WorldWideScience

Sample records for actinium 225

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.

    1977-01-01

    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  3. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  4. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    International Nuclear Information System (INIS)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

    2017-01-01

    The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  7. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  8. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the

  9. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    Marx, Sebastian Markus

    2014-01-01

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  10. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.

    1979-01-01

    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  11. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  12. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  13. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  14. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  15. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  16. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  17. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W

    1950-06-16

    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  18. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.

    1993-01-01

    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  19. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  20. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

    2016-01-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  1. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  2. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  3. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  4. 48 CFR 225.504 - Evaluation examples.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation examples. 225.504 Section 225.504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... 225.504 Evaluation examples. For examples that illustrate the evaluation procedures in 225.502(c)(ii...

  5. 48 CFR 225.7102 - Forgings.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forgings. 225.7102 Section 225.7102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Forgings. ...

  6. 48 CFR 225.7605 - Solicitation provision.

    Science.gov (United States)

    2010-10-01

    ... SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Secondary Arab Boycott of Israel... accordance with 225.7604, use the provision at 252.225-7031, Secondary Arab Boycott of Israel, in all...

  7. 49 CFR 192.225 - Welding procedures.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding procedures. 192.225 Section 192.225... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.225 Welding procedures. (a) Welding must be performed by a qualified welder in accordance with welding procedures...

  8. 49 CFR 397.225 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Judicial review. 397.225 Section 397.225... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.225 Judicial review. A party to a proceeding under § 397.205(a), § 397.213(a), or § 397.223(a) may seek review by the appropriate district...

  9. 7 CFR 3052.225 - Sanctions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Sanctions. 3052.225 Section 3052.225 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 3052.225 Sanctions. No...

  10. 7 CFR 225.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 225.3 Section 225.3 Agriculture... CHILD NUTRITION PROGRAMS SUMMER FOOD SERVICE PROGRAM General § 225.3 Administration. (a) Responsibility within the Department. FNS shall act on behalf of the Department in the administration of the Program. (b...

  11. 29 CFR 99.225 - Sanctions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Sanctions. 99.225 Section 99.225 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.225 Sanctions. No audit costs may be charged to Federal awards when audits required by this part have not been...

  12. 22 CFR 225.102 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 225.102 Section 225.102 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.102 Definitions. (a... includes communication or interpersonal contact between investigator and subject. “Private information...

  13. 25 CFR 225.24 - Environmental studies.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Environmental studies. 225.24 Section 225.24 Indians... SOLID MINERALS AGREEMENTS Minerals Agreements § 225.24 Environmental studies. (a) The Secretary shall ensure that all environmental studies are prepared as required by the National Environmental Policy Act...

  14. 10 CFR 600.225 - Program income.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Program income. 600.225 Section 600.225 Energy DEPARTMENT....225 Program income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees for services performed, from the use or rental of real or...

  15. 21 CFR 225.110 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records and Reports § 225.110 Distribution records. (a) Distribution records permit the manufacturer to relate complaints to specific batches and/or... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 225.110 Section 225.110 Food...

  16. 20 CFR 225.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 225.1 Section 225.1 Employees... DETERMINATIONS General § 225.1 Introduction. This part discusses Primary Insurance Amount, which is referred to... types of earnings. However, the formulas for computing any PIA are prescribed in section 215 of the...

  17. 48 CFR 225.7604 - Waivers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Waivers. 225.7604 Section 225.7604 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Secondary Arab Boycott of Israel 225.7604 Waivers. The...

  18. 48 CFR 225.7602 - Procedures.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Procedures. 225.7602 Section 225.7602 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Secondary Arab Boycott of Israel 225.7602...

  19. Octupole correlations in 225Th

    International Nuclear Information System (INIS)

    Hughes, J.R.

    1989-12-01

    The nuclear structure of 225 Th has been studied using the reaction 226 Ra(α, 5n) 225 Th at a beam energy of 50 MeV. In-beam γ-γ, e - -n, e - e - and e - γ coincidences have been measured, using the TESSA3 array at the Daresbury NSF and the Double Orange spectrometer at the University of Bonn Cyclotron. γ-ray and electron energies and intensities, γ-ray angular distribution ratios and electron subshell ratios and conversion coefficients have been used to establish a decay scheme up to spin (39/2) ℎ and excitation energy E x ≅ 2.5 MeV. The decay scheme is found to be characterised by two ΔJ = 1 rotational bands, and these are classified in terms of the simplex quantum number, s, which is expected to be conserved for an octupole nucleus. No band crossings are observed up to a rotational frequency of ℎw ≅ 0.21 and 0.18 MeV in the s = -i and +i bands, respectively. Parity doublets have been observed, with enhanced E1 transitions linking states of opposite parity. γ-branching ratios have been measured and an average value of | Q 1 | Q 2 | (0.51±0.06) x 10 -3 ; fm -1 has been deduced. The results are compared with various calculations incorporating odd multipole degrees of freedom in the description of the nuclear shape. (author)

  20. 48 CFR 225.104 - Nonavailable articles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Nonavailable articles. 225.104 Section 225.104 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Nonavailable articles. (a) DoD has determined that the following articles also are nonavailable in accordance...

  1. 48 CFR 225.503 - Group offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Group offers. 225.503... OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Evaluating Foreign Offers-Supply Contracts 225.503 Group offers. Evaluate group offers in accordance with FAR 25.503, but apply the evaluation...

  2. 31 CFR 800.225 - United States.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States. 800.225 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.225 United States. The term United States or U.S. means the United States of America, the States of the United States, the District of Columbia, and any commonwealth...

  3. 48 CFR 225.7003-3 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Exceptions. 225.7003-3 Section 225.7003-3 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... the recommendation of the Strategic Materials Protection Board pursuant to 10 U.S.C. 187, determines...

  4. 2 CFR 225.55 - Information contact.

    Science.gov (United States)

    2010-01-01

    ... information concerning this part may be obtained by contacting the Office of Federal Financial Management, Financial Standards and Reporting Branch, Office of Management and Budget, Washington, DC 20503, telephone... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Information contact. 225.55 Section 225.55...

  5. 7 CFR 225.17 - Procurement standards.

    Science.gov (United States)

    2010-01-01

    ...) Procurements by public sponsors comply with applicable State or local laws and the standards set forth in 7 CFR part 3016; and (2) Procurements by private nonprofit sponsors comply with standards set forth in 7 CFR... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement standards. 225.17 Section 225.17...

