. In mRen2.Lewis, but not in control Lewis rats, LY294002 (50 μmole/L) reduced MAP and increased BRS and HRV similar to wortmannin. Thus, the pharmacologic blockade of the PI3K signaling pathway in NTS reveals an important contribution to resting MAP and BRS in rats with overexpression of the Ren2 gene.

  17. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    Energy Technology Data Exchange (ETDEWEB)

    Aleissa, Khalid A.; Almasoud, Fahad I.; Islam, Mohammed S. [Atomic Energy Research Institute, King Abdul Aziz City for Science and Technology, P.O. Box 6086, Riyadh 11442 (Saudi Arabia); L' Annunziata, Michael F. [IAEA Expert, Montague Group, P.O. Box 5033, Oceanside, CA 92052-5033 (United States)], E-mail:


    The activities of {sup 228}Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide {sup 228}Ac. The radium was pre-concentrated on MnO{sub 2} and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter {sup 228}Ra({sup 228}Ac), the daughter nuclide {sup 228}Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by {sup 228}Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9{+-}0.1% was measured for {sup 228}Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317{+-}0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of {sup 228}Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for {sup 228}Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure {sup 228}Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  18. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228. (United States)

    Aleissa, Khalid A; Almasoud, Fahad I; Islam, Mohammed S; L'Annunziata, Michael F


    The activities of (228)Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide (228)Ac. The radium was pre-concentrated on MnO(2) and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter (228)Ra((228)Ac), the daughter nuclide (228)Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by (228)Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9+/-0.1% was measured for (228)Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317+/-0.013cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of (228)Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for (228)Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure (228)Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  19. 49 CFR 227.5 - Definitions. (United States)


    ... second or less. Decibel (dB) means a unit of measurement of sound pressure levels. dB(A) means the sound pressure level in decibels measured on the A-weighted scale. Employee means any individual who is engaged... this part. Exchange rate means the change in sound level, in decibels, which would require halving...

  20. 40 CFR 227.29 - Initial mixing. (United States)


    ... phases of a waste which occurs within four hours after dumping. The limiting permissible concentration..., theoretical oceanic turbulent diffusion relationships may be applied to known characteristics of the waste and... particulate phases of the dumped waste may be assumed to be evenly distributed after four hours over a column...

  1. 49 CFR 372.227 - Syracuse, NY. (United States)


    ... York Highway 192, thence easterly along New York Highway 192 to junction new New York Highway 48, thence northerly along new New York Highway 48 to junction New York Highway 213, thence easterly along New York Highway 213 to junction New York Highway 213A, thence easterly along New York Highway 213A...

  2. QTL Information Table: 227 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Pa-In, N., Vongsaprom, C., and Toojinda, T. (2002). Quantitative Trait Loci Associated with Leaf and Neck Blast Resistance in Recomb...inant Inbred Line Population of Rice (Oryza Sativa). DNA

  3. 49 CFR 227.121 - Recordkeeping. (United States)


    ..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating... person's representative upon written authorization by such employee; (iii) Make exposure measurement... exposure measurement records for specific locations available to regional or national labor...

  4. 49 CFR 227.119 - Training program. (United States)


    ..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating... concerning the expected range of workplace noise exposure levels associated with major categories of...

  5. 22 CFR 227.105 - Definitions. (United States)


    ..., any communication to or appearance before an officer or employee or any agency, a Member of Congress..., association, authority, firm, partnership, society, State, and local government, regardless of whether...

  6. Danish Media coverage of 22/7

    DEFF Research Database (Denmark)

    Hervik, Peter; Boisen, Sophie


    When the two terrorist attacks in Norway took place and the identity of terrorist, Anders Behring Breivik (ABB) was revealed, attention turned to his network relations and shared ideas with Danish radical right wing communities, including the Danish People’s Party. In this article, we focus on ABB...

  7. Reference: 227 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available AtGA3ox4 but not AtGA20ox3 also showed their signals at the rim of the developing embryo. The alpha-amylase ...gene, Amy3, which responded to gibberellin, was mainly expressed in the developing

  8. 47 CFR 1.227 - Consolidations. (United States)


    ... application. (ii) Domestic public fixed and public mobile. See Rule § 21.31 of this chapter for the... as to amendments of applications. (iii) Public coast stations (Maritime mobile service). See... such action will best conduce to the proper dispatch of business and to the ends of...

  9. 7 CFR 227.2 - Definitions. (United States)


    ... school grade or under operating under public or nonprofit private ownership in a single building or... handicapped, and unmarried mothers and their infants; group homes; halfway houses; orphanages; temporary...

  10. 12 CFR 227.12 - Definitions. (United States)


    ..., commission, bonus, or otherwise, including periodic payments pursuant to a pension, retirement, or disability... include: (1) Works of art; (2) Electronic entertainment equipment (other than one television and one...

  11. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  12. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  13. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)



    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)


    Institute of Scientific and Technical Information of China (English)

    周程; 孙恋君


    利用高纯锗γ谱仪对两个稀土产品氯化镧和氯化钇的样品进行能谱分析,研究经湿法冶炼工艺后的稀土产品中放射性核素的活度变化.结果表明,样品中存在天然放射性钍系和锕-铀系的核素,以及天然放射性核素~(138)La和~(176)Lu,但两个样品中所含的放射性核素不相同.氯化镧产品中锕-铀系和钍系核素放射性未达平衡,其主要子体~(224)Ra和~(227)Th的含量随时间发生明显变化,约60天达到平衡;而氯化钇产品没有这种现象.%This paper describes a study on raidoactivity change of rare-earth products after hydrometallurgy technology,using HPGe gamma spectrometer to analyze two rare earth products (LaCl_3 and YCl_3).The results show that in the two samples exist natural radionuclides of thorium series and actinium-uranium series as well as other natural radionuclides 138 La and 176 Lu.In the sample of lanthanum chloride the radioactivity of actinium-uranium series and thorium series has not reached balance,the contents of their main progenies ~(226)Ra and ~(227)Th obviously changes with the time,reaching balance 60 days later,while YCl_3 keeps stability.

  15. 1935 15' Quad #227 Aerial Photo Mosaic Index (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  16. Dicty_cDB: AFM227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DKEYKEGEKKFCVS*slsn nnrshcs*sflhfgl*wslg*gri**srsicskkykigkkcn*nfriissrflxrgsgii s Translated Amino Acid seq...SRSFGDKEYKEGEKKFCVS*slsn nnrshcs*sflhfgl*wslg*gri**srsicskkykigkkcn*nfriissrflxrgsgii s Frame B: iiifieiyy*n

  17. 7 CFR 2.27 - Office of Administrative Law Judges. (United States)


    ... Seed Act, as amended (7 U.S.C. 1551 et seq.); the (Laboratory) Animal Welfare Act, as amended (7 U.S.C....); the Forest Resources Conservation and Shortage Relief of 1990 (16 U.S.C. 630 et seq.); and any other...

  18. 227-IJBCS-Article-Pauline Bationo-Kando

    African Journals Online (AJOL)


    caractéristiques des fruits mais aussi entre celles des fruits et celles des noyaux. Les fortes ... fruits et le poids des graines d'autre part, montrent que la taille est un bon indicateur de production de pulpe et de graine. ...... Negev desert of Israel.

  19. Dicty_cDB: SSE227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kkk Translated Amino Acid sequence (All Frames) Frame A: kicsksg*pni**figr**sm*igitttnkhk*windfp*cfitrgkl*hv...m clone. 46 0.21 4 AC140109 |AC140109.1 Mus musculus chromosome UNK clone RP24-156A17, WORKING DRAFT SEQUENC...E, 34 unordered pieces. 40 0.43 2 AC135118 |AC135118.2 Mus musculus chromosome UN...K clone RP24-450N10, WORKING DRAFT SEQUENCE, 14 unordered pieces. 40 0.44 2 AC139942 |AC139942.2 Mus musculus chromo...some UNK clone RP23-447N11, WORKING DRAFT SEQUENCE, 5 unordered pieces. 40 0.48 2 AL031536 |AL031536.2 S.pombe chromo

  20. Dicty_cDB: SSL227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available developmental stages Lycopersicon esculentum cDNA, mRNA sequence. 34 0.79 2 BQ515661 |BQ515661.1 EST623076 Generation...60 |BQ515660.1 EST623075 Generation of a set of potato cDNA clones for microarray

  1. Dicty_cDB: CHC227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GGTA TCCCACCAGATCT sequence update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxxxxxxxxxi*xxx...LTGKTITLE VEGSDNIENVKTKIQDKEGIPPD Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxxi*xxx...ENVKTKIQDKEGIPPD Frame B: ---xxmxxxxxxxxxixxxfsxxxkxwyxxfcxnpxw*xynxxklkvlxxlrmlk...pkxkt kkvfhqinxvsfspvxnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhxk lkvvttlrm*kqkfktkkvshqi Frame C: ---xxxxxxxxxkxxsxxxlvxxxxggxxx

  2. 7 CFR 227.1 - General purpose and scope. (United States)


    ... carry out a nutrition information and education program through a system of grants to State agencies to provide for (a) the nutritional training of educational and foodservice personnel, (b) the...

  3. 7 CFR 227.30 - Responsibilities of State agencies. (United States)


    ....30 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Agency... nutrition or public health programs; foodservice operations for children; or community action or...

  4. 49 CFR 227.109 - Audiometric testing program. (United States)


    ... occupational noise in excess of the action level. Hearing protectors may be used as a substitute for the... hearing protectors offering greater attenuation, if necessary, and shall be required to use them. (iii)...

  5. 22 CFR 227.500 - Secretary of Defense. (United States)


    ... action from the prohibition whenever the Secretary determines, in writing, that such an exemption is in the national interest. The Secretary shall transmit a copy of each such written exemption to Congress... regulations to implement paragraph (a) of this section. ...

  6. 14 CFR 135.227 - Icing conditions: Operating limitations. (United States)


    ... OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT... aircraft that has frost, ice, or snow adhering to any rotor blade, propeller, windshield, wing, stabilizing... may take off an airplane any time conditions are such that frost, ice, or snow may reasonably...

  7. 227 Globalization, Culture and Human Development in the 21 ...

    African Journals Online (AJOL)

    The world has been described as a global village due to enhanced global communication and interaction ... impact of globalization on Nigerian culture and the effect on .... This gives opportunity to a global access of Nigeria's culture. Modern ...

  8. 49 CFR 227.103 - Noise monitoring program. (United States)


    ..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating... made under typical operating conditions using: (i) A sound level meter conforming, at a minimum, to the...-weighted SLOW response. (3) All instruments used to measure employee noise exposure shall be calibrated...

  9. 49 CFR 227.105 - Protection of employees. (United States)


    ..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating... appendix A of this part. (b) In assessing whether exposures exceed 115 dB(A), as set forth in paragraph (a) of this section and appendix A to this part, the apparent source of the noise exposures shall...

  10. 46 CFR 10.227 - Requirements for renewal. (United States)


    ... applicable Rules of the Road open-book exercise. (ii) The qualification requirements for renewal of radar... the applicant after cancellation; (5) Evidence of having passed a chemical test for dangerous drugs or... evidence of at least one year of sea service during the past five years; (B) Pass a comprehensive,...

  11. Dicty_cDB: SFG227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n Ankara... 35 2.1 DQ813662_67( DQ813662 |pid:none) Anticarsia gemmatalis nucleopolyh... 35 3.6 AJ306290_1( AJ306290 |pid:none) Toxoc...ara canis partial mRNA for my... 35 3.6 CP000492_904( CP000492 |pid:none) Chlorobiu

  12. Dicty_cDB: VFF227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Ov3MCAM56B08 5', mRNA sequence. 54 3e-04 2 AW355195 |AW355195.1 PFOvAFCB597K Onchocerca volvulus adult female cDNA following (SAW98PF-OvAF) Onchocerca volvulus cDNA clone PFOvAFCB597 5', mRNA sequence. 54

  13. 48 CFR 227.7103-5 - Government rights. (United States)


    ..., component, or process, including logistics support and other factors which may have relevance for a... adequate competition among the sources; or (iii) Reverse engineering, or providing items from Government... reverse engineering....

  14. 40 CFR 180.227 - Dicamba; tolerances for residues. (United States)


    ... removed 0.04 Corn, sweet, stover 0.50 Cotton, undelinted seed 0.2 Grass, forage, fodder and hay, group 17, forage 125.0 Grass, forage, fodder and hay, group 17, hay 200.0 Millet, proso, forage 90.0 Millet, proso....0 Oat, straw 30.0 Rye, forage 90.0 Rye, grain 2.0 Rye, straw 30.0 Sorghum, grain, forage 3.0...

  15. 22 CFR 227.205 - Professional and technical services. (United States)


    ... to law as a condition for receiving that Federal contract, grant, loan, or cooperative agreement. (b... cooperative agreement or an extension, continuation, renewal, amendment, or modification of a Federal contract, grant, loan, or cooperative agreement if payment is for professional or technical services...

  16. 227 Home Economics Students' Perception of the Relevance of ...

    African Journals Online (AJOL)

    Nekky Umera

    The data collected were analysed using simple frequency counts and percentages. ... Arubayi (1986) that “the opinion of those who eat the dinner should be ... industrialization, the Clothing needs of individuals and family members are.

  17. Viral erythrocytic necrosis: Chapter 2.2.7 (United States)

    Winton, James R.; Hershberger, Paul K.


    Viral erythrocytic necrosis (VEN), originally termed piscine erythrocytic necrosis, is a condition that has been reported to affect the red blood cells (RBCs) of many species of marine and anadromous fishes in both the Atlantic and Pacific Oceans (Nicholson and Reno 1981; Smail 1982; Wolf 1988; Dannevig and Thorud 1999). Fish with VEN may develop a severe anemia that can reduce their stamina, predispose them to other infections or increase the impact of other stressors (MacMillan et al. 1980; Nicholson and Reno 1981; Meyers et al. 1986; Haney et al. 1992) resulting in population-scale impacts in susceptible species (Hershberger et al. 2009).

  18. 25 CFR 227.17 - Rates of rents and royalties. (United States)


    ... gasoline, and/or all other hydrocarbon substances produced and saved from the land leased, save and except... the Interior, be calculated on the basis of the highest price paid or offered (whether calculated on... same gravity, and gas, and/or natural gasoline, and/or all other hydrocarbon substances produced...

  19. Dicty_cDB: VHA227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um chromoso... 33 7.5 AY698035_1( AY698035 |pid:none) Desmognathus marmoratus isolate 69... 33 7.5 AY612348_...1( AY612348 |pid:none) Desmognathus quadramaculatus vouch... 33 9.9 AY698038_1( AY698038 |pid:none) Desmognathus marmor...atus isolate T0... 33 9.9 AY612344_1( AY612344 |pid:none) Desmognathus marmor...atus voucher KH... 33 9.9 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 33 9.

  20. Dicty_cDB: SFF227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available donnay Vitis vinifera cDNA clone VVB158G03 5, mRNA sequence. 64 4e-07 2 CA813481 |CA813481.1 CA48LN10IF-E8 Caberne...28 |CB341828.2 CA32EN0002_IIIbF_E01 Cabernet Sauvignon Leaf - CA32EN Vitis vinife

  1. 7 CFR 227.36 - Requirements of needs assessment. (United States)


    ... children and areas where nutrition education may assist in positive changes; (15) Problems encountered in..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Coordinator... listed below to enable State agencies to determine their nutrition education and training needs for...

  2. 30 CFR 227.105 - What are the hearing procedures? (United States)


    ... conduct one or more public hearings for fact finding regarding your ability to assume the delegated... present testimony and written information in support of your proposal; (f) Other persons may attend the... you that your delegation proposal is complete, MMS will schedule a hearing on your proposal, if...

  3. Dosimetric and functional analysis of 227 patients treated by permanents prostate implants; Analyse dosimetrique et fonctionnelle de 227 patients traites par implants prostatiques permanents

    Energy Technology Data Exchange (ETDEWEB)

    Champeaux-Orange, E.; Wachter, T. [CHR, 45 - Orleans (France); Le Floch, O.; Haillot, O.; Peneau, M.; Raynaud-Bougnoux, A. [CHU, 37 - Tours (France)


    The brachytherapy of prostate by permanent implants is included in the armamentarium of localized prostate cancers with external radiotherapy and radical prostatectomy. The quality evaluation of implantation is essential for the patient and the team managing him. Our retrospective work consisted in analysing the whole of dosimetry data and urinary, digestive and sexual functional results of patients treated in our centers. conclusion: the post-implantation dosimetry analysis is essential to improve the technique and to understand the evolutions. The method of scanning evaluation is difficult but is currently the most used by its accessibility. The low urinary, rectal and sexual morbidity of the brachytherapy makes of this treatment an attractive technique for the patients should be well selected. (N.C.)

  4. Development of an Ultra-Low Background Liquid Scintillation Counter for Trace Level Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Erchinger, Jennifer L.; Orrell, John L.; Aalseth, Craig E.; Bernacki, Bruce E.; Douglas, Matthew; Finn, Erin C.; Fuller, Erin S.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Panisko, Mark E.; Shaff, Sarah M.; Warren, Glen A.; Wright, Michael E.


    Low-level liquid scintillation counting (LSC) has been established as one of the radiation detection techniques useful in elucidating environmental processes and environmental monitoring around nuclear facilities. The Ultra-Low Background Liquid Scintillation Counter (ULB-LSC) under construction in the Shallow Underground Laboratory at Pacific Northwest National Laboratory aims to further reduce the MDAs and/or required sample processing. Through layers of passive shielding in conjunction with an active veto and 30 meters water equivalent overburden, the background reduction is expected to be 10 to 100 times below typical analytic low-background liquid scintillation systems. Simulations have shown an expected background of around 14 counts per day. A novel approach to the light collection will use a coated hollow light guide cut into the inner copper shielding. Demonstration LSC measurements will show low-energy detection, spectral deconvolution, and alpha/beta discrimination capabilities, from trials with standards of tritium, strontium-90, and actinium-227, respectively. An overview of the system design and expected demonstration measurements will emphasize the potential applications of the ULB-LSC in environmental monitoring for treaty verification, reach-back sample analysis, and facility inspections.