  6. 48 CFR 225.901 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 225.901 Section... DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Customs and Duties 225.901 Policy. Unless the supplies are entitled to duty-free treatment under a special category in the Harmonized Tariff Schedule of the...

  7. 24 CFR 968.225 - Budget revisions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Budget revisions. 968.225 Section... Fewer Than 250 Units) § 968.225 Budget revisions. (a) A PHA shall not incur any modernization cost in excess of the total HUD-approved CIAP budget. A PHA shall submit a budget revision, in a form prescribed...

  8. 40 CFR 86.225-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.225-94 Section 86.225-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  9. 42 CFR 93.225 - Respondent.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respondent. 93.225 Section 93.225 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

  10. 20 CFR 225.40 - General.

    Science.gov (United States)

    2010-04-01

    ... DETERMINATIONS Cost-of-Living Increases § 225.40 General. A cost-of-living increase is an automatic increase in a... determines the percentage amount of any cost-of-living increase paid by the Board. ...

  11. Production of Ra225 precursor for Ac225/Bi213 generators. Final CRADA Report

    International Nuclear Information System (INIS)

    Ehst, D.A.

    2009-01-01

    Russian subcontractors shipped two small deliveries of Ra225 to PNNL for evaluation. The activity was close to the requisite amount in the subcontract. The first labeled properly; the second did not. This showed that the Russians could supply Ra225 to the US; however they proved unable to meet future demands for larger amounts of activity. The US DOE attempts to get Ra225 from Russian should be terminated; the Russians, under Rosatom, are not interested in this business.

  12. Design and synthesis of 225Ac radioimmunopharmaceuticals

    International Nuclear Information System (INIS)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

    2002-01-01

    The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

  13. 7 CFR 225.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... forth in § 225.15, from a food service management company. Yogurt means commercially prepared coagulated milk products obtained by the fermentation of specific bacteria, that meet milk fat or milk solid... and Drug Administration's Standard of Identity for yogurt, lowfat yogurt, and nonfat yogurt, (21 CFR...

  14. 48 CFR 225.502 - Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Application. 225.502....502 Application. (b) Use the following procedures instead of the procedures in FAR 25.502(b) for... of Payments Program, then only qualifying country end products are exempt from application of the Buy...

  15. 48 CFR 225.7501 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Balance of Payments Program 225.7501 Policy. Acquire... significantly impair the quality at the point of consumption; (ii) An end product or construction material, by... comparative cost of application of the Balance of Payments Program to the total acquisition; or (v) Use of a...

  16. 27 CFR 24.225 - General.

    Science.gov (United States)

    2010-04-01

    ... TREASURY LIQUORS WINE Spirits § 24.225 General. The proprietor of a bonded wine premises may withdraw and... are authorized in this part. Wine spirits produced in the United States may be added to natural wine on bonded wine premises if both the wine and the spirits are produced from the same kind of fruit. In...

  17. 48 CFR 225.872-1 - General.

    Science.gov (United States)

    2010-10-01

    ... determined it inconsistent with the public interest to apply restrictions of the Buy American Act or the... from the following qualifying country may, on a purchase-by-purchase basis (see 225.872-4), be exempted from application of the Buy American Act and the Balance of Payments Program as inconsistent with the...

  18. 12 CFR 225.177 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... pursuant to this subpart, including through a private equity fund that the financial holding company... in the determination of major policies of the company and whose decisions are limited by policy... COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Merchant Banking Investments § 225.177...

  19. 48 CFR 225.872-6 - Audit.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Audit. 225.872-6 Section...-6 Audit. (a) Memoranda of understanding with some qualifying countries contain annexes that provide for reciprocal “no-cost” audits of contracts and subcontracts (pre- and post-award). (b) To determine...

  20. 48 CFR 225.7403-1 - General.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Defense Contractors Outside the United States 225.7403-1 General. Information and guidance pertaining to DoD antiterrorism/force protection policy for contracts that require performance or travel outside the United States can be obtained from...

  1. 48 CFR 225.7201 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Reporting Contract Performance Outside the United States 225.7201 Policy. (a) 10 U.S.C. 2410g requires offerors and contractors to notify DoD of any intention to perform a DoD contract outside the United States and Canada when the contract could be...

  2. 48 CFR 225.870-1 - General.

    Science.gov (United States)

    2010-10-01

    ... covenants. (b) For production planning purposes, Canada is part of the defense industrial base (see 225.870... work under projects other than the Defense Development Sharing Program; (2) Acquisitions of unusual or... made by DoD activities located in Canada. (d) For additional information on production rights, data...

  3. 44 CFR 206.225 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ... communications. Emergency communications necessary for the purpose of carrying out disaster relief functions may... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Eligibility § 206.225... economically eliminates the need for temporary housing. The work will be limited to that necessary for the...

  4. 21 CFR 225.20 - Buildings.

    Science.gov (United States)

    2010-04-01

    ... CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Construction and Maintenance of Facilities and Equipment § 225.20 Buildings. (a) The location, design, construction, and physical size of the buildings and other production facilities are factors important to the manufacture of medicated feed. The features of...

  5. 21 CFR 225.58 - Laboratory controls.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Product Quality Control § 225.58... than 1 year after distribution of the medicated feed. The results of assays performed by State feed... premises. (e) Corrective action shall include provisions for discontinuing distribution where the medicated...

  6. 29 CFR 779.225 - Leased departments.

    Science.gov (United States)

    2010-07-01

    ..., Franchise and Other Business Arrangements § 779.225 Leased departments. (a) As stated in section 3(r) of the... without) a separate entrance, and operates under a separate name, with his own separate employees and... “leased department” and will not be included in the same enterprise with the lessor. (e) The employees of...

  7. 22 CFR 225.107 - IRB membership.

    Science.gov (United States)

    2010-04-01

    ... Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.107 IRB membership. (a..., to promote respect for its advice and counsel in safeguarding the rights and welfare of human... individuals who are knowledgeable about and experienced in working with these subjects. (b) Every...

  8. 48 CFR 225.7301 - General.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false General. 225.7301 Section... General. (a) The U.S. Government sells defense articles and services to foreign governments or... under the same acquisition and contract management procedures used for other defense acquisitions. (c...