  5. Pulse-shape discrimination and energy quenching of alpha particles in Cs$_2$LiLaBr$_6$:Ce$^{3+}$

    CERN Document Server

    Mesick, Katherine E; Stonehill, Laura C


    Cs$_2$LiLaBr$_6$:Ce$^{3+}$ (CLLB) is an elpasolite scintillator that offers excellent linearity and gamma-ray energy resolution and sensitivity to thermal neutrons with the ability to perform pulse-shape discrimination (PSD) to distinguish gammas and neutrons. Our investigation of CLLB has indicated the presence of intrinsic radioactive alpha background that we have determined to be from actinium contamination of the lanthanum component. We measured the pulse shapes for gamma, thermal neutron, and alpha events and determined that PSD can be performed to separate the alpha background with a moderate figure of merit of 0.98. We also measured the electron-equivalent-energy of the alpha particles in CLLB and simulated the intrinsic alpha background from $^{227}$Ac to determine the quenching factor of the alphas. A linear quenching relationship $L_{\\alpha} = E_{\\alpha} \\times q + L_0$ was found at alpha particle energies above 5 MeV, with a quenching factor $q = 0.71$ MeVee/MeV and an offset $L_0 = - 1.19$ MeVee.

  6. 49 CFR Appendix F to Part 227 - Calculations and Application of Age Corrections to Audiograms (United States)


    ...: Employee is a 32-year-old male. The audiometric history for his right ear is shown in decibels below... age correction). Table F-1—Age Correction Values in Decibels for Males Years Audiometric test... Correction Values in Decibels for Females Years Audiometric test frequencies(Hz) 1000 2000 3000 4000 6000...

  7. 48 CFR 252.227-7013 - Rights in technical data-Noncommercial items. (United States)


    ... the nature of the item, component, or process, and the state of the art. To be considered “developed... development of the items, components, or processes or creation of the data described in paragraph (b)(2)(i)(B..., processes, flow charts, formulae and related material that would enable the software to be reproduced...

  8. 48 CFR 1253.227-70 - Conveyance of invention rights acquired by the Government. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Conveyance of invention... invention rights acquired by the Government. The following form is prescribed as a means for contractors to report inventions made in the course of contract performance, as specified in 1227.305-4: DD Form 882...

  9. 48 CFR 952.227-11 - Patent rights-retention by the contractor (short form). (United States)


    ...) Nonprofit organization means a university or other institution of higher education or an organization of the... process or method; or to operate, in the case of a machine or system; and, in each case, under such... parties, in all subcontracts, regardless of tier, for experimental, developmental, or research work to...

  10. 48 CFR 252.227-7038 - Patent Rights-Ownership by the Contractor (Large Business). (United States)


    ... paragraph (c) of this clause and the agency requests title within 60 days after learning of the Contractor's..., the subject invention throughout the world. (e) Contractor action to protect the Government's interest...) Serial number and title. (iii) A copy of any patent application (including an English-language version if...

  11. 48 CFR 52.227-17 - Rights in Data-Special Works. (United States)


    ... in Data—Special Works (DEC 2007) (a) Definitions. As used in this clause— Data means recorded... financial, administrative, cost or pricing, or management information. Unlimited rights means the rights...

  12. 48 CFR 52.227-14 - Rights in Data-General. (United States)


    ... appropriate alternates: Rights in Data—General (DEC 2007) (a) Definitions. As used in this clause— Computer... contract administration, such as financial, administrative, cost or pricing, or management information..., administrative, cost or pricing, or management data or other information incidental to contract...

  13. 48 CFR 52.227-20 - Rights in Data-SBIR Program. (United States)


    ... Data—SBIR Program (DEC 2007) (a) Definitions. As used in this clause— Computer database or database... financial, administrative, cost or pricing or management information. Form, fit, and function data means... include computer software or financial, administrative, cost or pricing, or management data or...

  14. 48 CFR 952.227-13 - Patent rights-acquisition by the Government. (United States)


    ... following clause: Patent Rights—Acquisition by the Government (SEP 1997) (a) Definitions. Invention, as used in this clause, means any invention or discovery which is or may be patentable or otherwise... such conditions as to establish that the invention is being utilized and that its benefits are, to...

  15. 48 CFR 52.227-13 - Patent Rights-Ownership by the Government. (United States)


    ... following clause: Patent Rights—Ownership by the Government (DEC 2007) (a) Definitions. As used in this clause— Invention means any invention or discovery that is or may be patentable or otherwise protectable... Variety Protection Act (7 U.S.C. 2321, et seq.) Made means— (1) When used in relation to any...

  16. 48 CFR 1852.227-11 - Patent Rights-Retention by the Contractor (Short Form). (United States)


    ... copies of the patent application file, by the Government, when a Federal Government employee is a... subparagraph (c)(1). NASA prefers that the contractor use either the electronic or paper version of NASA Form.... Both the electronic and paper versions of NASA Form 1679 may be accessed at the electronic New...

  17. 21 CFR 1.227 - What definitions apply to this subpart? (United States)


    ..., bakery goods, snack foods, candy, and canned foods. (5) Holding means storage of food. Holding facilities...) Manufacturing/processing means making food from one or more ingredients, or synthesizing, preparing, treating, modifying or manipulating food, including food crops or ingredients. Examples of manufacturing/processing...

  18. 48 CFR 52.227-11 - Patent Rights-Ownership by the Contractor. (United States)


    ... invention is being utilized and that its benefits are, to the extent permitted by law or Government... subject invention. The disclosure shall also identify any publication, on sale (i.e., sale or offer for... the acceptance of any manuscript describing the subject invention for publication and any on sale...

  19. 48 CFR 252.227-7015 - Technical data-Commercial items. (United States)


    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text... information, regardless of the form or method of recording, of a scientific or technical nature (including... without restrictions on use, modification, reproduction, release, or further disclosure other than...

  20. 40 CFR 227.7 - Limits established for specific wastes or waste constituents. (United States)


    ..., such as benzene, xylene, carbon disulfide and toluene, may be dumped only when they are present in the waste in concentrations below their solubility limits in seawater. This provision does not apply...

  1. 30 CFR 250.227 - What environmental impact analysis (EIA) information must accompany the EP? (United States)


    ... activities; (2) Be project specific; and (3) Be as detailed as necessary to assist the Regional Supervisor in...) Other resources, conditions, and activities identified by the Regional Supervisor. (c) Environmental... accidents, cooling water intake structures, and those identified in relevant ESA biological opinions such as...

  2. 19 CFR 10.227 - Verification and justification of claim for preferential treatment. (United States)


    .... United States-Caribbean Basin Trade Partnership Act Textile and Apparel Articles Under the United States..., such as purchase orders, invoices, bills of lading and other shipping documents, and customs import and... the textile or apparel article qualifies for preferential treatment. Those records must...

  3. 12 CFR 227.23 - Unfair acts or practices regarding allocation of payments. (United States)


    ... payment among the balances using one of the following methods: (a) High-to-low method. The amount paid by the consumer in excess of the required minimum periodic payment is allocated first to the balance with... excess of the required minimum periodic payment is allocated among the balances in the same proportion as...

  4. 40 CFR 227.6 - Constituents prohibited as other than trace contaminants. (United States)


    ... regulated under the FWPCA; (5) Known carcinogens, mutagens, or teratogens or materials suspected to be carcinogens, mutagens, or teratogens by responsible scientific opinion. (b) These constituents will be... compounds identified as carcinogens, mutagens, or teratogens for which criteria have not been included...

  5. 48 CFR 252.227-7024 - Notice and approval of restricted designs. (United States)


    ... structures, machines, products, materials, construction methods, and equipment that are readily available through Government or competitive commercial channels, or through standard or proven production techniques, methods, and processes. Unless approved by the Contracting Officer, the Contractor shall not produce...

  6. Yao et al., Afr J Tradit Complement Altern Med. (2014) 11(1):222-227

    African Journals Online (AJOL)


    (Cohen et al., 2011; Starley et al., 2010) Non-alcoholic fatty liver disease has been found ... constitutes the “first hit”, and it is accompanied by obesity, and metabolic ..... Non-alcoholic fatty liver disease in children now: lifestyle changes and ...

  7. 227. Arteritis de takayasu y síndrome cardiovocal (síndrome de ortner

    Directory of Open Access Journals (Sweden)

    A. Ferreiro


    Resultados y conclusiones: Tras la realización de ventana pericárdica se confirma la presencia de pericarditis aguda serofibrinosa no infecciosa. La paciente fue diagnosticada de arteritis de Takayasu (cumpliendo 4 criterios mayores del American College of Rheumatology, con respuesta clínica y angiográfica favorable a corticoterapia y metotrexato. En 2011 se evidencia progresión de la insuficiencia aórtica hasta hacerse grave, realizándose cirugía de sustitución valvular. La variabilidad clínica en la forma de presentación de las vasculitis hace necesario un riguroso análisis, individualizado y sistemático, tanto en su diagnóstico como en su seguimiento.

  8. Erostratus Unbound: Norway’s 22/7 Converging Frames of War

    DEFF Research Database (Denmark)

    Meret, Susi; Hervik, Peter


    The purpose of this introductory article is to set the stage for the theme issue on the 22 July 2011 terror attacks in Oslo and Utøya by mass murderer, Anders Behring Breivik. The article opens up with the historical and literary figure Erostratus to discuss the differences and similarities betwe...... in news articles in a way not unlike the media coverage (and academic analyses) of the Danish Muhammad cartoon affair...

  9. 18 CFR 367.2270 - Account 227, Obligations under capital lease-Non-current. (United States)



  10. Cultural Resources Mitigation Along Ditch 19, Site 23DU227, Dunklin County, Missouri (United States)


    technical assistance on lithic analysis and helped in final report preparation. To Linda Scott of Palynological Analysts, I extend my appreciation for...categories. Each of the artifact categories is discussed in the following text. Prehistoric Lithic Analysis and Results Lithic materials have proven...organizes the lithic analysis so that a "comprehensive framework" for "maximizing possible understanding of h’iman behavior" was provided. To


    This SOP describes the method to train project staff and participants to collect various field samples and questionnaire data for the study. The training plan consists of two separate components: project staff training and participant training. Before project activities begin,...

  12. 30 CFR 227.803 - What are the hearing procedures for terminating a State's delegation agreement? (United States)


    ... opportunity to present testimony and written information on your ability to perform your delegated functions... Director will appoint a hearing official to conduct one or more public hearings for fact finding and to... whether to terminate your delegation agreement; (b) The hearing official will contact you about...

  13. Spanish-English Immersion in the Wake of California Proposition 227: Five Cases (United States)

    Linton, April


    Two-way bilingual immersion programs are noteworthy within the context of US public education because, in them, the children of immigrants are essential assets. Language-minority and English-speaking pupils are grouped together, starting in kindergarten or earlier and extending at least through grade five, with a goal of bilingual proficiency and…

  14. 上海市227名初中生营养午餐及营养知识状况调查%Nutritious Lunch and Nutrition Knowledge Among 227 Junior Middle School Students in Shanghai

    Institute of Scientific and Technical Information of China (English)

    叶文博; 姚家佳; 秦晴


    Objective To learn status of dinner at school and general nutrition knowledge of students, and to provide suggestions for boosting nutritious lunch and promoting students" healthy growth. Methods 230 externs from 3 kinds (in city center, town center and ordinary town of Shanghai) of middle schools were selected for random, and questionnaire about behavior of having dinner at school, nutrition knowledge, satiofaetion and suggestion to nutritious lunch were taken a~nong them. Food consumption of nutritious luneh were analyzed. Results Menu of the lunch were monotonous and lack of green vegetables. 37.4% students left more than half of the lunch and their satisfactory rate to the lunch was only 55.1%. Conclusion The students" nutrition knowledge is not enough. Education about nutrition knowledge among students should be strengthened, except improve the quality of nutritious luneh.%目的 了解学生在校就餐现状和营养常识,为实现营养午餐促进学生健康成长提出建议.方法 随机抽取上海市中心城区、郊区中心城镇和郊区普通乡镇3所初中的230名走读生,考察在校用餐的行为并采用问卷调查的方法,了解其掌握的营养知识和对学校午餐的满意程度和建议,分析营养午餐的食品组成.结果 午餐菜谱单调,缺乏绿叶蔬菜;37.4%的学生午餐饭菜剩余50%以上;学生对营养午餐的满意率仅为55.1%.结论 学生的营养知识匮乏,除改进营养午餐的质量之外,学生营养知识教育亟待加强.

  15. [Nebraska 4-H Wheat Science School Enrichment Project, Teacher/Leader Guides 213-222 and 227. (United States)

    Nebraska Univ., Lincoln. Inst. of Agriculture and Natural Resources.

    Through the 4-H Wheat Science project, students learn the importance of wheat from the complete process of growing wheat to the final product of bread. The curriculum is designed to include hands-on experiences in science, consumer education, nutrition, production economics, vocabulary, and applied mathematics. Teachers can select those units out…

  16. 78 FR 9420 - Central Gulf of Mexico Planning Area (CPA) Outer Continental Shelf (OCS) Oil and Gas Lease Sale 227 (United States)


    ... February 28, 2007) NH15-12 Ewing Bank (Revised November 1, 2000) NH16-04 Mobile (Revised July 1, 2011) NH16...) Coordination (6) Blocks South of Baldwin County, Alabama (7) Law of the Sea Convention Royalty Payment (8.... VII. Bidding Instructions Instructions on how to submit a bid, secure payment of the advance bonus...

  17. Direct liquefaction proof-of-concept program: POC bench option run 01 (227-90). Final report

    Energy Technology Data Exchange (ETDEWEB)

    Comolli, A.G.; Pradhan, V.R.; Lee, T.L.K.; Karolkiewicz, W.F.; Popper, G.


    This report presents the results of bench-scale work, Bench Run PB-01, conducted under the DOE Proof of Concept-Bench Option Program in direct coal liquefaction at Hydrocarbon Technologies, Inc. in Lawrenceville, New Jersey. The Bench Run PB-01 was the first of nine runs planned under the POC Bench Option Contract between the US DOE and Hydrocarbon Technologies, Inc. The primary goal of this bench run was to evaluate the most successful of the process improvements concepts, evolving out of the earlier CMSL Project, for conventional direct liquefaction as well as coprocessing of a sub-bituminous Black Thunder mine coal with waste organics such as waste plastics and heavy resid. The interstage separation of light ends and gases was indeed found to reduce the overall light gas-make from the liquefaction process. The organic waste feeds such as mixed plastics and vacuum resid, employed during Bench Run PB-01, in combined processing with coal, resulted in making the overall process more hydrogen efficient by virtue of reducing the light gas make and also decreasing the hydrogen consumption from the process, while at the same time improving the yields and quality of the distillate products. A definite synergy was found during the combined processing of coal with mixtures of vacuum resid and mixed waste plastics. The application of an all dispersed catalyst conversion reactor resulted in higher feed throughput at equivalent process performance, but also necessitated the use of an in-line hydrotreater for improving the quality of IBP-400{degrees}C distillate products. The combination of HTI`s iron gel catalyst and Molyvan-A was found very effective in achieving high levels of process performance; although, in recycled form, these catalysts were not as effective as the freshly added precursors.

  18. 48 CFR 952.227-14 - Rights in data-general. (DOE coverage-alternates VI and VII) (United States)


    ... supplied by the contractor or its licensees in sufficient quantity and at reasonable prices to satisfy... are expected to take effective steps to so supply such data in the form of results obtained by their... skilled in the art of manufacturing items or performing processes of the same general type and...

  19. [227-POS]: Thromboelastography (TEG((R))) and rotational thromboelastometry (ROTEM((R))) in pregnancy: A systematic review

    NARCIS (Netherlands)

    Bolte, A.C.; Hermans, F.J.; Rheenen-Flach, L.E. van


    OBJECTIVES: To evaluate the current position of thromboelastography (TEG) and rotational thromboelastometry (ROTEM) in clinical obstetric practice. METHODS: A search of the literature was performed on the following databases PubMed MEDLINE, EMBASE and the Cochrane Database of Systematic reviews. All

  20. [2](1,3)Adamantano[2](2,7)pyrenophane: A Hydrocarbon with a Large Dipole Moment. (United States)

    Kahl, Paul; Wagner, J Philipp; Balestrieri, Ciro; Becker, Jonathan; Hausmann, Heike; Bodwell, Graham J; Schreiner, Peter R


    The fusion of the sp(3) -hybridized parent diamondoid adamantane with the sp(2) -hybridized pyrene results in a hybrid structure with a very large dipole moment which arises from bending the pyrene moiety. Presented herein is the synthesis, study of the electronic and optical properties, as well as the dynamic behavior of this new hydrocarbon.

  1. Specific MAP-kinase blockade protects against renal damage in homozygous TGR(mRen2)27 rats

    NARCIS (Netherlands)

    de Borst, MH; Navis, G; de Boer, RA; Vis, LM; van Gilst, WH; van Goor, H


    Angiotensin II (AngII) plays an important role in renal damage by acting on hemodynamics, cell-growth, proliferation, and fibrosis, mainly by effects on the AngII type 1 (AT,) receptor. The AT, receptor activates several intracellular signaling molecules such as mitogen-activated protein kinases ext

  2. [Nebraska 4-H Wheat Science School Enrichment Project, Teacher/Leader Guides 213-222 and 227. (United States)

    Nebraska Univ., Lincoln. Inst. of Agriculture and Natural Resources.

    Through the 4-H Wheat Science project, students learn the importance of wheat from the complete process of growing wheat to the final product of bread. The curriculum is designed to include hands-on experiences in science, consumer education, nutrition, production economics, vocabulary, and applied mathematics. Teachers can select those units out…

  3. 77 FR 227 - Medicare Program; Payment Policies Under the Physician Fee Schedule, Five-Year Review of Work... (United States)


    ... a multi-component, inflatable penile prosthesis at the same operative session). Due to an..., minimum of 3 views), and 73630 (Radiologic examination, foot; complete, minimum of 3 views) to reflect the...) of a multi-component, inflatable penile prosthesis at the same operative session) was identified...

  4. 40 CFR 745.227 - Work practice standards for conducting lead-based paint activities: target housing and child... (United States)


    ... (EBL) determination, or Federal, State, Tribal, or local emergency abatement order should be received... showing evidence of an EBL determination or a copy of the Federal/State/Tribal/local emergency abatement.... (H) Documentation showing evidence of an EBL determination or a copy of the Federal/State/Tribal...

  5. In-Situ Estimates of tidal mixing in the Indonesian archipelago from multidisciplinary data (United States)

    Koch-Larrouy, Ariane; Atmadipoera, Agus; van Beek, Pieter; Madec, Gurvan; Aucan, Jerome; Lyard, Florent; Grelet, Jacques; Souhaut, Marc


    The Indonesian Mixing program (INDOMIX) was designed to quantify the very strong mixing that transforms Pacific waters into homohaline Indonesian Waters in the Indonesian archipelago. The turbulent dissipation rates and associated mixing were estimated and analyzed using a multidisciplinary approach that combines physical and geochemical observations: 1) direct measurements of the dissipation using a microstructure profiler, 2) use of density-based fine-scale methods, and 3) study of the vertical distribution of natural radionuclides (radium isotopes and actinium-227). Data were collected at five contrasting stations within the Indonesian archipelago. Strong instabilities, inversions of the density profiles and a very strong water mass transformation were observed. A wide range of values is obtained for dissipation within [10-10, 10-4] with spots of higher dissipation in the ocean interior correlated with a strong internal tide signal. Both Fine-scale and micro-scale methods allow us to identify very strong dissipation energy levels above the straits, ranging within [10-7, 10-4], in contrast to lower values at stations far from generation sites. However, the dissipation in the interior water column for the station located in the center of Halmahera [10-9, 10-8] is stronger than for the Banda station [10-11, 10-10], which is further away from generation sites. The three approaches agree relatively well and provide Kz values ranging between 5 10-4 and 5 10-1 m2.s-1, except in the Banda Sea where values are similar to the ones found in the open ocean (10-6 m2.s-1). Kz values mainly increase toward the bottom, where stratification decreases. Surface mixing, at the base of the mixed layer is found to be still very strong with values within [10-4, 10-3 m2.s-1]. These results confirm the results of modelling studies, in which hypothesis of intensified subsurface mixing were made, a mixing that strongly modifies the whole tropical mean state and

  6. Co-crystal structures of PKG Iβ (92-227 with cGMP and cAMP reveal the molecular details of cyclic-nucleotide binding.

    Directory of Open Access Journals (Sweden)

    Jeong Joo Kim

    Full Text Available Cyclic GMP-dependent protein kinases (PKGs are central mediators of the NO-cGMP signaling pathway and phosphorylate downstream substrates that are crucial for regulating smooth muscle tone, platelet activation, nociception and memory formation. As one of the main receptors for cGMP, PKGs mediate most of the effects of cGMP elevating drugs, such as nitric oxide-releasing agents and phosphodiesterase inhibitors which are used for the treatment of angina pectoris and erectile dysfunction, respectively.We have investigated the mechanism of cyclic nucleotide binding to PKG by determining crystal structures of the amino-terminal cyclic nucleotide-binding domain (CNBD-A of human PKG I bound to either cGMP or cAMP. We also determined the structure of CNBD-A in the absence of bound nucleotide. The crystal structures of CNBD-A with bound cAMP or cGMP reveal that cAMP binds in either syn or anti configurations whereas cGMP binds only in a syn configuration, with a conserved threonine residue anchoring both cyclic phosphate and guanine moieties. The structure of CNBD-A in the absence of bound cyclic nucleotide was similar to that of the cyclic nucleotide bound structures. Surprisingly, isothermal titration calorimetry experiments demonstrated that CNBD-A binds both cGMP and cAMP with a relatively high affinity, showing an approximately two-fold preference for cGMP.Our findings suggest that CNBD-A binds cGMP in the syn conformation through its interaction with Thr193 and an unusual cis-peptide forming residues Leu172 and Cys173. Although these studies provide the first structural insights into cyclic nucleotide binding to PKG, our ITC results show only a two-fold preference for cGMP, indicating that other domains are required for the previously reported cyclic nucleotide selectivity.

  7. Guillem Peire de Cazals, “Be·m plagr’ueymais qu’ab vos dona·m valgues” (BdT 227.6

    Directory of Open Access Journals (Sweden)

    Alessio Collura


    Full Text Available This paper proposes a new edition with commentary of the poem “Be·m plagr’ueymais qu’ab vos, dona, ·m valgues” by Guillem Peire de Cazals and represents a first critical and hermeneutical reassessment of the poetry of the troubadour from Cahors, that has long been neglected. The text presents the classical structure of a love-story (springtime exordium, singing brought on by love, the theme of improvement, courting with no hope of a reward, a request for mercé and invites the fin aman to be patient. The song is examined from the viewpoint of its metrical and stylistic relations to other troubadour poems (Bernart de Ventadorn, “Can par la flors josta·l vert folh” [BdT 70.41] and “La dousa votz ai auzida” [BdT 70.23] and Lanfranc Cigala, “Ioios d’amor farai de ioi senblan” [BdT 282.12], and represents an early example of the mannerisms and experimental tendencies that characterize Guillem Peire’s poems. The article also attempts to date the composition to the twenties or thirties of the 13th century.

  8. P2-27: Electrophysiological Correlates of Conscious and Unconscious Processing of Emotional Faces in Individuals with High and Low Autistic Traits

    Directory of Open Access Journals (Sweden)

    Svjetlana Vukusic


    Full Text Available LeDoux (1996 The Emotional Brain has suggested that subconsciouss presentation of fearful emotional information is relayed to the amygdala along a rapid subcortical route. Rapid emotion processing is important because it alerts other parts of brain to emotionally salient information. It also produces immediate reflexive responses to threating stimuli in comparison to slower conscious appraisal, which is of important adaptive survival value. Current theoretical models of autism spectrum disorders (ASD have linked impairments in the processing of emotional information to amygdala dysfunction. It can be suggested that impairment in face processing found in autism may be the result of impaired rapid subconscious processing of emotional information which does not make faces socially salient. Previous studies examined subconscious processing of emotional stimuli with backward masking paradigms by using very brief presentation of emotional face stimuli proceeded by a mask. We used an event-related potential (ERP study within a backward masking paradigm with subjects with low and high autistic tendencies as measured by the Autism Spectrum Quotient (AQ questionnaire. The time course of processing of fearful and happy facial expressions and an emotionally neutral face was investigated during subliminal (16 ms and supraliminal (166 ms stimuli presentation. The task consisted of an explicit categorization of emotional and neutral faces. We looked at ERP components N2, P3a, and also N170 for differences between subjects with low ( 19 AQ.

  9. Mouton Jean-Michel édit., Le Sinaï de la conquête arabe à nos jours, Le Caire, IFAO 870, 2001, 227 p.

    Directory of Open Access Journals (Sweden)

    Thierry Bianquis


    Full Text Available Contributions : Katia Cytryn-Siverman, The settlement in Northern Sinai in Islamic period. Pascal Ballet, Un atelier de potiers aux « sources de Moïse » (‘Uyûn Mûsâ. Sâmî Sâlih ‘Abd al-Malik, Une inscription du sultan mamelouk Kitbuga découverte à al-Qurrays. Béatrice Dansette, Le Sinaï, lieu de solitude, centre de relations et d’échanges spirituels ? Essai d’interprétation des récits de pèlerins occidentaux au Sinaï aux derniers siècles du Moyen-Âge. Deltev Kraack, Chivalrous adventures...

  10. A Cell ELISA for the quantification of MUC1 mucin (CD227) expressed by cancer cells of epithelial and neuroectodermal origin. (United States)

    Falahat, Rana; Wiranowska, Marzenna; Gallant, Nathan D; Toomey, Ryan; Hill, Robert; Alcantar, Norma


    Quantitative analysis of MUC1, a cell membrane associated mucin, expressed by intact cells of epithelial origin previously has been limited to flow cytometry, which requires using large quantities of cells and antibodies. Here, for the first time, we report the development of a novel Cellular-based Enzyme Linked Immunosorbent Assay (Cell ELISA) to quantify the expression of MUC1 by cell lines of epithelial and neuroectodermal origin using an antibody recognizing a specific tandem repeat found in the extracellular domain of MUC1. In contrast to flow cytometry, this method requires a much lower number of cells. We report here the results obtained from two variants of this Cell ELISA in live and fixed cells. We found that the Cell ELISA in live cells was not sensitive enough to detect a difference in MUC1 levels between the normal cells and tumor cells. However, we found that Cell ELISA in fixed cells followed by whole cell staining was a dependable method of MUC1 level detection in the normal and tumor cells showing significantly higher levels of MUC1 receptor in the tumor cells when compared to the normal controls. Therefore, we conclude that the Cell ELISA in fixed cells is an efficient method for quantifying the expression of MUC1 by epithelial and neuroectodermal cancer cell lines.

  11. Extracellular signal regulated kinase and SMAD signaling both mediate the angiotensin II driven progression towards overt heart failure in homozygous TGR(mRen2)27

    NARCIS (Netherlands)

    de Boer, RA; Pokharel, S; Flesch, M; van Kampen, DA; Suurmeijer, AJH; Boomsma, F; van Gilst, WH; van Veldhuisen, DJ; Pinto, YM


    Angiotensin (Ang) II is a key player in left ventricular (LV) remodeling and cardiac fibrosis. Its effects are thought to be transferred at least in part by mitogen-activated protein kinases (MAPK), transforming growth factor (TGF) beta(1), and the Smad pathway. In this study we sought to elucidate

  12. Retraction notice to: Artificial intelligence in pharmaceutical product formulation: Neural computing [Chem. Ind. Chem. Eng. Q. 15(4 (2009 227-236

    Directory of Open Access Journals (Sweden)

    Ibrić Svetlana


    Full Text Available This article has been retracted at the request of the authors. The retraction has been made because the authors admitted that they took the text and rawings from the review article written by R. Rowe and E. Colbourn, Future Medicinal Chemistry 1(4 (2009 713-726, without their permission and even did not include this article in the list of references. One of the conditions of submission of a paper for publication are that authors confirm that their work is entirely originally written, someone else’s data and/or text are appropriately cited or quoted and permission has been obtained for use of copyrighted material from other sources. Therefore, the retracted article represents a severe improperly usage of the scientific publishing system. Apologies are offered to readers of the Chem. Ind. Chem. Eng. Q. that this abuse was not detected during the submission process.

    Link to the retracted article 10.2298/CICEQ0904227I

  13. Ethyl (E-2-(2,7-dimethyl-5-oxo-4H,5H-pyrano[4,3-b]pyran-4-ylideneacetate

    Directory of Open Access Journals (Sweden)

    Oulemda Bassou


    Full Text Available In the title compound, C14H14O5, the two heterocyclic rings are coplanar (r.m.s. deviation = 0.008 Å, with the largest deviation from the mean plane being 0.012 (1 Å. The mean plane through the acetate group is inclined slightly with respect to the oxopyrano[4,3-b]pyran-4-yl system, as indicated by the dihedral angle of 1.70 (7° between them. Two intramolecular hydrogen bonds, completing S(6 ring motifs, are observed in the molecule. In the crystal, molecules are linked by weak C—H...O hydrogen bonds involving the same acceptor atom, forming chains propagating along the c-axis direction and enclosing R21(6 ring motifs. The chains are linked via offset π–π interactions [intercentroid distance = 3.622 (1 Å], involving inversion-related oxopyrano[4,3-b]pyran-4-yl ring systems, forming slabs parallel to the bc plane.

  14. Compte rendu d’Esquenazi (Jean-Pierre, Sociologie des œuvres. De la production à l’interprétation, Paris, Armand Colin, 2007, 227 p.

    Directory of Open Access Journals (Sweden)

    Clément Dessy


    Full Text Available Depuis Marcel Duchamp et l’élaboration du concept de ready-made, l’art contemporain a donné de nombreux coups de canif dans une conception de l’objet artistique qui le percevait comme « unique », d’un point de vue matériel. Pourtant, l’interprétation d’une œuvre d’art – sa « signification » ou son « sens » – demeure encore subordonnée à cette pensée de la « singularité ». L’esthétique recherche dans l’œuvre même des propriétés originales qui lui sont intrinsèques. Et si, comme le suggère Esqu...

  15. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.


    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  16. Monofunctionalization of Calix[4]arene Tetracarboxylic Acid at the Upper Rim with Isothiocyanate Group: First Bifunctional Chelating Agent for Alpha-Emitter Ac-225. (United States)

    Chen, Xiaoyuan; Ji, Min; Fisher, Darrell R; Wai, Chien M


    A procedure is reported for synthesizing a novel, water-soluble bifunctional chelating agent derived from calix[4]arene. This chelate features tetracarboxylic acid groups at the lower rim as an actinium-225 ionophore, and an isothiocyanate functional group at the upper rim for labeling of the N-terminus of monoclonal antibodies through thiourea linkage.

  17. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications; Comportement des radionucleides des familles de l'uranium dans les eaux superficielles du site de la Crouzille (Limousin): implications geochimiques

    Energy Technology Data Exchange (ETDEWEB)



    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of {sup 235}U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  18. Water Column Chemical Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-227 during 2008-2010 (NCEI Accession 0088839) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  19. Negociações Multilaterais do Comércio de Serviços, Intervenção Estatal Brasileira e Defesa dos Interesses Nacionais - 10.5102/uri.v4i2.227

    Directory of Open Access Journals (Sweden)

    Fátima Faro


    Full Text Available The purpose of this article is to discuss the evolution of the multilateral negotiations focused on trade of services, as well as the Brazilian governmental politics to emphasize the development of this economic activity, and to support our participation within the bilateral and multilateral rounds of negotiation, from an individual country perspective, according to the national point of view.

  20. Niskin Bottle Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010 (NCEI Accession 0087596) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  1. Crystal structure and absolute configuration of (3aS,4S,5R,7aR-2,2,7-trimethyl-3a,4,5,7a-tetrahydro-1,3-benzodioxole-4,5-diol

    Directory of Open Access Journals (Sweden)

    Mario A. Macías


    Full Text Available The absolute configuration of the title compound, C10H16O4, determined as 3aS,4S,5R,7aR on the basis of the synthetic pathway, was confirmed by X-ray diffraction. The molecule contains a five- and a six-membered ring that adopt twisted and envelope conformations, respectively. The dihedral angle between the mean planes of the rings is 76.80 (11° as a result of their cis-fusion. In the crystal, molecules are linked by two pairs of O—H...O hydrogen bonds, forming chains along [010]. These chains are further connected by weaker C—H...O interactions along [100], creating (001 sheets that interact only by weak van der Waals forces.

  2. Ursula Camba Ludlow, Imaginarios ambiguos, realidades contradictorias: conductas y representaciones de los negros y mulatos novohispanos. Siglos XVI y XVII, México D.F., COLMEX, 2008, 227 p.


    Albornoz Vásquez, María Eugenia


    Los negros y los mulatos en la historia de Iberoamérica, como tema de reflexión historiográfica, conocen hoy un protagonismo que hasta hace poco les fue esquivo, especialmente en las producciones publicadas en español. Subrayamos: no se trata de esclavos ni de esclavitud ni de situación de esclavitud, sino de individuos de origen africano, desgranados de una noción colectiva y anónima, “las castas”. En este libro se trata de explorar las ideas, las metáforas, las asociaciones simbólicas que e...

  3. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT219-227 during 2010 (NCEI Accession 0087988) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  4. CTD Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010) (NCEI Accession 0087584) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Multibeam collection for TN227: Multibeam data collected aboard Thomas G. Thompson from 2008-11-13 to 2008-11-28, departing from Apia, Western Samoa and returning to Apia, Western Samoa (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  6. CCDC 1035932: Experimental Crystal Structure Determination : 2,2'-(7H,7'H-5,5'-spirobi[indeno[2,1-b]fluorene]-7,7'-diylidene)dimalononitrile dichloromethane solvate

    KAUST Repository

    Xia, Debin


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.


    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot


    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  8. Lifestyle Changes After Laryngeal or Hypopharyngeal Cancer (United States)

    ... 1-800-227-2345. A tobacco cessation and coaching service can help increase your chances of quitting ... at 1-800-227-2345. Adopting other healthy behaviors such as eating well, getting regular physical activity, ...

  9. Transition wavelengths and unresolved transition array statistics of ions with Z = 72-89

    Energy Technology Data Exchange (ETDEWEB)

    Kilbane, D, E-mail: [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland)


    Potential extreme ultraviolet and soft x-ray radiation sources have been identified, using the flexible atomic code (FAC), as emission peaks arising from the 4d-4f and 4p-4d transitions in Pd-like to Rb-like ions of hafnium through actinium. The effects of configuration interaction are investigated and for increasing nuclear charge, these strong emitters are seen to separate and move to shorter wavelengths. Each source is characterized using the unresolved transition array model. They are proposed to complement the currently used nitrogen and argon sources in the 'water window', and as possible successors to tin in next-generation lithography.