  9. 24 CFR 884.225 - PHA reporting requirements. [Reserved

    Science.gov (United States)

    2010-04-01

    ... reporting requirements. [Reserved] ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false PHA reporting requirements. [Reserved] 884.225 Section 884.225 Housing and Urban Development Regulations Relating to Housing and Urban...

  10. Measurements of multipolarities in 225Ra

    International Nuclear Information System (INIS)

    Andersen, E.; Nyboe, K.; Thorsteinsen, T.F.; Gietz, H.; Kaffrell, N.; Mattsson, S.; Nyman, G.

    1989-01-01

    Multipolarities of 45 transitions in 225 Ra have been established by investigating the radiations associated with the β - decay of 225 Fr. The study includes β - , e - and γ-singles spectra, e - γ- and γγ-coincidence measurements. The conversion electrons were measured with a mini-orange electron spectrometer, and the γ-spectra with Ge detectors. The multipolarities obtained from the measured conversion coefficients support the assignments of spin-parity doublets thus giving evidence for a stable octupole deformation of this nucleus. The negative parity of the 394.2 keV level established in the present work indicates that this level is a candidate for the parity-doublet partner of the 5/2 + state at 236.3 keV. (orig.)

  11. 25 CFR 225.26 - Auditing and accounting.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Auditing and accounting. 225.26 Section 225.26 Indians... SOLID MINERALS AGREEMENTS Minerals Agreements § 225.26 Auditing and accounting. The Secretary may... agreement. Procedures and standards used for accounting and auditing of minerals agreements will be in...

  12. 14 CFR 13.225 - Offer of proof.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Offer of proof. 13.225 Section 13.225... INVESTIGATIVE AND ENFORCEMENT PROCEDURES Rules of Practice in FAA Civil Penalty Actions § 13.225 Offer of proof. A party whose evidence has been excluded by a ruling of the administrative law judge may offer the...

  13. 10 CFR 603.225 - Benefits of using a TIA.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Benefits of using a TIA. 603.225 Section 603.225 Energy... Technology Investment Agreements § 603.225 Benefits of using a TIA. Before deciding that a TIA is appropriate, the contracting officer also must judge that using a TIA could benefit the RD&D objectives in ways...

  14. 25 CFR 225.33 - Assignment of minerals agreements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Assignment of minerals agreements. 225.33 Section 225.33 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS OIL AND GAS, GEOTHERMAL, AND SOLID MINERALS AGREEMENTS Minerals Agreements § 225.33 Assignment of minerals agreements. An...

  15. 46 CFR 174.225 - Hull penetrations and shell connections.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Hull penetrations and shell connections. 174.225 Section 174.225 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY... § 174.225 Hull penetrations and shell connections. Each overboard discharge and shell connection except...

  16. 7 CFR 225.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 225.1 Section 225.1... AGRICULTURE CHILD NUTRITION PROGRAMS SUMMER FOOD SERVICE PROGRAM General § 225.1 General purpose and scope... primary purpose of the Program is to provide food service to children from needy areas during periods when...

  17. 33 CFR 117.225 - Yellow Mill Channel.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Yellow Mill Channel. 117.225 Section 117.225 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.225 Yellow Mill Channel. The...

  18. 12 CFR 225.123 - Activities closely related to banking.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June 15...

  19. Alpha decay 225Ac→221Fr

    International Nuclear Information System (INIS)

    Kudrya, S.A.; Sergienko, V.A.; Gorozhankin, V.M.; Gromov, K.Ya.; Malikov, Sh.R.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Yakushev, E.A.

    2002-01-01

    In-depth investigation of (α-γ)-coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ-rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the (α-γ)-coincidences makes it possible to find the intensity of population of 221 Fr levels by the α decay and multipolarities of five weak γ-transitions. The conversion electron spectrum is investigated in the range of 5-24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the assumption of static octupole deformation

  20. Alpha decay 225 Ac → 221Fr

    International Nuclear Information System (INIS)

    Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

    2004-01-01

    Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

  1. Dicty_cDB: CFI225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI225 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFI225F 133 - - - - - - Show CFI225 Library CF (Link to library) Clone ID CFI225 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  2. 48 CFR 225.7703-3 - Evaluating offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluating offers. 225... Iraq or Afghanistan 225.7703-3 Evaluating offers. (a) Evaluate offers submitted in response to... Afghanistan, as follows: (1) If the low offer is an offer of a product or service from Iraq or Afghanistan...

  3. 21 CFR 225.120 - Buildings and grounds.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Buildings and grounds. 225.120 Section 225.120... Buildings and grounds. Buildings used for production of medicated feed shall provide adequate space for... routine maintenance and cleaning of equipment. Buildings and grounds shall be constructed and maintained...

  4. 7 CFR 225.9 - Program assistance to sponsors.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SUMMER FOOD SERVICE PROGRAM State Agency Provisions § 225.9 Program... of any previous payment which is under dispute or which is part of a demand for recovery under § 225...

  5. 21 CFR 225.1 - Current good manufacturing practice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Current good manufacturing practice. 225.1 Section...) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS General Provisions § 225.1 Current good manufacturing practice. (a) Section 501(a)(2)(B) of the Federal Food, Drug, and Cosmetic Act...

  6. 48 CFR 225.870-8 - Industrial security.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Industrial security. 225... Coordination 225.870-8 Industrial security. Industrial security for Canada shall be in accordance with the U.S.-Canada Industrial Security Agreement of March 31, 1952, as amended. ...

  7. 48 CFR 252.225-7041 - Correspondence in English.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Correspondence in English... of Provisions And Clauses 252.225-7041 Correspondence in English. As prescribed in 225.1103(2), use the following clause: Correspondence in English (JUN 1997) The Contractor shall ensure that all...

  8. 49 CFR 225.11 - Reporting of accidents/incidents.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Reporting of accidents/incidents. 225.11 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD ACCIDENTS/INCIDENTS: REPORTS CLASSIFICATION, AND INVESTIGATIONS § 225.11 Reporting of accidents/incidents. Each railroad subject to this part shall submit to FRA...

  9. 7 CFR 1280.225 - Books and records of persons.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records of persons. 1280.225 Section 1280... PROMOTION, RESEARCH, AND INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.225 Books and records of persons. (a) Each first handler, exporter of lambs, and...

  10. 7 CFR 225.14 - Requirements for sponsor participation.

    Science.gov (United States)

    2010-01-01

    ... 225.14 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SUMMER FOOD SERVICE PROGRAM Sponsor and Site Provisions... Youth Sports Program; and (5) Private nonprofit organizations as defined in § 225.2. (c) General...