  10. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State


    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  11. Analysis of the Yrast Bands with q-Deformed Moment of Inertia

    Institute of Scientific and Technical Information of China (English)

    FANG Xiang-Zheng; RUAN Tu-Nan


    The rigid-rotor with a q-deformed moment of inertia is introduced to describe the nuclear rotational spectra. With the representations of quantum algebra, the normal deformed and superdeformed bands are naturally differentiated by softness. The yrast normal deformed bands in rare earth and actinium regions, as well as the yrast superdeformed bands in A-190 and 150 regions are investigated. The calculated results agree with experimental data qualitatively well, and the values of the parameters are physically reasonable. This indicates that the fixed deformation, the stretching effect and the many body statistics effect are three possible dominant factors to govern nuclear rotational bands.

  12. Reclassification of English Learners


    James B. Grissom


    Ron Unz, originator of Proposition 227, claimed, prior to the passage of Prop. 227, that the five percent annual reclassification rate of English learners to fluent English proficient indicated bilingual education was a failure. Critics of Prop. 227 have countered that the annual reclassification rate has changed little since the passage of Prop. 227, indicating the new legislation had no effect on reclassification rates. Unfortunately, the annual reclassification rate does not provide a clea...

  13. Gclust Server: 168727 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 168727 TET_227.m00055 Cluster Sequences - 94 hypothetical protein chr_0_8254606_227...; no annotation 1 1.00e-50 0.0 11.11 0.0 0.0 0.0 0.0 Show 168727 Cluster ID 168727 Sequence ID TET_227.m0005

  14. 21 CFR 558.265 - Halofuginone hydrobromide. (United States)


    ...) plus bacitracin methylene disalicylate 10 to 50 grams and roxarsone 22.7 to 45.4 grams. (A) Indications... grams plus roxarsone, 22.7 to 45.4 grams. (A) Indications for use. For the prevention of coccidiosis... hydrobromide, 2.72 grams plus roxarsone, 22.7 to 45.4 grams. (A) Indications for use. For the prevention...

  15. 40 CFR 52.1679 - EPA-approved New York State regulations. (United States)


    .../72, 37 FR 19814 Part 220, Portland Cement Plants 3/14/73 11/12/81, 46 FR 55690 Part 222, Incinerators... Metal Cleaning Processes 5/7/03 1/23/04, 69 FR 3240 Part 227, Stationary Combustion Installations /section 227.2(b)(1) 5/1/72 9/22/72, 37 FR 19814 Part 227, Stationary Combustion Installations...

  16. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.


    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  17. Large scale accelerator production of (225)Ac: Effective cross sections for 78-192MeV protons incident on (232)Th targets. (United States)

    Griswold, J R; Medvedev, D G; Engle, J W; Copping, R; Fitzsimmons, J M; Radchenko, V; Cooley, J C; Fassbender, M E; Denton, D L; Murphy, K E; Owens, A C; Birnbaum, E R; John, K D; Nortier, F M; Stracener, D W; Heilbronn, L H; Mausner, L F; Mirzadeh, S


    Actinium-225 and (213)Bi have been used successfully in targeted alpha therapy (TAT) in preclinical and clinical research. This paper is a continuation of research activities aiming to expand the availability of (225)Ac. The high-energy proton spallation reaction on natural thorium metal targets has been utilized to produce millicurie quantities of (225)Ac. The results of sixteen irradiation experiments of thorium metal at beam energies between 78 and 192MeV are summarized in this work. Irradiations have been conducted at Brookhaven National Laboratory (BNL) and Los Alamos National Laboratory (LANL), while target dissolution and processing was carried out at Oak Ridge National Laboratory (ORNL). Excitation functions for actinium and thorium isotopes, as well as for some of the fission products, are presented. The cross sections for production of (225)Ac range from 3.6 to 16.7mb in the incident proton energy range of 78-192MeV. Based on these data, production of curie quantities of (225)Ac is possible by irradiating a 5.0gcm(-2 232)Th target for 10 days in either BNL or LANL proton irradiation facilities. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller


    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  19. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    Directory of Open Access Journals (Sweden)

    Julius Schlosser


    Full Text Available In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl, and being written just at a moment in his career when Schlosser had been casting around the ideas of Ernst Brücke, Konrad Lange, even Henri Bergson, but had discovered the recent contribution of Benedetto Croce, which would colour his approach with an increasing intensity for the remainder of his life. He became what might be seen as the archetypical art historical theorist, but continues to distinguish himself from his successors by his greater consistency.

  20. Primary production and sediment trap flux measurements and calculations by the Hawaii Ocean Time-series (HOT) program at Station ALOHA in the North Pacific 100 miles north of Oahu, Hawaii for Cruises HOT1-227 during 1988-2010 (NODC Accession 0089168) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Hawaii Ocean Time-series (HOT) program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii....

  1. Digestible lysine requirement of Nile tilapia from 86 to 227 g fed arginine to lysine balanced dietsExigência de lisina digestível para a tilápia-do-Nilo de 87 a 226 g alimentada com dietas balanceadas para a relação arginina: lisina

    Directory of Open Access Journals (Sweden)

    Tadeu Orlandi Xavier


    Full Text Available This study was conducted out to determine the dietary digestible lysine requirements of Nile tilapia from 87 to 226 g. Fish (n = 170; average initial weight = 86.62 ± 4.89 g were distributed 15 1000-L cages, in a completely randomized design with five treatments and three replicates, and fed extruded diets containing 0.88; 1.12; 1.36; 1.59 and 1.83% of digestible lysine, balanced to keep the arginine to lysine ratio as 1.43:1. There was no effect of the dietary lysine levels on whole body moisture and ash. By Linear Response Plateau analysis of lysine levels on daily gain, feed conversion, protein efficiency ratio and rate of protein deposition was estimated requirement of 1.31, 1.03, 1.16 and 1.31 % of lysine, respectively. A quadratic effect of lysine levels on whole body fat deposition ratio and whole body ether extract composition were observed, and the lowest values were estimated with 1.16% and 1.43% of dietary lysine, respectively. An increase of the dietary lysine levels resulted in linear increase on the fillet yield. The digestible lysine requirements of Nile tilapia (87 to 226 g is 1.31%, in diets balanced for arginine to lysine ratio.Este estudo foi realizado com o objetivo de determinar a exigência de lisina digestível em dietas para alevinos de tilápia-do-Nilo de 87 a 226 g. Os peixes (n=300; peso inicial médio = 86,62 ± 4,89 g foram distribuídos em 15 tanques-rede de 1000 L cada, em delineamento inteiramente casualizado com cinco tratamentos e três repetições e alimentados com dietas extrusadas contendo 0,88; 1,12; 1,36; 1,59 e 1,83% de lisina digestível, balanceadas para relação arginina:lisina em 1,43:1. Não foi observado efeito dos níveis de lisina na dieta sobre os teores de umidade e proteína corporal. Pela análise Linear Response Plateau dos níveis de lisina sobre o ganho de peso diário, conversão alimentar, taxa de eficiência proteica e taxa de deposição de proteína, estimou-se exigência de 1,31; 1,03; 1,16 e 1,31% de lisina digestível, respectivamente. Foi observado efeito quadrático dos níveis de lisina sobre a taxa de deposição de gordura e teor de extrato etéreo corporal, em que os menores valores dessas variáveis foram estimados com 1,16% e 1,43% de lisina, respectivamente. Com o incremento nos teores de lisina na dieta ocorreu aumento linear no rendimento de filé e nível de proteína corporal. Concluiu-se que a tilápia-do-Nilo (87 a 226 g exige 1,31% de lisina digestível, em dietas balanceadas para a relação arginina:lisina.

  2. « Islamic Restorative Traditions and Their Reflections in the Post Revolutionary Criminal Justice System of Iran ». European Journal of Crime, Criminal Law and Criminal Justice, Vol. 15, N° 2, 2007, pp. 227-248.


    Engeland, Anicée Van


    L’A. s’interroge sur l’utilité sociale de punir et sur l’opportunité de « qui punir ». C’est ainsi qu’il approche le droit pénal iranien comme une réparation du criminel envers la société. Il se concentre alors sur la notion de violation du devoir moral. Le crime de qiṣāṣ (réparation pour un homicide ou pour une blessure) a selon lui cette approche du droit pénal : il s’agit de la violation d’un devoir moral et la réparation doit de ce fait être proportionnelle au mal qui a été fait à la soci...

  3. Public Libraries in Norway Help Non-Western Immigrant Women to Integrate into Society. A Review of: Audunson, R., Essmat, S., & Aabø, S. (2011. Public libraries: A meeting place for immigrant women? Library & Information Science Research, 33(3, 220-227. doi: 10.1016/j.lisr.2011.01.003

    Directory of Open Access Journals (Sweden)

    Kathryn Oxborrow


    Full Text Available Objectives – To discover the ways in which the public library was used by immigrant women, with a particular focus on the library as a meeting place.Design – Semi-structured qualitative interviews conducted in the participants’ native languages.Setting – Public libraries in Norway. Participants lived in one of two cities both with a population of approximately 40,000 and a somewhat lower number of immigrants than the national average.Subjects – Nine non-western women who had immigrated to Norway between 8 months and 17 years prior to the study. Three women were from Iran, Kurdistan and Afghanistan respectively. All identified themselves as public library users.Methods – Participants were interviewed in their native languages and the qualitative results were analyzed in accordance with the theoretical framework set out by the authors. The main areas of focus were the role of the library in the generation of social capital, and the library as a high intensive versus low intensive meeting place.Main Results – Participants used public libraries in various ways. In the initial stages of life in a new country they were used to observe and learn about the majority culture and language. They were also used as a safe place to openly grieve and provide comfort among close friends without fear of being seen by other fellow countrymen. Over time, participants came to use the library space in more traditional ways such as for information, social, and professional needs. The study also revealed that using public libraries built trust in the institution of libraries and librarians as employees.Conclusions – The public library plays a key role in the generation of social capital, both in terms of integrating into the majority culture through observation and spontaneous interactions (bridging social capital and connecting with others from participants’ home cultures (bonding social capital for example through the provision of social space and other links to home such as native language materials. The public library was used initially by participants as a high intensive meeting place, for meeting with friends and consoling one another. In time, however, the public library became a medium- to low-intensive meeting place, with participants engaging in library programmes or in spontaneous interactions with other library customers. Moreover, the study refutes the Swedish Library Association’s conclusion that library is used more often by immigrants that have lived in the country for long periods of time.

  4. Communication Breakdown: Librarian and Student Approaches to Virtual Reference Differ. A review of: Walter, Virginia A. and Cindy Mediavilla. “Teens Are from Neptune, Librarians Are from Pluto: An Analysis of Online Reference Transactions.” Library Trends 54.2 (2005: 209-227.

    Directory of Open Access Journals (Sweden)

    Stephanie Hall


    Full Text Available Objective – To evaluate the effectiveness of an online reference and referral service for students (primarily those in middle school and high school seeking homework help. Design – Analysis of 114 transcripts of reference transactions. Setting – A centralized homework reference and tutor referral service provided on behalf of the California State Library by the Metropolitan Cooperative Library System. Subjects – Virtual reference librarians at a large urban library system and middle and high school students in California. Methods – One hundred fourteen virtual reference transactions recorded between October 12 and November 8, 2003 were evaluated against the Reference and User Services Association’s (RUSA “Guidelines for Behavioral Performance of Reference and Information Service Providers.” Secondly, the transcripts were subjected to discourse analysis. Main results Performance of virtual reference librarians vis‐àvis RUSA guidelines In the majority of cases, there was some evidence that librarians communicated clearly (110 out of 114 transactions. In 78 cases, it appeared that a librarian was available quickly, and in 92 of the transactions a friendly greeting was given. What was striking, however, was that in a clear majority of cases, some of the classic reference interview strategies were not employed. In 100 or more cases each, the following strategies were not observed: repeating or paraphrasing the question; helping to interpret the question; verifying mutual understanding; asking if the question has been answered; asking if the student needs more information. Furthermore, in 75 cases librarians did not probe for further information to clarify the question, while in 87 cases they did not check that information had been clearly understood. Possibly related to these findings, the researchers felt that the transcripts revealed “a conviction that homework questions are not the proper content for reference transactions” (222. In addition, librarians were found to be frequently too quick to refer students to a tutor, when a query might have been better answered as a reference question. Findings of discourse analysis In general, the virtual reference librarians used impersonal, formal language to “reinforce the professional’s superior position vis‐à‐vis the help‐seeker” (217. There were repeated attempts by the students to interject a lighter or warmer tone (using humour, emoticons, informal language, introducing a personal note, etc.. These attempts were rarely reciprocated, with librarians continuing to use impersonal language, including stock messages such as: “we are experiencing a very busy time right now,” (217; or, “I am going to send you a page which will give you some help with your homework. After we disconnect this session, click on this link and follow the instructions to be connected with a tutor. Please do not click on any links on this page until after we have disconnected” (217. In several cases librarians were preoccupied with defining their roles—for example, specifying that they could give reference help but not advice. In all, the distancing mechanisms used by librarians, combined with occasional inaccurate referrals and technical problems with the software, were seen to create an enormous potential forfrustration on the part of the student. Conclusions – The most important implication of the study was that librarians and students were worlds (or planets apart in their approach to the reference interaction. While “teens attempted to create meaningby recreating the chat discourse environment in which they were most at home”, librarians “tried to create meaning in a parallel discourse environment that duplicated as much as possible the standard impersonal protocols of a face‐to‐face reference counter” (223. One suggested way to alleviate the disconnect between librarians and students was to involve students in the planning of the services. For now, however, the authors conclude that “teens are from Neptune, librarians are from Pluto. Better services would result if they could meet somewhere closer together” (224.

  5. Data from Phelan et al. 2016 (Water Air and Soil Pollution 227:84. DOI 10.1007/s11270-016-2762-x). "Assessing the effects of climate change and air pollution on soil properties and plant diversity in sugar-maple-beech-yellow birch hardwood..." (United States)

    U.S. Environmental Protection Agency — This dataset describes the simulations at two pilot sites in the northeast from 1900-2100 for several soil and plant community responses to climate and nitrogen...

  6. Protein (Viridiplantae): 192242 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YHRPGRGGGGCLGCCCSCIFGLVFKLIMTAVVFMGLAFFVFWLIVRPNRVKFHVTDATLTQFNFSNDNTLHYNLALNLTIR...2 ... 171637:227 ... 721813:233 ... 3749:233 ... 3750:233 ... PREDICTED: protein YLS9-like, partial Malus domestica PKSQS

  7. 225Ac and 223Ra production via 800 MeV proton irradiation of natural thorium targets. (United States)

    Weidner, J W; Mashnik, S G; John, K D; Ballard, B; Birnbaum, E R; Bitteker, L J; Couture, A; Fassbender, M E; Goff, G S; Gritzo, R; Hemez, F M; Runde, W; Ullmann, J L; Wolfsberg, L E; Nortier, F M


    Cross sections for the formation of (225,227)Ac, (223,225)Ra, and (227)Th via the proton bombardment of natural thorium targets were measured at a nominal proton energy of 800 MeV. No earlier experimental cross section data for the production of (223,225)Ra, (227)Ac and (227)Th by this method were found in the literature. A comparison of theoretical predictions with the experimental data shows agreement within a factor of two. Results indicate that accelerator-based production of (225)Ac and (223)Ra is a viable production method.

  8. 77 FR 61051 - Additional Designations, Foreign Narcotics Kingpin Designation Act (United States)


    ... Codigo Postal 11560, Mexico; Calle Ferrocarril de Cintura No. 300, Colonia Carranza Emilio, Delegacion Venustiano Carranza, Distrito Federal Codigo Postal 15230, Mexico; Calle Moliere No. 227, Colonia Polanco...

  9. Annual Report of the Chief of Engineers, U.S. Army, on Civil Works Activities 1961. Volume 1 (United States)


    227, 898 1, 047 Chico, Fla_.. .---------------------------------------..A.. .127, 633 143 Chocolate , Tex... Caliente -........ Pine Blackwater River......... Nubanusit Brook......... Pemigewasset River

  10. Process for radioisotope recovery and system for implementing same (United States)

    Meikrantz, David H.; Todd, Terry A.; Tranter, Troy J.; Horwitz, E. Philip


    A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

  11. Temporal Variations in Surface Concentrations of Terrestrial Lead 210 and Uranium 235 Radionucleides (United States)

    Yoshimori, M.

    We have started to measure the surface concentrations of terrestrial radionucleides of lead 210 and uranium 235 in Tokyo (N35, E139) in 2002. Lead 210 which is a daughter nucleus of Rn-222 (uranium series) emits 46 keV gamma-ray with a half-life of 22.4 years, while uranium 235 (actinium series) emits a gamma-ray at 186 keV with a half-life of 0.7 billion years. The present measurement of the surface concentration of lead 210 exhibits two peaks in spring and fall, similar to the beryllium 7 seasonal variations, while the uranium 235 concentration does not vary with time within statistical errors. These two terrestrial radionucleides exhibit different temporal variations on the surface. We discuss possible explanations for the differences in the temporal variations from a point of view of differences in their altitude distribution.