  11. 48 CFR 225.7403-2 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... performance or travel outside the United States, except for contracts with— (a) Foreign governments; (b..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Defense Contractors Outside the United States 225.7403-2 Contract clause. Use the clause at 252.225-7043, Antiterrorism/Force Protection Policy...

  12. 20 CFR 627.225 - Employment generating activities.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Employment generating activities. 627.225 Section 627.225 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR GENERAL... chambers of commerce); JTPA staff participation on economic development boards and commissions, and work...

  13. 5 CFR 591.225 - Which CPIs does OPM use?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Which CPIs does OPM use? 591.225 Section 591.225 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...

  14. 25 CFR 225.22 - Approval of minerals agreements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Approval of minerals agreements. 225.22 Section 225.22 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS OIL AND GAS, GEOTHERMAL... financial return to the Indian parties thereto; the extent, nature, value or disposition of the mineral...

  15. 29 CFR 778.225 - Talent fees excludable under regulations.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Talent fees excludable under regulations. 778.225 Section... Payments That May Be Excluded From the âRegular Rateâ Talent Fees in the Radio and Television Industry § 778.225 Talent fees excludable under regulations. Section 7(e)(3) provides for the exclusion from the...

  16. 21 CFR 225.202 - Formula, production, and distribution records.

    Science.gov (United States)

    2010-04-01

    ... SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records § 225.202 Formula, production, and distribution records. Records shall be maintained identifying the... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Formula, production, and distribution records. 225...

  17. 48 CFR 252.225-7020 - Trade Agreements Certificate.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Trade Agreements... of Provisions And Clauses 252.225-7020 Trade Agreements Certificate. As prescribed in 225.1101(5), use the following provision: Trade Agreements Certificate (JAN 2005) (a) Definitions. Designated...

  18. 12 CFR 225.124 - Foreign bank holding companies.

    Science.gov (United States)

    2010-01-01

    ... SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies Interpretations § 225.124 Foreign bank holding companies. (a) Effective December 1, 1971, the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Foreign bank holding companies. 225.124 Section...

  19. 18 CFR 284.225-284.226 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.225-284.226 Section 284.225-284.226 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... RELATED AUTHORITIES Blanket Certificates Authorizing Certain Transportation by Interstate Pipelines on...

  20. 48 CFR 225.7003-4 - One-time waiver.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false One-time waiver. 225.7003... Other Statutory Restrictions on Foreign Acquisition 225.7003-4 One-time waiver. DoD may accept articles containing specialty metals that are not in compliance with the specialty metals clause of the contract if...

  1. Ice nucleation rates near ˜225 K

    Science.gov (United States)

    Amaya, Andrew J.; Wyslouzil, Barbara E.

    2018-02-01

    We have measured the ice nucleation rates, Jice, in supercooled nano-droplets with radii ranging from 6.6 nm to 10 nm and droplet temperatures, Td, ranging from 225 K to 204 K. The initial temperature of the 10 nm water droplets is ˜250 K, i.e., well above the homogeneous nucleation temperature for micron sized water droplets, TH ˜235 K. The nucleation rates increase systematically from ˜1021 cm-3 s-1 to ˜1022 cm-3 s-1 in this temperature range, overlap with the nucleation rates of Manka et al. [Phys. Chem. Chem. Phys. 14, 4505 (2012)], and suggest that experiments with larger droplets would extrapolate smoothly the rates of Hagen et al. [J. Atmos. Sci. 38, 1236 (1981)]. The sharp corner in the rate data as temperature drops is, however, difficult to match with available theory even if we correct classical nucleation theory and the physical properties of water for the high internal pressure of the nanodroplets.

  2. 25 CFR 1000.225 - Are meetings or discussions mandatory?

    Science.gov (United States)

    2010-04-01

    ... FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.225 Are meetings or discussions mandatory? No, a meeting with the...

  3. 12 CFR 225.131 - Activities closely related to banking.

    Science.gov (United States)

    2010-01-01

    ...; operation and management of a trust department; international banking; foreign exchange transactions... specialized lending provisions; marketing operations, including research, market development and advertising... Holding Companies Interpretations § 225.131 Activities closely related to banking. (a) Bank management...

  4. 48 CFR 252.225-7025 - Restriction on acquisition of forgings.

    Science.gov (United States)

    2010-10-01

    ... of forgings. 252.225-7025 Section 252.225-7025 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.225-7025 Restriction on acquisition of forgings. As prescribed in 225.7102-4, use the following clause: Restriction on Acquisition of Forgings (DEC 2009) (a...

  5. 48 CFR 252.225-7031 - Secondary Arab boycott of Israel.

    Science.gov (United States)

    2010-10-01

    ... Israel. 252.225-7031 Section 252.225-7031 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.225-7031 Secondary Arab boycott of Israel. As prescribed in 225.7605, use the following provision: Secondary Arab Boycott of Israel (JUN 2005) (a) Definitions. As used in...

  6. 48 CFR 225.802-70 - Contracts for performance outside the United States and Canada.

    Science.gov (United States)

    2010-10-01

    ... outside the United States and Canada. 225.802-70 Section 225.802-70 Federal Acquisition Regulations System... States and Canada. Follow the procedures at PGI 225.802-70 when placing a contract requiring performance outside the United States and Canada. Also see Subpart 225.74, Defense Contractors Outside the United...

  7. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  8. Decay schemes of the radioactive nuclei A = 225 to 229. Skhemy raspada radioaktivnykh yader A = 225 - 229

    Energy Technology Data Exchange (ETDEWEB)

    Dzhelepov, B S; Ivanov, R B; Mikhailova, M A

    1976-01-01

    This monograph is devoted to properties of atomic nuclei with mass numbers A = 225 to 229. The book collects and systematizes all of the experimental data characterizing properties of radioactive isotopes: information concerning masses of nuclei, magnetic and electric moments, lifetimes of nuclear states, the most reliable information on characteristics of radiations, quantum characteristics of levels and other properties of the studied nuclei. On basis of a critical analysis of the totality of information, decay schemes of radioactive nuclei with mass numbers A = 225 to 229 were constructed, as well as the series of excited states of the isotopes which lie in this region of nuclei.