  12. Towards high-resolution laser ionization spectroscopy of the heaviest elements in supersonic gas jet expansion (United States)

    Ferrer, R.; Barzakh, A.; Bastin, B.; Beerwerth, R.; Block, M.; Creemers, P.; Grawe, H.; de Groote, R.; Delahaye, P.; Fléchard, X.; Franchoo, S.; Fritzsche, S.; Gaffney, L. P.; Ghys, L.; Gins, W.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Loiselet, M.; Lutton, F.; Moore, I. D.; Martínez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Raeder, S.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Thomas, J-C; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    Resonant laser ionization and spectroscopy are widely used techniques at radioactive ion beam facilities to produce pure beams of exotic nuclei and measure the shape, size, spin and electromagnetic multipole moments of these nuclei. However, in such measurements it is difficult to combine a high efficiency with a high spectral resolution. Here we demonstrate the on-line application of atomic laser ionization spectroscopy in a supersonic gas jet, a technique suited for high-precision studies of the ground- and isomeric-state properties of nuclei located at the extremes of stability. The technique is characterized in a measurement on actinium isotopes around the N=126 neutron shell closure. A significant improvement in the spectral resolution by more than one order of magnitude is achieved in these experiments without loss in efficiency. PMID:28224987

  13. Evaluation of total effective dose due to certain environmentally placed naturally occurring radioactive materials using a procedural adaptation of RESRAD code. (United States)

    Beauvais, Z S; Thompson, K H; Kearfott, K J


    Due to a recent upward trend in the price of uranium and subsequent increased interest in uranium mining, accurate modeling of baseline dose from environmental sources of radioactivity is of increasing interest. Residual radioactivity model and code (RESRAD) is a program used to model environmental movement and calculate the dose due to the inhalation, ingestion, and exposure to radioactive materials following a placement. This paper presents a novel use of RESRAD for the calculation of dose from non-enhanced, or ancient, naturally occurring radioactive material (NORM). In order to use RESRAD to calculate the total effective dose (TED) due to ancient NORM, a procedural adaptation was developed to negate the effects of time progressive distribution of radioactive materials. A dose due to United States' average concentrations of uranium, actinium, and thorium series radionuclides was then calculated. For adults exposed in a residential setting and assumed to eat significant amounts of food grown in NORM concentrated areas, the annual dose due to national average NORM concentrations was 0.935 mSv y(-1). A set of environmental dose factors were calculated for simple estimation of dose from uranium, thorium, and actinium series radionuclides for various age groups and exposure scenarios as a function of elemental uranium and thorium activity concentrations in groundwater and soil. The values of these factors for uranium were lowest for an adult exposed in an industrial setting: 0.00476 microSv kg Bq(-1) y(-1) for soil and 0.00596 microSv m(3) Bq(-1) y(-1) for water (assuming a 1:1 234U:238U activity ratio in water). The uranium factors were highest for infants exposed in a residential setting and assumed to ingest food grown onsite: 34.8 microSv kg Bq(-1) y(-1) in soil and 13.0 microSv m(3) Bq(-1) y(-1) in water.

  14. Drug: D06580 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Antivirals Anti-HIV agent Reverse transcriptase inhibitor (RTI) Nucleoside and nucleotide rev...D06580 Drug Dexelvucitabine (USAN/INN); Reverset (TN) C9H10FN3O3 227.0706 227.1924 ...D06580.gif Treatment of HIV-1 and HIV-2 infection [DS:H00406] See Elvucitabine [DR:D03981] Nucleoside analogue rev

  15. 48 CFR 212.7003 - Technical data and computer software. (United States)


    ... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a rebuttable...

  16. bu ke kao xu shu zhe zhi zai shen shi (不可靠叙述者之再审视)

    DEFF Research Database (Denmark)

    Hansen, Per Krogh


    Kinesisk oversættelse af "Reconsidering the Unreliable Narrator" in Semiotica 165 - 1/4 2007: 227-246. Oversætter: Shang Biwu.......Kinesisk oversættelse af "Reconsidering the Unreliable Narrator" in Semiotica 165 - 1/4 2007: 227-246. Oversætter: Shang Biwu....

  17. 21 CFR 520.534 - Decoquinate. (United States)


    ...—(1) Amount. Feed 22.7 milligrams per 100 pounds of body weight (0.5 milligram per kilogram) per day... rate of 22.7 milligrams per 100 pounds body weight daily (0.5 milligram per kilogram) for at least...

  18. Judicial Activity Concerning Enemy Combatant Detainees: Major Court Rulings (United States)


    13 United States v. Lindh , 227 F. Supp. 2d 565...convicted for his role in the September 11, 2001, terrorist attacks, but was never officially designated as an “enemy combatant”; John Walker Lindh , thus far...instructed that the sentencing options were limited as part of an apparently successful strategy to avoid the death penalty. United States v. Lindh , 227

  19. 77 FR 12175 - Airworthiness Directives; DASSAULT AVIATION Airplanes (United States)


    ... AD to prevent cracking of the flap tracks, which could lead to flap asymmetry and loss of control of..., 1200 New Jersey Avenue SE., Washington, DC. FOR FURTHER INFORMATION CONTACT: Tom Rodriguez, Aerospace..., Washington 98057-3356; telephone (425) 227-1137; fax (425) 227-1149. SUPPLEMENTARY INFORMATION: Discussion...

  20. Gclust Server: 201689 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201689 OSA_@227 Cluster Sequences - 157 no annotation 1 1.00e-80 14.29 0.0 0.0 0.0 0.0 0.0 Show 2016...89 Cluster ID 201689 Sequence ID OSA_@227 Link to cluster sequences Cluster Sequences Link

  1. The Tactical Implications of Combat Inexperience in the United States Army (United States)


    Wrigley , IL• __b.Dl1B• atfg•n (New York: Mocrin.llan, 1967), p. 403. 36. Holler, pp. 226-227, V7. Holier, pp, 227-228. 38. George C. Marshall, lbt l...Washington: Department of the Army, 1957. .51 Kellett, Anthony . Combat Motivation: The Behavior of Soldiers in Battle. Boston: Kluwer Nijhoff Publishing

  2. EST Table: DC547495 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC547495 E_FL_phe-_10L12_F_0 10/09/28 94 %/227 aa ref|NP_001037003.1| transitional ...%/227 aa FBpp0154194|DgriGH20288-PA 10/08/28 65 %/223 aa C06A1.1#CE02114#WBGene00007352#locus:cdc

  3. EST Table: DC545804 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC545804 E_FL_phe-_04J04_F_0 10/09/28 94 %/227 aa ref|NP_001037003.1| transitional ...%/227 aa FBpp0154194|DgriGH20288-PA 10/08/28 65 %/223 aa C06A1.1#CE02114#WBGene00007352#locus:cdc

  4. EST Table: DC551457 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC551457 E_FL_phe-_24P13_F_0 10/09/28 94 %/227 aa ref|NP_001037003.1| transitional ...%/227 aa FBpp0154194|DgriGH20288-PA 10/08/28 65 %/223 aa C06A1.1#CE02114#WBGene00007352#locus:cdc

  5. NCBI nr-aa BLAST: CBRC-TTRU-01-1397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1397 ref|YP_408932.1| putative 3-phenylpropionic acid transporter [Shigella... boydii Sb227] gb|ABB67104.1| MFS transporter [Shigella boydii Sb227] YP_408932.1 0.28 20% ...

  6. NCBI nr-aa BLAST: CBRC-MMUR-01-1441 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1441 ref|YP_408932.1| putative 3-phenylpropionic acid transporter [Shigella... boydii Sb227] gb|ABB67104.1| MFS transporter [Shigella boydii Sb227] YP_408932.1 0.32 20% ...

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-1054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1054 ref|YP_406984.1| putative transport [Shigella boydii Sb227] sp|Q3...24V2|ENTS_SHIBS Enterobactin exporter entS gb|ABB65156.1| putative transport [Shigella boydii Sb227] YP_406984.1 1.7 27% ...

  8. NCBI nr-aa BLAST: CBRC-ETEL-01-1342 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-1342 ref|YP_408708.1| NADH dehydrogenase I chain G [Shigella boydii Sb...227] gb|ABB66880.1| NADH dehydrogenase I chain G [Shigella boydii Sb227] YP_408708.1 3.8 31% ...

  9. Procedimento de fiscalização : pneus reformados



    Estabelece os critérios e padroniza o procedimento para fiscalização de pneus reformados quanto ao cumprimento da Portaria Inmetro nº Portarias Inmetro 227 e 252/2006. Portarias INMETRO 227 e 252/2006

  10. The Knossos Od Series. An Epigraphical Study

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    and decoration of the cloth. Moreover, scribe 227, newly identified by KILLEN and MELENA, is presented. Scribe 227 records small amounts of wool, writes in a style similar to the writing of scribes 113 and 115, and is associated with the area I1 near the North Entrance. His administrative practices thus seem...

  11. A Discourse on Human Systems Integration (United States)


    47(4), 221–227. Monk, T. H., Buysse, D. J., & Rose, L. R. (1999). Wrist actigraphic measures of sleep in space. Sleep , 22(7), 948–954. Naval Center...482 1. Actigraphic Measures of Sleep .......................................................483 2. Mood States...405  Figure VI-9.  Histogram of participants’ reported hours of sleep per night (PSQI question 4) in actigraphy subsample

  12. An Evaluation of the Marine Corps IDT Travel Reimbursement Program (United States)


    to the Government’s Unlimited Rights license as defined in DFARS 252.227-7013 and/or DFARS 252.227-7014. The reproduction of this work for...program served 609 Marines and executed around $714,000 of the allotted $1.6 mil- lion in FY 2013. For the most part, the data suggest little abuse of

  13. Improving Enlisted Fleet Manning (United States)


    work is subject to the Government’s Unlimited Rights license as defined in DFARS 252.227-7013 and/or DFARS 252.227-7014. The reproduction of this work...that civilian billets are 30 per- cent less expensive than military billets: • Buying outright—the cost of closing 100 billet gaps is $5.4 mil- lion

  14. Magnetic Moments and Ordered States in Pyrochlore Iridates Nd2Ir2O7 and Sm2Ir2O7 Studied by Muon-Spin Relaxation (United States)

    Asih, Retno; Adam, Noraina; Sakinah Mohd-Tajudin, Saidah; Puspita Sari, Dita; Matsuhira, Kazuyuki; Guo, Hanjie; Wakeshima, Makoto; Hinatsu, Yukio; Nakano, Takehito; Nozue, Yasuo; Sulaiman, Shukri; Ismail Mohamed-Ibrahim, Mohamad; Biswas, Pabitra Kumar; Watanabe, Isao


    Magnetic-ordered states of the pyrochlore iridates Nd2Ir2O7 (Nd227) and Sm2Ir2O7 (Sm227), showing metal-insulator transitions at 33 and 117 K, respectively, were studied by both the muon-spin-relaxation (μSR) method and density functional theory (DFT) calculations. A long-range magnetic ordering of Ir moments appeared in conjunction with the metal insulator transition, and additional long-range-ordered states of Nd/Sm moments were confirmed at temperatures below about 10 K. We found that the all-in all-out spin structure most convincingly explained the present μSR results of both Nd227 and Sm227. Observed internal fields were compared with values derived from DFT calculations. The lower limits of the sizes of magnetic moments were estimated to be 0.12 μB and 0.2 μB for Ir and Nd moments in Nd227, and 0.3 μB and 0.1 μB for Ir and Sm moments in Sm227, respectively. Further analysis indicated that the spin coupling between Ir and Nd/Sm moments was ferromagnetic for Nd227 and antiferromagnetic for Sm227.

  15. 78 FR 33120 - Final Interim Staff Guidance LR-ISG-2011-04; Updated Aging Management Criteria for Reactor Vessel... (United States)


    ... Evaluation Guidelines (MRP-227-A), dated December 2011 (ADAMS Accession No. ML12017A193 [Transmittal letter from the EPRI-MRP] and ADAMS Accession Nos. ML12017A194, ML12017A196, ML12017A197, ML12017A191... ensure consistency with MRP-227-A and provides a framework to ensure that PWR license renewal...

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116978 |AC116978.1 Dictyostelium di...VF (Link to library) VFC227 (Link to dictyBase) - - - Contig-U16444-1 VFC227Z (Link... to Original site) - - VFC227Z 622 - - - - Show VFC227 Library VF (Link to library) Clone ID VFC227 (Link to di...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16444-1 Original site URL http://dict...scoideum chromosome 2 map 4846697-4874480 strain AX4, *** SEQUENCING IN PROGRESS ***. 876 0.0 5 AC117076 |AC117076.2 Di

  17. The use of DNA markers in the pre-clinical diagnosis of familial ...

    African Journals Online (AJOL)

    Histopathological proof of FAP was .... second degree, provided further evidence that probes Pi227 .... eventually enable the development of rapid DNA-based .... non-Jewish adult G.,a gangliosidosis patients share a common genetic defect.

  18. health in Wakiso District, Uganda

    African Journals Online (AJOL)

    In a qualitative study on the perceptions of domestic violence in Wakiso district, payment of bride price emerged as .... Bride price payment was found acceptable to many older women .... Issues in Mental Health Nursing 1989; 10: 209-227. 11.

  19. Data of evolutionary structure change: 1DJ2B-1ADIA [Confc[Archive

    Lifescience Database Archive (English)


  20. CA FOB IOS

    African Journals Online (AJOL)

    case as the threat of protein nutritional stress dangles on. Although a .... DM= Dry matter. Table 2: Prophylactic program used for the piglets ..... pre - and post - partum nutrition on growth of goat kids. Small Ruminant Research 3:227 - 236.

  1. Water classification of the Colorado River Corridor, Grand Canyon, Arizona, 2013—Data (United States)

    U.S. Geological Survey, Department of the Interior — These data area classified maps of water in the Colorado River at a discharge of approximately 227 meters squared/second in Grand Canyon from Glen Canyon Dam to...

  2. Do We Know What Causes Soft Tissue Sarcomas? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  3. Breast Reconstruction Options (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  4. What Are Lung Carcinoid Tumors? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  5. Non-Specific Immunotherapies and Adjuvants (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  6. Advance Directives (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  7. What Is Childhood Leukemia? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  8. How Is Cancer of the Esophagus Diagnosed? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  9. Do We Know What Causes Ovarian Cancer? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  10. What Is Waldenstrom Macroglobulinema? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  11. How Is Breast Cancer in Men Diagnosed? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  12. Gallbladder Cancer: Surgery (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  13. What Is Uterine Sarcoma? (United States)

    ... Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every Minute ... 227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of use ...

  14. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... 2 MB) Close × Evidence-based Treatment: What Does It Mean? Right Click here to download "Evidence-based Treatment: What Does It Mean?" (22.7 MB) Close × Prolonged Exposure for ...

  15. [Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887)] / Paul Kaegbein

    Index Scriptorium Estoniae

    Kaegbein, Paul


    Arvustus: Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887). - Ostseeprovinzen, baltische Staaten und das Nationale. Münster : LIT, 2005. Lk. 227-250. Tallinna linnaarhiivi esimesest linnaarhivaarist

  16. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... MB) Close × Evidence-based Treatment: What Does It Mean? Right Click here to download "Evidence-based Treatment: What Does It Mean?" (22.7 MB) Close × Prolonged Exposure for PTSD ...

  17. 45 CFR 673.1 - Purpose of regulations. (United States)


    ..., Tourism and Conservation Act of 1996, Public Law 104-227, and Article 15 of the Protocol on Environmental... environmental protection obligations under the Antarctic Conservation Act. (Approved by the Office of Management...

  18. Cost–effectiveness of salmeterol in patients with chronic obstructive pulmonary disease: an economic evaluation

    National Research Council Canada - National Science Library



    .... This 16-week study examined the cost-effectiveness of salmeterol in this patient group. Patients with a history of COPD were randomised to treatment with salmetrol 50 mcg (229 patients) or placebo (227 patients...

  19. EST Table: FS796464 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/09/09 32 %/334 aa FBpp0237202|DvirGJ227...milar to putative lysosomal glucocerebrosidase [Tribolium castaneum] FS796494 ffbm ...

  20. Get Tested for Colon Cancer: Here's How

    Medline Plus

    Full Text Available ... Statistics Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every ... 800.227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of ...

  1. Colonization of marine snow aggregates by invertebrate zooplankton : Abundance, scaling, and possible role

    DEFF Research Database (Denmark)

    Kiørboe, Thomas


    I compiled literature observations of abundances of invertebrate zooplankters associated with marine snow aggregates in the euphotic zone. Abundances, normalized with ambient concentrations of colonizers, scale with equivalent aggregate radius raised to power 2.27. Different taxonomic groups showed...

  2. Gene : CBRC-HSAP-10-0042 [SEVENS

    Lifescience Database Archive (English)


  3. October, 2009 ISSN 1994-9057 (Print) ISSN 2070-0083

    African Journals Online (AJOL)

    Nekky Umera

    where there are motivated 'others', that is, parents, older siblings, aunts and uncles to ... of the specialized materials in higher classes and beyond” (p.227). Secondary ... stressed that many Nigerian students attend schools without the basic.

  4. Õpetajate Lehe tellimiseks on vaja eriluba / Sirje Tohver

    Index Scriptorium Estoniae

    Tohver, Sirje, 1948-


    Tallinna linnapea 29. oktoobri käskkirjaga nr PO-1/227 keelatakse linna ameti- ja nende hallatavatel asutustel, sh koolidel ja lasteaedadel tellida 2010. aastaks rohkem kui üks üleriigiline päevaleht

  5. [Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887)] / Paul Kaegbein

    Index Scriptorium Estoniae

    Kaegbein, Paul


    Arvustus: Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887). - Ostseeprovinzen, baltische Staaten und das Nationale. Münster : LIT, 2005. Lk. 227-250. Tallinna linnaarhiivi esimesest linnaarhivaarist

  6. 76 FR 78082 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to Executive Order 12978 (United States)


    ..., Medellin, Colombia; Carrera 52 No. 72-65 Local 106, Barranquilla, Colombia; Carrera 66B No. 34A-76 Local 227, Medellin, Colombia; Centro Comercial Cosmocentro Local 103, Cali, Colombia; Transversal 71D...

  7. Genetic characterization of mango anthracnose pathogen ...

    African Journals Online (AJOL)



    Jun 28, 2010 ... African Journal of Biotechnology Vol. 9(26), pp. ... 2Molecular Plant Pathology Laboratory, CISH, Lucknow-227 017, India. ... Fruit anthracnose pathogens, C. gloeosporioides, Colletotrichum .... On leaves, lesions, brown to.

  8. Sports-related dentofacial trauma among high school students in ...

    African Journals Online (AJOL)

    Sports-related dentofacial trauma among high school students in Nairobi. ... PROMOTING ACCESS TO AFRICAN RESEARCH ... of all the participants reported having had some form of medical insurance while 227 (44.5%) did not have any.