  9. 27 CFR 28.225 - Removals of beer by brewer.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removals of beer by brewer..., DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Beer With Benefit of Drawback Execution of Claims § 28.225 Removals of beer by brewer. Where a brewer removes taxpaid beer from the...

  10. 47 CFR 76.225 - Commercial limits in children's programs.

    Science.gov (United States)

    2010-10-01

    ... purposes, including either e-commerce or advertising; (3) The Web site's home page and other menu pages are... site to which viewers are directed by the Web site address is not used for e-commerce, advertising, or... primarily for an audience of children 12 years old and younger. Note 3 to § 76.225: Section 76.1703 contains...

  11. Improved experimental limit on the EDM of 225Ra

    Science.gov (United States)

    Bishof, Michael; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Tom P.; Parker, Richard H.; Rabga, Tenzin; Singh, Jaideep T.

    2015-10-01

    Searches for permanent electric dipole moments (EDMs) in fundamental and composite particles are sensitive probes of beyond-standard-model symmetry violation that could explain the dominance of matter over anti-matter. The 225Ra (t1/2 = 15d, I = 1/2) atom is a particularly attractive system to use for an EDM measurement because its large nuclear octupole deformation, closely spaced ground-state parity doublet, and large atomic mass make 225Ra uniquely sensitive to symmetry-violating interactions in the nuclear medium. We have developed an experiment to measure the EDM of 225Ra and demonstrated the first ``proof-of-principle'' measurement, giving a 95% confidence upper limit of 5E-22 e-cm. After implementing a vacuum upgrade, we have observed nuclear spin coherence after 20 s of free evolution - a factor of ten improvement over our earlier results - and have lowered the 225Ra EDM limit by over an order of magnitude. Upcoming experimental upgrades have the potential to further improve our EDM sensitivity by many orders of magnitude, allowing us to test symmetry violation at an unprecedented level. This work is supported by U.S. DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  12. 6 CFR 27.225 - Site security plans.

    Science.gov (United States)

    2010-01-01

    ... Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.225 Site security plans. (a) The Site Security Plan must... chemical facility security. (b) Except as provided in § 27.235, a covered facility must complete the Site...

  13. 40 CFR 1033.225 - Amending applications for certification

    Science.gov (United States)

    2010-07-01

    ...) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM LOCOMOTIVES Certifying Engine Families § 1033.225... produce 12-cylinder versions of the 16-cylinder locomotives you described in your application. (2) Change... the new FEL on the emission control information label for all locomotives produced after the change...

  14. 12 CFR 225.132 - Acquisition of assets.

    Science.gov (United States)

    2010-01-01

    ... it constitutes the acquisition, in whole or in part, of a going concern. 2 1 Section 225.4(c)(3) of... Regulation Y, the acquisition of a going concern requires prior Board approval. (c) The following examples... going concern. [39 FR 35128, Sept. 30, 1974, as amended at Reg. Y, 57 FR 28779, June 29, 1992] ...

  15. 40 CFR 1065.225 - Intake-air flow meter.

    Science.gov (United States)

    2010-07-01

    ... as described in § 1065.650, as follows: (1) Use the actual value of calculated raw exhaust in the..., you may use an intake-air flow meter signal that does not give the actual value of raw exhaust, as... CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Flow-Related Measurements § 1065.225 Intake-air...

  16. 12 CFR 225.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ...) of the Federal Deposit Insurance Act (12 U.S.C. 1818(b)); section 914 of the Financial Institutions..., title 12, chapter II, part 225. (b) Purpose. The principal purposes of this part are to: (1) Regulate the acquisition of control of banks by companies and individuals; (2) Define and regulate the...

  17. 48 CFR 225.7303-4 - Contingent fees.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contingent fees. 225.7303....7303-4 Contingent fees. (a) Except as provided in paragraph (b) of this subsection, contingent fees are generally allowable under DoD contracts, provided— (1) The fees are paid to a bona fide employee or a bona...

  18. 21 CFR 225.65 - Equipment cleanout procedures.

    Science.gov (United States)

    2010-04-01

    ...) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Product Quality Control § 225.65... and distribution of medicated feeds are essential to maintain proper drug potency and avoid unsafe..., mixing, conveying, and distribution that comes in contact with the active drug component, feeds in...

  19. 48 CFR 225.7304 - FMS customer involvement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false FMS customer involvement... Military Sales 225.7304 FMS customer involvement. (a) FMS customers may request that a defense article or... contract without full and open competition. The FMS customer may also request that a subcontract be placed...

  20. 7 CFR 225.4 - Program management and administration plan.

    Science.gov (United States)

    2010-01-01

    ... year. (b) Each plan shall be acted on or approved by March 15 or, if it is submitted late, within 30... funding which it is assured of receiving under § 225.5(a)(3). (c) Approval of the Plan by FNS shall be a... subject to auditing requirements prescribed by the Secretary; (7) The State's plan for ensuring compliance...

  1. 48 CFR 52.225-6 - Trade Agreements Certificate.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Trade Agreements....225-6 Trade Agreements Certificate. As prescribed in 25.1101(c)(2), insert the following provision: Trade Agreements Certificate (JAN 2005) (a) The offeror certifies that each end product, except those...

  2. 12 CFR 225.129 - Activities closely related to banking.

    Science.gov (United States)

    2010-01-01

    ... competitive advantage over firms competing with other holding company affiliates. To reduce the possibility... Board's amendment of § 225.4(a), which adds courier services to the list of closely related activities... generally in the provision of transportation services. During the course of the Board's proceedings...

  3. 48 CFR 52.225-18 - Place of Manufacture.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Place of Manufacture. 52....225-18 Place of Manufacture. As prescribed in 25.1101(f), insert the following solicitation provision: Place of Manufacture (SEP 2006) (a) Definitions. As used in this clause— Manufactured end product means...

  4. 48 CFR 225.7009 - Restriction on ball and roller bearings.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Restriction on ball and roller bearings. 225.7009 Section 225.7009 Federal Acquisition Regulations System DEFENSE ACQUISITION... roller bearings. ...

  5. 48 CFR 225.7005 - Restriction on certain chemical weapons antidote.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Restriction on certain chemical weapons antidote. 225.7005 Section 225.7005 Federal Acquisition Regulations System DEFENSE... on certain chemical weapons antidote. ...

  6. 48 CFR 252.225-7016 - Restriction on acquisition of ball and roller bearings.