  9. The importance of choice attributes and the positions of the airlines ...

    African Journals Online (AJOL)

    aimed to determine the choice criteria used by consumers in airline choice, ... Mullins and Walker (2010: 206) break down positioning into a seven-step process: ..... Hoyer and MacInnis (2007: 227) explain that in making a decision, consumers.

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 227 ... Vol 14, No 1 (2008), Ageing and mental health resources for older persons ... interpersonal psychotherapy in treating depression in HIV positive patients ... of South African adults with Type 2 diabetes mellitus, Abstract PDF.

  11. 78 FR 49370 - Inflation Adjustment of Maximum Forfeiture Penalties (United States)


    ... Job Creation Act of 2012, 72 FR 71131, 71134 (November 29, 2012). Accordingly, the only penalties... Records & 9,600/day. Accounts. Sec. 223(b) Dial-a-Porn 80,000/day. ] Sec. 227(e) 10,000/violation....

  12. Alternative tube caps on in vitro growth of Orbignya oleifera Burret ...

    African Journals Online (AJOL)

    Tuoyo Aghomotsegin


    Oct 19, 2016 ... The experiment was conducted at the Laboratory of Culture and. Plant Tissues, Goiano ... The experimental design was completely randomized (CRD) and consisted of four .... Plant Cell Tissue Organ Cult. 110(2):227-238.

  13. 77 FR 64837 - Federal Aviation Administration (United States)


    ... Federal Aviation Administration Fourth Meeting: RTCA Special Committee 227, Standards of Navigation Performance AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION... 15, 2012. Kathy Hitt, Management Analyst, Business Operations Group, Federal Aviation...

  14. Profile of stress factors associated with mental disorders in children ...

    African Journals Online (AJOL)

    Profile of stress factors associated with mental disorders in children and adolescents referred for ... South African Journal of Psychiatry ... and disruptive behaviour disorders, followed by major depressive disorders (22.7%), anxiety disorders ...

  15. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... please perform the following steps. 1. Please switch auto forms mode to off. 2. Hit enter to ... Exposure for PTSD" (22.7 MB) Close Video Help Problems viewing videos in pop up windows? See ...

  16. Get Tested for Colon Cancer: Here's How

    Medline Plus

    Full Text Available ... Abuse Global Health ACS CAN Sign Up for Email Policies Our Volunteers More ACS Sites Bookstore Shop ... 800-227-2345 any time day or night. Email Address (optional) Praise Dislike Suggestion What made your ...

  17. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... 2 MB) Close × Evidence-based Treatment: What Does It Mean? Right Click here to download "Evidence-based Treatment: What Does It Mean?" (22.7 MB) Close × Prolonged Exposure for ...

  18. Get Tested for Colon Cancer: Here's How

    Medline Plus

    Full Text Available ... Statistics Center Volunteer Learning Center Follow Us Twitter Facebook Instagram Cancer Information, Answers, and Hope. Available Every ... 800.227.2345 Live Chat Follow Us Twitter Facebook Instagram help site map privacy accessibility terms of ...

  19. Aquatic concentrations of chemical analytes compared to ecotoxicity estimates (United States)

    U.S. Environmental Protection Agency — We describe screening level estimates of potential aquatic toxicity posed by 227 chemical analytes that were measured in 25 ambient water samples collected as part...


    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.


    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  1. NCBI nr-aa BLAST: CBRC-DYAK-03-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-03-0009 ref|YP_311187.1| putative transport protein [Shigella sonnei Ss04...6] ref|YP_408457.1| putative transport protein [Shigella boydii Sb227] gb|AAZ88952.1| putative transport protein [Shigella... sonnei Ss046] gb|ABB66629.1| putative transport protein [Shigella boydii Sb227] YP_311187.1 0.82 22% ...

  2. NCBI nr-aa BLAST: CBRC-DSIM-03-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-03-0006 ref|YP_311187.1| putative transport protein [Shigella sonnei Ss04...6] ref|YP_408457.1| putative transport protein [Shigella boydii Sb227] gb|AAZ88952.1| putative transport protein [Shigella... sonnei Ss046] gb|ABB66629.1| putative transport protein [Shigella boydii Sb227] YP_311187.1 1.4 22% ...

  3. Dicty_cDB: SFF738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Y923753_1( AY923753 |pid:none) Physarum polycephalum glycosyl hyd... 288 3e-76 DQ390347_1( DQ390347 |pid:none) Hart...mannella vermiformis glycosyl ... 227 6e-58 DQ384328_1( DQ384328 |pid:none) Hartmannella vermiformis ...glycosyl ... 227 6e-58 DQ384329_1( DQ384329 |pid:none) Hartmannella vermiformis g

  4. Assessing the State of Procurement Knowledge Production: Implications for the Federal Government (United States)


    TCE) Microeconomic 82 15.53% Resource-Based View (RBV) Competitive 45 8.52% Social Exchange Theory Social Exchange 28 5.30% Relationship...Marketing Marketing 23 4.36% Contingency Theory Competitive 21 3.98% Resource Dependence Theory Microeconomic 18 3.41% Agency Theory Microeconomic 16 3.03...Game Theory Microeconomic 15 2.84% Organizational Learning Theories of Organizations 12 2.27% Social Network Theory Social Exchange 12 2.27

  5. Chesapeake Bay Low Freshwater Inflow Study. Biota Assessment. Phase I. Volume I. (United States)


    101 111-13. Schematic Diagram of Movements of Estuarine-Dependent Fish Larvae and Juveniles Toward a Common Low Salinity Nursery Area... Larvae and Juveniles Off the East Coast of the United States." Fish. Bull. 77 (1): 213 - 227. Ketchum. B.H. 1967. "Phytoplankton Nutrients in Estuaries...bution of Bluefish, Pomatomus saltatrix, Larvae and Juveniles off the East Coast of the United States." Fish. Bull. 77(l):213 - 227. Kerr, S.R. 1971 a

  6. Reclassification of English Learners

    Directory of Open Access Journals (Sweden)

    James B. Grissom


    Full Text Available Ron Unz, originator of Proposition 227, claimed, prior to the passage of Prop. 227, that the five percent annual reclassification rate of English learners to fluent English proficient indicated bilingual education was a failure. Critics of Prop. 227 have countered that the annual reclassification rate has changed little since the passage of Prop. 227, indicating the new legislation had no effect on reclassification rates. Unfortunately, the annual reclassification rate does not provide a clear indicator of how long it takes students to be reclassified after entering the school system. To better estimate reclassification rates for English learners in California, cohorts were created to track the same groups of students over time. Ron Unz also claimed that test scores for immigrant students improved dramatically after the passage of Prop. 227. To evaluate his claim, average test scores were calculated by language fluency. Based on statewide data from three different cohorts tracked across four years, Prop. 227 has had no effect on reclassification rates or test scores.

  7. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.


    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  8. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré


    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  9. Rutherford's curriculum vitae, 1894-1907. (United States)

    Cohen, M


    A single page, handwritten document was discovered when the Macdonald Physics building of McGill University in Montreal was gutted in 1978. This proved to be the draft of Ernest Rutherford's curriculum vitae (C.V.) covering the years 1894-1907, probably written in the autumn of 1906 when Rutherford was preparing to leave McGill. The C.V. contains 21 headings in chronological order, referring to research and other activities of Rutherford and his coauthors (especially Soddy and Barnes), plus a further set of headings relating to the associated investigations of Rutherford's team, including Eve and Hahn. A transcript of the document is provided, although in several places, Rutherford's handwriting is difficult to interpret, and the significance of his abbreviations is not always clear. Each of the items in the C.V. is discussed briefly in this review, in the light both of Rutherford's personal career and of the contribution of his team to the development and understanding of radioactivity. This contribution included the cause and nature of radioactivity (with Soddy), energy aspects of radioactive decay (with Barnes), elucidation of the uranium-radium, thorium and actinium series (Godlewski and Hahn), the radioactivity of the earth and atmosphere (Eve), the nature of the gamma rays (Eve) and, perhaps most important of all, the nature and properties of the alpha particle (Rutherford himself). The latter investigations led directly to Rutherford's later work in Manchester, including the nuclear model of the atom and artificial disintegration of the nucleus.


    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  11. Purification of lanthanides for double beta decay experiments

    Energy Technology Data Exchange (ETDEWEB)

    Polischuk, O. G. [Institute for Nuclear Research, MSP 03680 Kyiv, Ukraine and INFN, Section of Rome, La Sapienza, I-00185 Rome (Italy); Barabash, A. S. [Institute of Theoretical and Experimental Physics, 117259 Moscow (Russian Federation); Belli, P. [INFN, Section of Rome Tor Vergata, I-00133 Rome (Italy); Bernabei, R. [INFN, Section of Rome Tor Vergata, I-00133 Rome, Italy and Department of Physics, University of Rome Tor Vergata, I-00133 Rome (Italy); Boiko, R. S.; Danevich, F. A.; Mokina, V. M.; Poda, D. V.; Tretyak, V. I. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Cappella, F.; Incicchitti, A. [INFN, Section of Rome La Sapienza, I-00185 Rome, Italy and Department of Physics, University of Rome La Sapienza, I-00185 Rome (Italy); Cerulli, R.; Laubenstein, M.; Nisi, S. [INFN, Gran Sasso National Laboratories, I-67100 Assergi (Aq) (Italy)


    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain {sup 238}U, {sup 226}Ra and {sup 232,228}Th typically on the level of ∼ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO{sub 2}, Nd{sub 2}O{sub 3} and Gd{sub 2}O{sub 3}. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R and D of the methods to remove the pollutions with improved efficiency is in progress.

  12. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. (United States)

    Nour, S; El-Sharkawy, A; Burnett, W C; Horwitz, E P


    The objective of this work was to establish a new procedure for 228Ra determination of natural waters via preconcentration of radium on MnO2 and separation of its daughter, 228Ac, using Diphonix ion exchange resin. Following removal of potential interferences via passage through an initial Diphonix Resin column, the first daughter of 228Ra, 228Ac, is isolated by chromatographic separation via a second Diphonix column. A holding time of > 30 h for 228Ac ingrowth in between the two column separations ensures secular equilibrium. Barium-133 is used as a yield tracer. Actinium-228 is eluted from the second Diphonix Resin with 5 ml 1M 1-Hydroxyethane-1,1-diphosphonic acid (HEDPA) and quantified by addition of scintillation cocktail and LSC counting. Radium (and 133Ba) from the load and rinse solutions from the 2nd Diphonix column may be prepared for alpha spectrometry (for determination of 223Ra, 224Ra, and 226Ra) by BaSO4 microprecipitation and filtration. Decontamination tests indicate that U, Th, and Ra series nuclides do not interfere with these measurements, although high contents of 90Sr (90Y) require additional treatment for accurate measurement of 228Ra. Addition of stable Sr as a "hold back" carrier during the initial MnO2 preconcentration step was shown to remove most 90Sr interference.

  13. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    Energy Technology Data Exchange (ETDEWEB)

    Segre, Nadia; Fagundes, Rosane Correa, E-mail: [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)


    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  14. Background radiation and individual dosimetry in the costal area of Tamil Nadu, India. (United States)

    Matsuda, Naoki; Brahmanandhan, G M; Yoshida, Masahiro; Takamura, Noboru; Suyama, Akihiko; Koguchi, Yasuhiro; Juto, Norimichi; Raj, Y Lenin; Winsley, Godwin; Selvasekarapandian, S


    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2×7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y(-1). From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g(-1) of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y(-1) ranging from 2.79 to 14.17 mSv y(-1).

  15. Coupling of Uranium and Thorium Series Isotope Systematics for Age Determination of Late Pleistocene Zircons using LA-ICP-MS (United States)

    Sakata, S.; Hirakawa, S.; Iwano, H.; Danhara, T.; Hirata, T.


    Zircon U-Th-Pb dating method is one of the most important tools for estimating the duration of magmatism by means of coupling of uranium, actinium and thorium decay series. Using U-Pb dating method, its reliability is principally guaranteed by the concordance between 238U-206Pb and 235U-207Pb ages. In case of dating Quaternary zircons, however, the initial disequilibrium effect on 230Th and 231Pa should be considered. On the other hands, 232Th-208Pb dating method can be a simple but powerful approach for investigating the age of crystallization because of negligible influence from initial disequilibrium effect. We have developed a new correction model for accurate U-Pb dating of the young zircon samples by taking into consideration of initial disequilibrium and a U-Pb vs Th-Pb concordia diagram for reliable age calibration was successfully established. Hence, the U-Th-Pb dating method can be applied to various zircons ranging from Hadean (4,600 Ma) to Quaternary (~50 ka) ages, and this suggests that further detailed information concerning the thermal history of the geological sequences can be made by the coupling of U-Th-Pb, fission track and Ar-Ar ages. In this presentation, we will show an example of U-Th-Pb dating for zircon samples from Sambe Volcano (3 to 100 ka), southwest Japan and the present dating technique using LA-ICP-MS.

  16. Cyclotron production of cesium radionuclides as analogues for francium-221 biodistribution (United States)

    Finn, R.; McDevitt, M.; Sheh, Y.; Lom, C.; Qiao, J.; Cai, S.; Burnazi, E.; Nacca, A.; Pillarsetty, N.; Jaggi, J.; Scheinberg, D.


    In our clinical investigations focussing on improved therapeutic treatment of specific tumors we have concentrated on a targeted therapy approach utilizing designed radiolabeled monoclonal antibodies as the cytotoxic reagent. The physical characteristics of the alpha particle emitting radionuclide bismuth-213 including the short half-life of 45.6 min, has shown promise for the treatment of specific cancers such as leukemias and lymphomas or micrometastatic carcinomas. In an effort to increase the cytocidal effect of the HuM195, a humanized monoclonal antibody carrier to the CD33 antigen expressed on leukemia cells, our focus is directed toward an "internal" nano-generator composed of Ac-225 radionuclide, the parent of the bismuth-213. The actinium-225 radionuclide decays through several short-lived, alpha emitting daughters including francium-221, astatine-217 and bismuth-213. In order to study the biodistribution and the pharmacokinetics of the individual daughter nuclide, francium-221, the cyclotron production and separation of cesium radionuclides, specifically cesium-132, from a natural xenon gas target was undertaken. The choice of cesium as an analogue for francium was predicated upon both elements being in Group 1A alkali metals and cesium radionuclide possesses a sufficient half-life to allow biodistribution studies to be performed. The preliminary experimental results of this investigation are presented.

  17. An Ion Exchange Study of Possible Hydridized 5f Bonding in theActinides

    Energy Technology Data Exchange (ETDEWEB)

    Diamond, R.M.; Street, Jr., K.; Seaborg, G.T.


    A study has been made of the elution behavior of curium(III), americium(III), plutonium(III), actinium(III), plutonium(IV), neptunium(IV), uraniuM(IV), thorium(IV), neptunium(V), plutonium (VI), uranium (VI), lanthanum(III), cerium(III), europium(III), ytterbium(III), ytterium(III), strontium(II), barium(II), radium(II), cesium(I) with 3.2 M, 6.2 M, 9.3 M, and 12.2 M HCl solutions from Dowex-50 cation exchange resin columns. These elutions show that in high concentrations of hydrochloric acid the actinides form complex ions with chloride ion to a much greater extent than the lanthanides. The strengths of the tripositive actinide complex ions apparently go in the order plutonium > americium> curium, although their ionic radii also decrease in this same order. To explain these results, a partial covalent character may be ascribed to the bonding in the transuranium complex ions. It is shown that a reasonable structure for such covalent bonding involves hybridization of the 5f orbitals in the actinide elements.

  18. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)


    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

  19. Octupole Deformed Nuclei in the Actinide Region

    CERN Multimedia

    Thorsteinsen, T; Rubio barroso, B; Simpson, J; Gulda, K; Sanchez-vega, M; Cocks, J; Nybo, K; Garcia borge, M; Aas, A; Fogelberg, B; Honsi, J; Smith, G; Naumann, R; Grant, I


    The aim of the present study is to investigate the limits of the "island" of octupole deformation in the mass region A=225. It is of particular importance to demonstrate experimentally the sudden disappearance of the stable octupole deformation in the presence of a well developed quadrupole field. \\\\ \\\\In order to establish the upper border line the $\\beta$ -decay chains of $^{227}$Rn $\\rightarrow ^{227}$Fr $\\rightarrow ^{227}$Ra and $^{231}$Fr $\\rightarrow ^{231}$Ra $\\rightarrow ^{231}$Ac were studied at PSB-ISOLDE using advanced fast timing and $\\gamma$-ray spectroscopy techniques. The lifetimes of the excited states have been measured in the picosecond range using the time-delayed $\\beta\\gamma\\gamma$(t) method.

  20. Any Peer Competitors Out There? An Economic Perspective to the Growth of Potential Peer Competitors (United States)


    Country Growth Regression,” American Economic Review , Vol. 82, (Sep 92), 942-963. 3 Levine and Renelt, “Sensitivity Analysis,” 949. 4 Vaclav Smil...for China’s Growth Performance,” American Economic Review , Vol. 86, No. 2, May 96, 227. 2 “State Run Firm to Sell More Coal at Market Prices,” Journal...29 Eduardo Borenzstein and Jonathan D. Ostry, “Accounting for China’s Growth Performance,” American Economic Review , Vol. 86, no. 2, May 96, 227. 30

  1. H+CO 2→OH+CO: Yield versus HI photolysls wavelength and OH rotational distributions under single-collision conditions and with CO 2HI complexes (United States)

    Chen, Y.; Hoffmann, G.; Oh, D.; Wittig, C.


    The title reaction was studied under single-collision conditions using 227-285 nm HI photolysis. A large decrease in the OH yield was observed as the photolysis wavelength was increased. Rotational distributions were obtained at 227, 239, 251, 263 and 280 nm. Similar yield versus wavelength data were obtained for CO 2HI complexes (233-263 nm). The OH rotational distribution obtained using 239 nm CO 2HI photolysis differs markedly from its single-collision H+CO 2 counterpart.