    Science.gov (United States)

    2010-10-01

    ... of ball and roller bearings. 252.225-7016 Section 252.225-7016 Federal Acquisition Regulations System... and roller bearings. As prescribed in 225.7009-5, use the following clause: Restriction on Acquisition of Ball and Roller Bearings (MAR 2006) (a) Definitions. As used in this clause' (1) Bearing...

  7. 27 CFR 25.225 - Destruction of taxpaid beer which was never removed from brewery premises.

    Science.gov (United States)

    2010-04-01

    ... beer which was never removed from brewery premises. 25.225 Section 25.225 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Voluntary Destruction § 25.225 Destruction of taxpaid beer which was never removed from brewery premises. (a) General. A...

  8. 48 CFR 52.225-14 - Inconsistency between English Version and Translation of Contract.

    Science.gov (United States)

    2010-10-01

    ... English Version and Translation of Contract. 52.225-14 Section 52.225-14 Federal Acquisition Regulations... CLAUSES Text of Provisions and Clauses 52.225-14 Inconsistency between English Version and Translation of... and Translation of Contract (FEB 2000) In the event of inconsistency between any terms of this...

  9. 25 CFR 225.28 - Approval of amendments to minerals agreements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Approval of amendments to minerals agreements. 225.28 Section 225.28 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS OIL AND GAS, GEOTHERMAL, AND SOLID MINERALS AGREEMENTS Minerals Agreements § 225.28 Approval of amendments to...

  10. 25 CFR 225.40 - Government employees cannot acquire minerals agreements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Government employees cannot acquire minerals agreements. 225.40 Section 225.40 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS OIL AND GAS, GEOTHERMAL, AND SOLID MINERALS AGREEMENTS Minerals Agreements § 225.40 Government...

  11. Nuclear Structure Effects in the Exotic Decay of $^{225}$Ac via $^{14}$C Emission

    CERN Multimedia

    2002-01-01

    % IS323 \\\\ \\\\ We propose to build at Isolde a high intensity $^{225}$Ac source by $\\beta$-decay of $^{225}$(Ra+Fr) beam, to be used at the superconducting spectrometer SOLENO of IPN-Orsay in order to study a possible fine structure in the spectrum of $^{14}$C ions spontaneously emitted by $^{225}$Ac.

  12. 18 CFR 2.25 - Ratemaking treatment of the cost of emissions allowances in coordination transactions.

    Science.gov (United States)

    2010-04-01

    ... the cost of emissions allowances in coordination transactions. 2.25 Section 2.25 Conservation of Power... § 2.25 Ratemaking treatment of the cost of emissions allowances in coordination transactions. (a... Commission provides for recovery of variable costs on an incremental basis, the Commission will allow...

  13. 48 CFR 225.7303-1 - Contractor sales to other foreign customers.

    Science.gov (United States)

    2010-10-01

    ... foreign customers. 225.7303-1 Section 225.7303-1 Federal Acquisition Regulations System DEFENSE... for Foreign Military Sales 225.7303-1 Contractor sales to other foreign customers. If the contractor has made sales of the item required for the foreign military sale to foreign customers under...

  14. 47 CFR 25.225 - Geographic Service Requirements for 17/24 GHz Broadcasting Satellite Service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Geographic Service Requirements for 17/24 GHz Broadcasting Satellite Service. 25.225 Section 25.225 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.225 Geographic Service...

  15. 48 CFR 225.403 - World Trade Organization Government Procurement Agreement and Free Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... Government Procurement Agreement and Free Trade Agreements. 225.403 Section 225.403 Federal Acquisition... FOREIGN ACQUISITION Trade Agreements 225.403 World Trade Organization Government Procurement Agreement and... Government Procurement Agreement, acquire only U.S.-made, qualifying country, or designated country end...

  16. 48 CFR 252.225-7026 - Acquisition Restricted to Products or Services from Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... Products or Services from Iraq or Afghanistan. 252.225-7026 Section 252.225-7026 Federal Acquisition... to Products or Services from Iraq or Afghanistan. As prescribed in 225.7703-5(c), use the following clause: Acquisition Restricted to Products or Services From Iraq or Afghanistan (APR 2010) (a...

  17. 48 CFR 252.225-7024 - Requirement for products or services from Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... or services from Iraq or Afghanistan. 252.225-7024 Section 252.225-7024 Federal Acquisition... products or services from Iraq or Afghanistan. As prescribed in 225.7703-5(b), use the following clause: Requirement for Products or Services From Iraq or Afghanistan (SEP 2008) (a) Definitions. As used in this...

  18. 48 CFR 252.225-7023 - Preference for products or services from Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... services from Iraq or Afghanistan. 252.225-7023 Section 252.225-7023 Federal Acquisition Regulations System... from Iraq or Afghanistan. As prescribed in 225.7703-5(a), use the following provision: Requirement for Products or Services from Iraq or Afghanistan (APR 2010) (a) Definitions. Product from Iraq or Afghanistan...

  19. 78 FR 55773 - Fourteenth Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems...

    Science.gov (United States)

    2013-09-11

    ... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size AGENCY: Federal... Special Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. SUMMARY... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size DATES: The meeting...

  20. 78 FR 16031 - Twelfth Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems...

    Science.gov (United States)

    2013-03-13

    ... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size AGENCY: Federal... Special Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. SUMMARY... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. DATES: The meeting...

  1. 77 FR 39321 - Eighth Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems...

    Science.gov (United States)

    2012-07-02

    ... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Sizes AGENCY: Federal... Special Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Sizes. SUMMARY... 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Sizes. DATES: The meeting will...

  2. 78 FR 6845 - Eleventh Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems...

    Science.gov (United States)

    2013-01-31

    ... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size AGENCY: Federal... Special Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. SUMMARY... Committee 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. DATES: The meeting...

  3. 48 CFR 225.7016 - Restriction on Ballistic Missile Defense research, development, test, and evaluation.

    Science.gov (United States)

    2010-10-01

    ... Missile Defense research, development, test, and evaluation. 225.7016 Section 225.7016 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS... Acquisition 225.7016 Restriction on Ballistic Missile Defense research, development, test, and evaluation. [68...

  4. 28 CFR 54.225 - Educational institutions eligible to submit transition plans.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Educational institutions eligible to submit transition plans. 54.225 Section 54.225 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED... Coverage § 54.225 Educational institutions eligible to submit transition plans. (a) Application. This...