  2. The Role of Dioxin Receptor in Mammary Development and Carcinogenesis (United States)


    Stimulation of calcium uptake in cultured rat hippocampal neurons by 2,3,7,8-tetrachlorodibenzo-p-dioxin. Toxicology 112:19–28. Jones PB, Galeazzi DR, Fisher JM...P.B., Galeazzi , D.R., Fisher, J.M., Whitlock Jr., J.P., 1985. Con- trol of cytochrome P1–450 gene expression by dioxin. Science 227, 1499–1502... Galeazzi DR, Fisher JM, Whitlock JP, Jr.: Control of cytochrome P1-450 gene expression by dioxin. Science 1985, 227(4693):1499-1502. 5. Gonzalez FJ

  3. Army Science and Technology Master Plan, Fiscal Year 1997 - Volume 2. (United States)


    be demonstrated in FY97 and 98, respectively, to exploit both commercial CDMA and BCDMA technology for MSE access. In order to extend ATM services to...Florence John Appel MAJ Paul Begeman TARDEC SARD-TT Armor Center, DFD (810)574-5473 697-8432 (502)624-8994 DSN : 786-5473 227-8432 464-8994 III.G.06. Hit...AATD SARDA-TF Avn Center (DCD) ATZQ-CD 804-878-4130 703-697-8434 334-255-3370/3489 DSN 927-4130 DSN 227-8434 DSN 558 A-4-2 D. AIR AND SPACE VEHICLES

  4. Targeted Lymphoma Cell Death by Novel Signal Transduction Modifications (United States)


    binding via direct visualization . negative #41 HB22.7 Figure 11. Ramos B cells were either incubated with anti-mouse FITC (negative), HB22.7 + anti...plemented with 10% FCS and incubated with AET - activated sheep red blood cells (SRBC) for 1 h. B-cells were collected at the interface after centrifugation...prepared and incubated with cells (4 9 104 cells/ml) for 4 days. Percent cell killing was quan- tified by visual examination using trypan blue dye exclusion

  5. 黑可信新闻

    Institute of Scientific and Technical Information of China (English)


    英国12个月记下227起“超自然事件”超往年纪录据台湾省“今日新闻网”报道,一项27日发表的研究显示,英国在过去12个月来破纪录地记下227起让人震骇的“超自然事件”(Paranormal Events),不明真象的事件数量明显飙升。

  6. Gclust Server: 137076 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 137076 PoTR_587240 Cluster Sequences - 227 eugene3.209210001 1 1.00e-99 14.29 0.0 0....0 0.0 0.0 0.0 Show 137076 Cluster ID 137076 Sequence ID PoTR_587240 Link to cluster sequences Cluster Seque...nces Link to related sequences - Sequence length 227 Representative annotation eugene3.209210001 Number of not appearing in this cluster ATH: 0 OSA: 0 PPT: 0 CRE: 0 OTAU: 0 CME: 0 GTH: 0 PFA: 0 PTR: 0 TPS: 0 Ter:

  7. An aerial radiological survey of the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Hendricks, T J; Riedhauser, S R


    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys.

  8. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    Full Text Available BACKGROUND: Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature. METHODOLOGY AND PRINCIPAL FINDINGS: Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy. CONCLUSIONS: The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  9. Evaluation of naturally occurring radioactive materials (NORMs) in inorganic and organic oilfield scales from the Middle East. (United States)

    Bassioni, Ghada; Abdulla, Fareed; Morsy, Zeinab; El-Faramawy, Nabil


    The distribution of natural nuclide gamma-ray activities and their respective annual effective dose rates, produced by potassium-40 (⁴⁰K), uranium-238 (²³⁸U), thorium-232 (²³²Th), and radium-226 (²²⁶Ra), were determined for 14 oilfield scale samples from the Middle East. Accumulated radioactive materials concentrate in tubing and surface equipment, and workers at equipment-cleaning facilities and naturally occurring radioactive materials (NORMs) disposal facilities are the population most at risk for exposure to NORM radiation. Gamma-spectra analysis indicated that photo-gamma lines represent the parents of 10 radioactive nuclides: ²³⁴Th, plutonium-239, actinium-228, ²²⁶Ra, lead-212 (²¹²Pb), ²¹⁴Pb, thallium-238 (²⁰⁸Tl), bismuth-212 (²¹²Bi), ²¹⁴Bi, and ⁴⁰K. These nuclides represent the daughters of the natural radioactive series ²³⁸U and ²³²Th with ⁴⁰K as well. The mean activity concentration of ²³⁸U, ²³²Th, and ⁴⁰K were found to be 25.8 ± 11.6, 18.3 ± 8.1, and 4487.2 ± 2.5% Bq kg⁻¹ (average values for 14 samples), respectively. The annual effective dose rates and the absorbed doses in air, both indoor and outdoor, for the samples were obtained as well. The results can be used to assess the respective hazard on workers in the field and represent a basis for revisiting current engineering practices.

  10. Alpha-emitting isotopes and chromium in a coastal California aquifer (United States)

    Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.


    The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238U and its daughter 234U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232Th, including its daughter 224Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ53Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development.

  11. A survey of arsenic, manganese, boron, thorium, and other toxic metals in the groundwater of a West Bengal, India neighbourhood. (United States)

    Bacquart, Thomas; Bradshaw, Kelly; Frisbie, Seth; Mitchell, Erika; Springston, George; Defelice, Jeffrey; Dustin, Hannah; Sarkar, Bibudhendra


    Around 150 million people are at risk from arsenic-contaminated groundwater in India and Bangladesh. Multiple metal analysis in Bangladesh has found other toxic elements above the World Health Organization (WHO) health-based drinking water guidelines which significantly increases the number of people at risk due to drinking groundwater. In this study, drinking water samples from the Bongaon area (North 24 Parganas district, West Bengal, India) were analyzed for multiple metal contamination in order to evaluate groundwater quality on the neighbourhood scale. Each sample was analyzed for arsenic (As), boron (B), barium (Ba), chromium (Cr), manganese (Mn), molybdenum (Mo), nickel (Ni), lead (Pb), and uranium (U). Arsenic was found above the WHO health-based drinking water guideline in 50% of these tubewells. Mn and B were found at significant concentrations in 19% and 6% of these tubewells, respectively. The maps of As, Mn, and B concentrations suggest that approximately 75% of this area has no safe tubewells. The concentrations of As, Mn, B, and many other toxic elements are independent of each other. The concentrations of Pb and U were not found above WHO health-based drinking water guidelines but they were statistically related to each other (p-value = 0.001). An analysis of selected isotopes in the Uranium, Actinium, and Thorium Radioactive Decay Series revealed the presence of thorium (Th) in 31% of these tubewells. This discovery of Th, which does not have a WHO health-based drinking water guideline, is a potential public health challenge. In sum, the widespread presence and independent distribution of other metals besides As must be taken into consideration for drinking water remediation strategies involving well switching or home-scale water treatment.

  12. Fostering Biliteracy in a Monolingual Milieu: Reflections on Two Counter-Hegemonic English Immersion Classes (United States)

    Manyak, Patrick C.


    This article presents data from two yearlong ethnographic studies of the biliteracy instruction and development of young Latina/o children in two counter-hegemonic English immersion classes in the English-only milieu established by California's Proposition 227. The author first describes the struggle that the teachers engaged in as they sought to…

  13. Evaluation and reselection of wheat resistance to Russian wheat aphid biotype 2 (United States)

    Russian wheat aphid (RWA, Diuraphis noxia, Mordvilko) biotype 2 (RWA2) is virulent to most known RWA resistance genes and severely threatens wheat production in the hard winter wheat area of the US western Great Plains. We determined RWA2 reactions of 386 cultivars from China, 227 advanced breeding...

  14. Minority Undergraduate Research in Prostate Cancer: Bridging Opportunities for Postbaccalaureate Education (United States)


    Hydrogels for Controlling the Cell Microenvironment : Fibrous Materials for Understanding and Directing Ligament Regeneration 152) Catherine Halat...Karoline Guerrero, Marketing (McNair) Daniel Freeman, Business Administration Co-shopping with Luxury Brands 227) Dana Griskowitz, Sports Management (SL...Exceptional Care for Children Marketing , Managing Art erapy, and Mural Painting at Exceptional Care for Children Elizabeth Knight, Material Culture

  15. Faculty Perspectives and Needs in Supporting Adult English Learners: Linking Measurement to Practice (United States)

    Shore, Jane; Lentini, Jennifer; Molloy, Hillary; Steinberg, Jonathan; Holtzman, Steven


    Results from a survey of 227 adult English learner (EL) faculty in community and technical colleges in the United States reveal a clear desire to better serve adult ELs, but a lack of resources specifically designed to do so. Faculty want and need more resources to support the teaching and learning process, in the form of thoughtful assessments,…

  16. 78 FR 30898 - Information Collection Requirement; Defense Federal Acquisition Regulation Supplement; Rights in... (United States)


    ... Technical Data and Computer Software--Small Business Innovation Research (SBIR) Program. In accordance with... Regulation Supplement; Rights in Technical Data and Computer Software AGENCY: Defense Acquisition Regulations... in Technical Data, and Subpart 227.72, Rights in Computer Software and Computer Software...

  17. Sentinel node biopsy in head and neck cancer

    DEFF Research Database (Denmark)

    Ross, Gary L; Soutar, David S; Gordon MacDonald, D


    BACKGROUND: The aim was to determine the reliability and reproducibility of sentinel node biopsy (SNB) as a staging tool in head and neck squamous cell carcinoma (HNSCC) for T1/2 clinically N0 patients by means of a standardized technique. METHODS: Between June 1998 and June 2002, 227 SNB...

  18. The birth of counterjihadist terrorism: reflections on some unspoken dimensions of 22 July 2011

    NARCIS (Netherlands)

    Asprem, E.


    The religious and ideological standpoints of the Norwegian terrorist Anders Behring Breivik gathered some attention by scholars of religious studies in the wake of the 22/7 attacks in Oslo and on Utøya. These comments mostly focused on the question of Breivik's alleged Christianity: in what sense is

  19. Quality of life among prostate cancer patients : A prospective longitudinal population-based study

    NARCIS (Netherlands)

    Schaake, Wouter; de Groot, Martijn; Krijnen, Wim P.; Langendijk, Johannes A.; van den Bergh, Alfons C. M.


    Purpose: To investigate the course of quality of life (QoL) among prostate cancer patients treated with external beam radiotherapy and to compare the results with QoL of a normal age-matched reference population. Patients and methods: The study population was composed of 227 prostate cancer patients

  20. The impact of gastrointestinal and genitourinary toxicity on health related quality of life among irradiated prostate cancer patients

    NARCIS (Netherlands)

    Schaake, Wouter; Wiegman, Erwin M; de Groot, Martijn; van der Laan, Hans Paul; van der Schans, Cees P.; van den Bergh, Alfons C M; Langendijk, Johannes A


    PURPOSE: To determine the impact of late radiation-induced toxicity on health-related quality of life (HRQoL) among patients with prostate cancer. PATIENTS AND METHODS: The study sample was composed of 227 patients, treated with external beam radiotherapy. Common Terminology Criteria for Adverse Eve

  1. A Danish phonetically annotated spontaneous speech corpus (DanPASS)

    DEFF Research Database (Denmark)

    Grønnum, Nina


    A corpus is described consisting of non-scripted monologues and dialogues, recorded by 27 speakers, comprising a total of 73,227 running words, corresponding to 9 h and 46 min of speech. The monologues were recorded as one-way communication with an unseen partner where the speaker performed three...

  2. Associations between lifestyle factors and hand eczema severity

    DEFF Research Database (Denmark)

    Sørensen, Jennifer A; Fisker, Maja H; Agner, Tove


    for assessment of severity of hand eczema and questions on quality of life. RESULTS: A total of 773 individuals (546 women and 227 men) responded to the questionnaire and were included in the study. A strong association was found between tobacco smoking and hand eczema severity (p = 0.003), whereas...

  3. Experimental determination of the slow-neutron wavelength distribution

    DEFF Research Database (Denmark)

    Lebech, Bente; Mikke, K.; Sledziewska-Blocka, D.


    Different experiments for determining the slow-neutron wavelength distribution in the region 227-3 meV have been carried out, and the results compared. It is concluded that the slow-neutron wave-length distribution can be determined accurately by elastic scattering on a pure incoherent or a pure...

  4. Computational Vision Based on Neurobiology (United States)


    34 Journal of Personality and 71. M. Seibert and A.M. Waxman "Learning and Social Psychology, Vol. 37, pp. 2049-2058, 1979. recognizing 3D objects from...coherence. Nature. 358:412-414, 1992. 18. Petter, G. Nuove ricerche sperimentali sulla totalizzazione percettiva. Rivista di psicologia . 50: 213-227

  5. 21 CFR 520.905d - Fenbendazole powder. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Fenbendazole powder. 520.905d Section 520.905d... DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.905d Fenbendazole powder. (a) Specifications. (1) Each 2-ounce packet contains 2.27 grams (4 percent) of fenbendazole plus other...

  6. 76 FR 44933 - Determination on Adding Cancer, or a Certain Type of Cancer, to the List of WTC-Related Health... (United States)


    ... [Docket Number NIOSH-227] Determination on Adding Cancer, or a Certain Type of Cancer, to the List of WTC... be found at: . Background: The James Zadroga 9/11... Administrator of the World Trade Center (WTC) Health Program ``periodically conduct a review of all available...

  7. Depressive symptoms in adolescence : Longitudinal links with maternal empathy and psychological control

    NARCIS (Netherlands)

    Werner, Lente L. A. A.; Van der Graaff, Jolien; Meeus, W.H.J.; Branje, Susan J. T.


    Building on self-determination theory (Deci and Ryan in Psychological Inquiry, 11, 227-268. doi:10.1207/S15327965PLI1104_01, 2000), the aim of the current study was to examine the role of maternal affective and cognitive empathy in predicting adolescents' depressive symptoms, through mothers' psycho

  8. Depressive Symptoms in Adolescence: Longitudinal Links with Maternal Empathy and Psychological Control

    NARCIS (Netherlands)

    Werner, L.A.A.; van der Graaff, J.; Meeus, W.H.J.; Branje, S.J.T.


    Building on self-determination theory (Deci and Ryan in Psychological Inquiry, 11, 227-268. doi:10.1207/ S15327965PLI1104_01, 2000), the aim of the current study was to examine the role of maternal affective and cognitive empathy in predicting adolescents’ depressive symptoms, through mothers’ psych

  9. Myocardial disease

    Institute of Scientific and Technical Information of China (English)


    920666 Immunocytochemical study ofCuZn superoxide dismutase in the myocardi-um of normal subjects and patients ofrheumatic heart disease.ZHENG Yi(郑毅),et al. Dept Intern Med, Navy General Hosp,PLA, Beijing. 100037. Natl Med J China 1992;72(4): 225-227. By using the methods of immunocytochemistry

  10. Get Tested for Colon Cancer: Here's How

    Medline Plus

    Full Text Available ... need immediate cancer-related information or patient program assistance, please call 800-227-2345 any time day or night. ... your website experience challenging? [Please provide a link to the page if you experienced a technical issue.] Tell us about your idea to improve ...

  11. 76 FR 31453 - Special Conditions: Gulfstream Model GVI Airplane; Single-Occupant Side-Facing Seats (United States)


    ...; facsimile (425) 227-1320. SUPPLEMENTARY INFORMATION: Background On March 29, 2005, Gulfstream Aerospace... issue a finding of regulatory adequacy pursuant to section 611 of Public Law 92-574, the ``Noise Control... processed as defined in Federal Motor Vehicle Safety Standard (FMVSS) part 571.214, section S6.13.5....

  12. The Crimean Tatars and Their Influence on the `Triangle of Conflict’ - Russia-Crimea-Ukraine (United States)


    inhabitants, who were mentioned in literary references, were “the Cimmerians. Homer, in the Odyssey, mentioned them as the ones who populated the...47 Charles J. Halperin, Russia and the Golden Horde: the Mongol Impact on Medieval Russian History...extent and subject to distortion in light of contemporary political goals and issues.226 Moreover, Crimea is the multiethnic literary landscape,227 and




  14. How Can We Best Serve LEP Students? A Reply to Nicholas Meier and Stephen Krashen. (United States)

    Baker, Keith


    Meier and Krashen, both employed in California's education system, do an injustice to students in rehashing an already settled battle. Fed up with two decades of failure, California voters replaced bilingual education with structured English immersion. Meier and Krashen offer no suggestions for coping with Proposition 227. (27 references) (MLH)

  15. Parental Autonomy Support, Community Feeling and Student Expectations as Contributors to Later Achievement among Adolescents (United States)

    Froiland, John Mark; Worrell, Frank C.


    This longitudinal study examined the relationships among parental autonomy support, student intrinsic life goals (i.e. community feeling), student expectations for long-term educational attainment and later academic performance (measured by GPA) in 227 students in an ethnically and racially diverse high school. Hypotheses were tested with…

  16. Structure-Function Relationship of a Plant NCS1 Member – Homology Modeling and Mutagenesis Identified Residues Critical for Substrate Specificity of PLUTO, a Nucleobase Transporter from Arabidopsis (United States)

    Witz, Sandra; Panwar, Pankaj; Schober, Markus; Deppe, Johannes; Pasha, Farhan Ahmad; Lemieux, M. Joanne; Möhlmann, Torsten


    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. PMID:24621654

  17. Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis. (United States)

    Witz, Sandra; Panwar, Pankaj; Schober, Markus; Deppe, Johannes; Pasha, Farhan Ahmad; Lemieux, M Joanne; Möhlmann, Torsten


    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members.

  18. Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Sandra Witz

    Full Text Available Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members.