  5. 12 CFR 225.174 - What aggregate thresholds apply to merchant banking investments?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What aggregate thresholds apply to merchant banking investments? 225.174 Section 225.174 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF...) Regulations Merchant Banking Investments § 225.174 What aggregate thresholds apply to merchant banking...

  6. 12 CFR 225.126 - Activities not closely related to banking.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities not closely related to banking. 225.126 Section 225.126 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE... Financial Holding Companies Interpretations § 225.126 Activities not closely related to banking. Pursuant to...

  7. 20 CFR 725.225 - Determination of dependency; parent, brother, or sister.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; parent, brother, or sister. 725.225 Section 725.225 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.225 Determination of dependency; parent, brother, or sister. An individual who is the miner...

  8. 48 CFR 252.225-7044 - Balance of Payments Program-Construction Material.

    Science.gov (United States)

    2010-10-01

    ... Program-Construction Material. 252.225-7044 Section 252.225-7044 Federal Acquisition Regulations System...—Construction Material. As prescribed in 225.7503(a), use the following clause: Balance of Payments Program—Construction Material (JAN 2009) (a) Definitions. As used in this clause— Commercially available off-the-shelf...

  9. 48 CFR 52.225-10 - Notice of Buy American Act Requirement-Construction Materials.

    Science.gov (United States)

    2010-10-01

    ... Requirement-Construction Materials. 52.225-10 Section 52.225-10 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.225-10 Notice of Buy American Act Requirement—Construction Materials. As prescribed... Materials (FEB 2009) (a) Definitions. “Commercially available off-the-shelf (COTS) item,” “construction...

  10. First Measurement of the Atomic Electric Dipole Moment of (225)Ra.

    Science.gov (United States)

    Parker, R H; Dietrich, M R; Kalita, M R; Lemke, N D; Bailey, K G; Bishof, M; Greene, J P; Holt, R J; Korsch, W; Lu, Z-T; Mueller, P; O'Connor, T P; Singh, J T

    2015-06-12

    The radioactive radium-225 ((225)Ra) atom is a favorable case to search for a permanent electric dipole moment. Because of its strong nuclear octupole deformation and large atomic mass, (225)Ra is particularly sensitive to interactions in the nuclear medium that violate both time-reversal symmetry and parity. We have developed a cold-atom technique to study the spin precession of (225)Ra atoms held in an optical dipole trap, and demonstrated the principle of this method by completing the first measurement of its atomic electric dipole moment, reaching an upper limit of |d((225)Ra)|<5.0×10(-22)  e cm (95% confidence).

  11. Effect of niobium on the embrittlement of 2.25 Cr and 2.25 Cr-1Mo steels by phosphous

    International Nuclear Information System (INIS)

    Antunes, J.L.B.

    1985-01-01

    The influence of niobium on the temper embrittlement of 2.25Cr and 2.25 Cr-1Mo steels doped with phosphorus is evaluated. The transition temperatures of the samples tempered at 650 0 C and aged at different temperatures for niobium steels. (M.J.C.) [pt

  12. 49 CFR 225.17 - Doubtful cases; alcohol or drug involvement.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Doubtful cases; alcohol or drug involvement. 225..., AND INVESTIGATIONS § 225.17 Doubtful cases; alcohol or drug involvement. (a) The reporting officer of... the possible involvement of alcohol or drug use or impairment in such accident or incident. If the...

  13. 7 CFR Appendix A to Part 225 - Alternate Foods for Meals

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SUMMER FOOD SERVICE PROGRAM Pt. 225, App. A Appendix A to Part 225... produced from plant or animal sources. b. The biological quality of the protein in the alternate protein...

  14. 48 CFR 252.225-7045 - Balance of Payments Program-Construction Material Under Trade Agreements.

    Science.gov (United States)

    2010-10-01

    .... Designated country means— (1) A World Trade Organization Government Procurement Agreement (WTO GPA) country... another country, has been substantially transformed in a Free Trade Agreement country into a new and... Program-Construction Material Under Trade Agreements. 252.225-7045 Section 252.225-7045 Federal...

  15. 49 CFR 372.225 - Lexington-Fayette Urban County, KY.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Lexington-Fayette Urban County, KY. 372.225 Section 372.225 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS...

  16. 12 CFR 225.81 - What is a financial holding company?

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies § 225.81 What is a financial holding company? (a) Definition. A financial holding... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What is a financial holding company? 225.81...

  17. 24 CFR 200.225 - Approvals by Area Managers for limited partners.

    Science.gov (United States)

    2010-04-01

    ... previous projects covered by these regulations has been as a limited partner. All other certificates must... limited partners. 200.225 Section 200.225 Housing and Urban Development Regulations Relating to Housing... by Area Managers for limited partners. The Area Manager of the HUD Area Office where the certificate...

  18. 48 CFR 225.7015 - Restriction on overseas architect-engineer services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Restriction on overseas architect-engineer services. 225.7015 Section 225.7015 Federal Acquisition Regulations System DEFENSE... on overseas architect-engineer services. For restriction on award of architect-engineer contracts to...

  19. 49 CFR 225.15 - Accidents/incidents not to be reported.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Accidents/incidents not to be reported. 225.15... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD ACCIDENTS/INCIDENTS: REPORTS CLASSIFICATION, AND INVESTIGATIONS § 225.15 Accidents/incidents not to be reported. A railroad need not report: (a) Casualties which...

  20. 49 CFR 225.19 - Primary groups of accidents/incidents.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Primary groups of accidents/incidents. 225.19... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD ACCIDENTS/INCIDENTS: REPORTS CLASSIFICATION, AND INVESTIGATIONS § 225.19 Primary groups of accidents/incidents. (a) For reporting purposes reportable railroad...

  1. 76 FR 6180 - First Meeting: RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery Systems...

    Science.gov (United States)

    2011-02-03

    ... 225: Rechargeable Lithium Batteries and Battery Systems--Small and Medium Sizes AGENCY: Federal... Lithium Batteries and Battery Systems--Small and Medium Sizes. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery...

  2. 76 FR 22161 - Second Meeting: RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery Systems...

    Science.gov (United States)

    2011-04-20

    ... Committee 225: Rechargeable Lithium Batteries and Battery Systems--Small and Medium Sizes AGENCY: Federal... Lithium Batteries and Battery Systems--Small and Medium Sizes. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery...

  3. 76 FR 38741 - Third Meeting: RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery Systems...