  19. Commanders Responsibilities in the Operations Process During the 1864 Red River Expedition (United States)


    1, vol. 34, part 1, 227. The Battle of Pleasant Hill occurred the following morning, 9 April.37 Union and Confederate forces battled furiously ...much indebted for the happy manner in which he forwarded this enterprise, giving it his whole attention day and night, scarcely sleeping while the work

  20. Commanders’ Responsibilities in the Operations Process During the 1864 Red River Expedition (United States)


    1, vol. 34, part 1, 227. The Battle of Pleasant Hill occurred the following morning, 9 April.37 Union and Confederate forces battled furiously ...much indebted for the happy manner in which he forwarded this enterprise, giving it his whole attention day and night, scarcely sleeping while the work

  1. Epidemiology of subtypes of hyperthyroidism in Denmark: a population-based study

    DEFF Research Database (Denmark)

    Carle, Allan; Pedersen, Inge Bulow; Knudsen, Nils


    Z227 632).Methods: A laboratory monitoring system identified subjects with thyroid function tests suggesting overt hyperthyroidism (low s-TSH combined with high s-thyroxine or s-triiodothyronine). For all subjects, we collected information on medical history, thyroid scintigraphy and thyroid hormone...

  2. 糙皮侧耳和康氏木霉二步混合发酵生产饲料蛋白的研究%STUDY ON FORAGE PROTEIN PRODUCTION BY TWO-STEP MIXED CULTURE FERMENTATION WITH Pleurotus ostreatus AND Trichoderma koningii

    Institute of Scientific and Technical Information of China (English)



    研究了糙皮侧耳(Pleurotus ostreatus)和康氏木霉C-3(Trichoderma Koningii C-3)降解稻草生产饲料蛋白的发酵工艺.发酵产物的粗蛋白含量达到 22.7 %,粗纤维降解率为 34 %.

  3. Broadband Teleseismic Array Recording in the Adirondack Mountains, New York State (United States)


    to the surrounding terrain. The exposed Adirondack granulite is believed to represent a small window of the much larger Grenville Province in Ontario...on experimental studies of seismic velocities in granulite , Geological Society of America Bulletin, v. 86, 227-236. Connery, J.E.P., and A.F. Kuckes

  4. Development of Advanced Technologies for Complete Genomic and Proteomic Characterization of Quantized Human Tumor Cells (United States)


    recently described in our recently published Science paper (1). The mutations defined in GBM tumors are analyzed against quantitative changes in class Active agents SN143 SN186 Alcohol antagonist 3 1 1 Antihelminthic 33 7 7 Antiarrhythmic 24 0 1 Antibacterial 227 11 11 Antifungal 55

  5. Assessment of undiscovered conventional oil and gas resources of Bonaparte Basin, Browse Basin, Northwest Shelf, and Gippsland Basin Provinces, Australia, 2011 (United States)

    Pollastro, Richard M.; Brownfield, Michael E.; Charpentier, Ronald R.; Cook, Troy A.; Klett, Timothy R.; Kirschbaum, Mark A.; Pitman, Janet K.; Schenk, Christopher J.


    Using a geology-based assessment methodology, the U.S. Geological Survey estimated means of 4.7 billion barrels of undiscovered oil and 227 trillion cubic feet of undiscovered natural gas in three major offshore petroleum basins of northwest Australia and in the Gippsland Basin of southeast Australia.

  6. Domain Modeling: NP_113674.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_113674.1 chr9 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr9/NP_113674....1/NP_113674.1_holo_94-171.pdb psi-blast 225C,227Q,228C,229G,230K,231P,232L,233H,234H,2

  7. EST Table: DY231350 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DY231350 EST02101 10/09/28 99 %/227 aa ref|NP_001037309.1| vitellogenin precursor [...s: Precursor dbj|BAA02444.1| vitellogenin precursor [Bombyx mori] dbj|BAA06397.1| vitellogenin [Bombyx mori

  8. EST Table: DN237644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DN237644 EST00770 10/09/29 99 %/227 aa ref|NP_001037309.1| vitellogenin precursor [...s: Precursor dbj|BAA02444.1| vitellogenin precursor [Bombyx mori] dbj|BAA06397.1| vitellogenin [Bombyx mori

  9. EST Table: DN237680 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DN237680 EST00806 10/09/29 95 %/227 aa ref|NP_001037309.1| vitellogenin precursor [...s: Precursor dbj|BAA02444.1| vitellogenin precursor [Bombyx mori] dbj|BAA06397.1| vitellogenin [Bombyx mori

  10. A Framework to Support Automated Classification and Labeling of Brain Electromagnetic Patterns (United States)


    Spatial analysis of evoked po- tentials in man—a review,” Progress in Neurobiology, vol. 23, no. 3, pp. 227–250, 1984. [38] “ Cartool software...Functional Brain Mapping Laboratory, Geneva, Switzerland, Cartool .htm. [39] T. Koenig, K. Kochi, and D. Lehmann, “Event

  11. 48 CFR 1827.305-4 - Conveyance of invention rights acquired by the Government. (NASA supplements paragraph (a)) (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Conveyance of invention... PATENTS, DATA, AND COPYRIGHTS Patent Rights Under Government Contracts 1827.305-4 Conveyance of invention... entire right to, title to, and interest in an invention under the clause at 1852.227-70, New Technology...

  12. Screening of Elderly for Chronic Kidney Disease

    NARCIS (Netherlands)

    Lezaic, Visnja; Bajcetic, Sanja; Perunicic-Pekovic, Gordana; Bukvic, Danica; Dimkovic, Nada; Djukanovic, Ljubica


    Background and Aims: The frequency of chronic kidney disease (CKD) markers was assessed in two groups of patients over 60 years - one without and the other with hypertension. Methods: The cross-sectional study involved 585 asymptomatic elderly patients (227 males), 93 without and 492 with hypertensi

  13. Martin Creed: "Tahan luua keskkonna, kus on hea olla" / intervjueerinud Maria Arusoo

    Index Scriptorium Estoniae

    Creed, Martin, 1968-


    Tallinna Kunstihoones 29. sept.-l publikuga kohtunud inglise kunstnik, muusik ja teoreetik Martin Creed endast, oma loomingust, loomeprotsessist, oma Turner Prize'i pälvinud installatsioonist "Work No 227. Lights going on and off", mis oli väljas näitusel "Continuum_Kunst kui taju. Ruum kui protsess" jm.

  14. Translation and Validation of the Malay Subjective Happiness Scale (United States)

    Swami, Viren


    The Subjective Happiness Scale (Lyubomirsky and Lepper, "Social Indicators Research," 46, 137-155, 1999) is a brief measure for assessing subjective happiness. The reliability and validity of the Malay version of the Subjective Happiness Scale was investigated in a community sample of 290 Chinese and 227 Malays in Malaysia. Results showed that the…

  15. Adolescent Time Attitude Scale: Adaptation into Turkish (United States)

    Çelik, Eyüp; Sahranç, Ümit; Kaya, Mehmet; Turan, Mehmet Emin


    This research is aimed at examining the validity and reliability of the Turkish version of the Time Attitude Scale. Data was collected from 433 adolescents; 206 males and 227 females participated in the study. Confirmatory factor analysis performed to discover the structural validity of the scale. The internal consistency method was used for…

  16. Using Strategy Instruction and Confidence Judgments to Improve Metacognitive Monitoring (United States)

    Huff, Jessica D.; Nietfeld, John L.


    Current models of self-regulated learning emphasize the pervasive need for metacognitive monitoring skills at all phases of the learning process (Winne and Hadwin in "Studying as self-regulated learning." In D. J. Hacker, J. Dunlosky, & A. C. Graesser (Eds.), "Metacognition in educational theory and practice" (pp. 227-304). Mahwah, NJ: Erlbaum,…

  17. 77 FR 59339 - Patents, Data, and Copyrights; CFR Correction (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Defense Acquisition Regulations System 48 CFR Part 227 Patents, Data, and Copyrights; CFR Correction In Title 48 of the Code of Federal Regulations, Chapter 2 (Parts 201--299), revised as of October 1,...

  18. Data of evolutionary structure change: 1DJ2B-1ADIB [Confc[Archive

    Lifescience Database Archive (English)


  19. Air Mission Laser Communications for 2040 (United States)


    aerodynamics . The missile launch detector (MLD) windows on the F-227 and the electro-optical targeting system (EOTS) on the F-358 offer two examples It might be a long winged, lightweight drone or it might be a modern airship . The important parameters are the capacity to pass information and

  20. 78 FR 17718 - Notice of Availability of a Record of Decision for the Searchlight Wind Energy Project, Clark... (United States)


    ... Helseth, Renewable Energy Project Manager, telephone 702-515-5173; address 4701 N. Torrey Pines Drive, Las... conformance with the 1998 Las Vegas Resource Management Plan, pages 2-26 and 2-27 and the Record of Decision, October 5, 1998, pages 19 and 20. The Environmental Protection Agency (EPA) and the BLM published the...

  1. It's All Relative: Different Levels of Relational Similarity Used in Children's Comparisons (United States)

    Paik, Jae H.; Mix, Kelly S.


    Using a sticker search task, Gentner and Rattermann ("Perspectives on thought and language: Interrelations in development" (Gelman & Byrnes, Eds.), pp. 225-227, 1991) found that the ability to ignore surface features and match objects in terms of relative size emerged around 5 years of age. However, because spatial position covaried with relative…

  2. 75 FR 9017 - Orders Limiting Scheduled Operations at John F. Kennedy International Airport, LaGuardia Airport... (United States)


    ... CFR Sec. 93.227 (DCA); 74 FR 51648 (Oct. 7, 2009) (EWR); 74 FR 51650 (Oct. 7, 2009) (JFK); 74 FR 51653... Airport, LaGuardia Airport and Newark Liberty International Airport; High Density Rule at Reagan National Airport AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of limited waiver of the...

  3. 76 FR 19517 - Orders Limiting Scheduled Operations at John F. Kennedy International Airport, LaGuardia Airport... (United States)


    ....\\1\\ \\1\\ 75 FR 9017 (Feb. 26, 2010). ATA also stated the National Oceanic and Atmospheric...\\ 14 CFR 93.227 (DCA); 74 FR 51648 (Oct. 7, 2009) (EWR); 74 FR 51650 (Oct. 7, 2009) (JFK); 74 FR 51653... Airport, LaGuardia Airport, and Newark Liberty International Airport; High Density Rule at Reagan...

  4. 78 FR 9731 - Gulf of Mexico, Outer Continental Shelf (OCS), Central Planning Area (CPA) Oil and Gas Lease Sale... (United States)


    ... Mississippi. In making its decision, BOEM considered alternatives to the proposed action and the potential... Bureau of Ocean Energy Management Gulf of Mexico, Outer Continental Shelf (OCS), Central Planning Area...: Notice of Availability (NOA) of a Record of Decision (ROD) for CPA Lease Sale 227 in the Gulf of Mexico...

  5. EST Table: FS855919 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS855919 E_FL_fner_53F07_F_0 10/09/28 100 %/227 aa ref|NP_001103794.1| calcyphosphine... isoform 1 [Bombyx mori] gb|ABF51310.1| calcyphosphine isoform 1 [Bombyx mori] 10/09/11 58 %/200 aa FBpp01

  6. EST Table: FS855652 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS855652 E_FL_fner_52J07_F_0 10/09/28 100 %/227 aa ref|NP_001103794.1| calcyphosphine... isoform 1 [Bombyx mori] gb|ABF51310.1| calcyphosphine isoform 1 [Bombyx mori] 10/09/11 58 %/200 aa FBpp01

  7. EST Table: FS814723 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS814723 E_FL_fmgV_43N12_F_0 10/09/28 100 %/222 aa ref|NP_001040396.1| calcyphosphine... isoform 2 [Bombyx mori] gb|ABF51311.1| calcyphosphine isoform 2 [Bombyx mori] 10/09/09 54 %/227 aa FBpp02

  8. Turbulence and Complex Flow Phenomena in Multi-Stage Axial Turbomachines (United States)


    J.J., Mulac R.A., Celestina M.L., 1986, "A Model for Closing the Inviscid Form of the Average-Passage Equation System," ASME Paper No. 86-GT-227...Adamczyk J.J.; Celestina M.L.; Beach T.A.; Barnett M., 1990, "Simulation Of Three Dimensional Viscous Flow Within A Multistage Turbine," J. of

  9. Technological properties of Lactobacillus fermentum involved in the processing of dolo and pito, West African sorghum beers, for the selection of starter cultures

    DEFF Research Database (Denmark)

    Sawadogo-Lingani, H.; Diawara, B.; Traoré, A.S.;


    ) and amylase production. An antimicrobial activity was detected for 33.3%, 31.8%, 22.7% and 15.9% of the isolates towards Staphylococcus aureus enterotoxin A producer, Staphylococcus aureus enterotoxin A and B producer, Escherichia coli and Listeria innocua, respectively. A similarity was found between...

  10. 48 CFR 3427.472 - Advertising of awards clause. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Advertising of awards... Copyrights 3427.472 Advertising of awards clause. The contracting officer shall insert the clause in 3452.227-72, Advertising of Awards, in all solicitations and contracts other than purchase orders....

  11. Comparing Diagnostic Outcomes of Autism Spectrum Disorder Using "DSM-IV-TR" and "DSM-5" Criteria (United States)

    Harstad, Elizabeth B.; Fogler, Jason; Sideridis, Georgios; Weas, Sarah; Mauras, Carrie; Barbaresi, William J.


    Controversy exists regarding the "DSM-5" criteria for ASD. This study tested the psychometric properties of the "DSM-5" model and determined how well it performed across different gender, IQ, and "DSM-IV-TR" sub-type, using clinically collected data on 227 subjects (median age = 3.95 years, majority had IQ > 70).…

  12. Structure-function relationship of a plant NCS1 member - Homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from arabidopsis

    KAUST Repository

    Witz, Sandra


    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. 2014 Witz et al.


    African Journals Online (AJOL)


    Prevention of Prenatal HIV Transmission in Kazakhstan. Zh. Trumova. Almaty – ... Countries of Central Asia inform report a rise of. HIV cases in that ... C, D) were found in. 55.9% of the women; 22.7% of them had sexually transmitted diseases.

  14. HIV among Transgender People (United States)

    ... Prevention VIH En Español Get Tested Find an HIV testing site near you. Enter ZIP code or city Follow HIV/AIDS CDC HIV CDC HIV/AIDS See RSS | ... Email Updates on HIV Syndicated Content Website Feedback HIV Among Transgender People Format: Select One PDF [227K] ...

  15. Selective Exposure to Televised Aggression. Report No. 7. (United States)

    Atkin, Charles K.; And Others

    This 2-wave panel survey of young people was conducted to explore the relationship between attitudes and viewing over time, examining aggressiveness and viewing of programs portraying physical and verbal aggression. Questionnaires were administered to 227 children in the fourth, sixth, and eighth grades in 1976 and again one year later. The…

  16. 14 CFR 1260.57 - New technology. (United States)


    ... education or an organization of the type described in section 501(c)(3) of the Internal Revenue Code of 1954... manufacture, in the case of a composition or product; to practice, in the case of a process or method; or to... experimental, developmental, or research work; and (ii) Include the clause at FAR 52.227-11 (suitably...

  17. Rose Atoll Site 29P 3/9/2006 25-26M (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Rose Atoll, site 29P (14 32.227S, 168 09.122W), between 25 and 26 meters along a permanent transect.

  18. Rose Atoll Site 29P 7/31/2004 29-30M (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Rose Atoll, site 29P (14 32.227S, 168 09.122W), between 29 and 30 meters along a permanent transect.

  19. 223Ra levels fed in the 223Fr β decay (United States)

    Abdul-Hadi, A.; Barci, V.; Weiss, B.; Maria, H.; Ardisson, G.; Hussonnois, M.; Constantinescu, O.


    The 223Fr β decay was reinvestigated using high-resolution single γ spectrometry as well as γ-γ coincidence techniques. For single γ-spectra measurements, radiochemically pure 223Fr sources were obtained by chromatographic separation from a 75 MBq activity 227Ac parent source and continuously purified of 223Ra and daughters. The analysis of the γ spectra of 30 sources showed the existence of 131 γ lines, of which 87 are reported for the first time in the 223Fr β decay although many of them are observed following the 227Th α decay. The 223Fr half-life was remeasured and found to be T1/2=22.00+/-0.07 min. γ-γ-t coincidence measurements were also carried out with 223Fr purified sources. The 223Ra level scheme was built on the basis of our γ data, as well as 227Th α-decay data. Among the 32 excited 223Ra levels, of which 22 were also known from 227Th α decay, 13 are newly reported from 223Fr β decay. Low energy levels (E<400 keV) may be classified as parity doublet bands according to the predictions of the reflection asymmetric rotor model. Above a 700 keV gap, a coexistence of symmetric and asymmetric shapes including both static and dynamic octupole correlations is suggested.

  20. Breeding of an anti-postacidification strain from Lactobacillus bulgaricus by NTG mutagenesis%抗后酸化保加利亚乳杆菌的亚硝基胍诱变选育

    Institute of Scientific and Technical Information of China (English)

    车黎猛; 任发政; 张恒涛; 常征; 蔡华伟


    利用0.9mg/mL亚硝基胍对保加利亚乳杆菌ZLB进行诱变处理30min(菌株致死率为99%),中间培养后用青霉素筛选.处理液涂布培养后,选取生长缓慢或不长的32株接种于RSM(Reconstituted Skimmed Milk)培养基中,随后选取凝固的16株做12℃贮藏,最终得到产酸较慢的突变株ZT224、ZT227.突变株与ZLB相比,在42℃时,ZT224、ZT227在RSM培养基中滴定酸度值明显减少.发酵脱脂乳在12℃贮藏时,ZT224的发酵乳在贮藏的20d内一直没有发生后酸化;ZT227发生后酸化的时间推迟了4d.同时,突变株ZT224、ZT227对链霉素的敏感性不同于出发菌株ZLB且能稳定遗传.