    Science.gov (United States)

    2011-07-01

    ... 225: Rechargeable Lithium Batteries and Battery Systems--Small and Medium Sizes AGENCY: Federal... Lithium Batteries and Battery Systems--Small and Medium Sizes. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery...

  4. 77 FR 8325 - Sixth Meeting: RTCA Special Committee 225, Rechargeable Lithium Batteries and Battery Systems...

    Science.gov (United States)

    2012-02-14

    ... 225, Rechargeable Lithium Batteries and Battery Systems, Small and Medium Size AGENCY: Federal... Committee 225, Rechargeable Lithium Batteries and Battery Systems, Small and Medium Size. SUMMARY: The FAA..., Rechargeable Lithium Batteries and Battery Systems, Small and Medium Size. DATES: The meeting will be held...

  5. 76 FR 54527 - Fourth Meeting: RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery Systems...

    Science.gov (United States)

    2011-09-01

    ... Committee 225: Rechargeable Lithium Batteries and Battery Systems--Small and Medium Sizes AGENCY: Federal... Lithium Batteries and Battery Systems--Small and Medium Sizes. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 225: Rechargeable Lithium Batteries and Battery...

  6. 77 FR 20688 - Seventh Meeting: RTCA Special Committee 225, Rechargeable Lithium Batteries and Battery Systems...

    Science.gov (United States)

    2012-04-05

    ... Committee 225, Rechargeable Lithium Batteries and Battery Systems, Small and Medium Size AGENCY: Federal... Committee 225, Rechargeable Lithium Batteries and Battery Systems, Small and Medium Size. SUMMARY: The FAA..., Rechargeable Lithium Batteries and Battery Systems, Small and Medium Size. DATES: The meeting will be held May...

  7. CCR 20th anniversary commentary: a chimeric antibody, C225, inhibits EGFR activation and tumor growth.

    Science.gov (United States)

    Mendelsohn, John; Prewett, Marie; Rockwell, Patricia; Goldstein, Neil I

    2015-01-15

    Murine mAb 225 was effective against the EGFR tyrosine kinase and inhibited tumor growth in preclinical studies. A phase I trial showed safety, tumor localization, and satisfactory pharmacokinetics. Human:murine chimeric C225 retained biologic activity, which was essential for the conduct of subsequent combination therapy trials and eventual regulatory approval. ©2015 American Association for Cancer Research.

  8. 48 CFR 652.225-70 - Arab League Boycott of Israel.

    Science.gov (United States)

    2010-10-01

    ... Israel. 652.225-70 Section 652.225-70 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES... League Boycott of Israel. As prescribed in 625.7002(a), insert the following provision: Arab League Boycott of Israel (AUG 1999) (a) Definitions. As used in this provision: Foreign person means any person...

  9. 25 CFR 225.6 - Authority and responsibility of the Minerals Management Service (MMS).

    Science.gov (United States)

    2010-04-01

    ... Service (MMS). 225.6 Section 225.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND... responsibility of the Minerals Management Service (MMS). The functions of the MMS for reporting, accounting, and... satisfactorily addressing the issues or functions governed by the MMS regulations relating to valuation of...

  10. 48 CFR 252.225-7022 - Trade agreements certificate-inclusion of Iraqi end products.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Trade agreements... PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.225-7022 Trade agreements certificate—inclusion of Iraqi end products. As prescribed in 225.1101(7), use the following provision: Trade Agreements...

  11. 48 CFR 1852.225-8 - Duty-free entry of space articles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Duty-free entry of space articles. 1852.225-8 Section 1852.225-8 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions...

  12. 48 CFR 225.7003-5 - Solicitation provision and contract clauses.

    Science.gov (United States)

    2010-10-01

    ..., Restriction on Acquisition of Certain Articles Containing Specialty Metals, in solicitations and contracts... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitation provision and contract clauses. 225.7003-5 Section 225.7003-5 Federal Acquisition Regulations System DEFENSE ACQUISITION...

  13. The National Football League-225 Bench Press Test and the Size-Weight Illusion.

    Science.gov (United States)

    Luebbers, Paul E; Buckingham, Gavin; Butler, Michael S

    2017-06-01

    The purpose of this study was to test reports that size and arrangement manipulations of weight plates (i.e., inducing a size-weight illusion [SWI]) effect athletic weightlifting performance. The participants were 72 experienced, weight-trained collegiate American football players. Across three weeks, each athlete performed three different repetitions-to-fatigue bench press tests (NFL-225, SWI-225, and SWI-215). A multiple regression revealed a positive association between participants' strength relative to the test load and repetitions for NFL-225 and SWI-215, but no association with SWI-225. To explore these results, players were ranked into quartiles based on their one-repetition maximum relative to 102.27 kg (225 lb), and a 3 × 4 repeated measures analysis of variance was conducted. The primary finding was a significant Test Condition × Quartile interaction ( p = .004). Bonferroni-corrected pairwise comparisons revealed that Quartile 4 (those with lowest strength relative to test load) completed more repetitions for SWI-225 compared with NFL-225 ( p = .049). These results suggest that alternate weight plate arrangements may be beneficial for those whose bench press load is near the lifter's one-repetition maximum. However, variations of the SWI do not appear to affect the performance of repetitions-to-fatigue bench press tests for the majority of collegiate American football players.

  14. 32 CFR 37.225 - What judgment must I make about the benefits of using a TIA?

    Science.gov (United States)

    2010-07-01

    ... using a TIA? 37.225 Section 37.225 National Defense Department of Defense OFFICE OF THE SECRETARY OF... Investment Agreements § 37.225 What judgment must I make about the benefits of using a TIA? Before deciding that a TIA is appropriate, you also must judge that using a TIA could benefit defense research...

  15. 48 CFR 52.225-3 - Buy American Act-Free Trade Agreements-Israeli Trade Act.

    Science.gov (United States)

    2010-10-01

    ... Trade Agreements-Israeli Trade Act. 52.225-3 Section 52.225-3 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.225-3 Buy American Act—Free Trade Agreements—Israeli Trade Act. As prescribed in 25.1101(b)(1)(i), insert the following clause: Buy American Act—Free Trade Agreements—Israeli...

  16. 12 CFR 225.83 - What are the consequences of failing to continue to meet applicable capital and management...

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What are the consequences of failing to continue to meet applicable capital and management requirements? 225.83 Section 225.83 Banks and Banking... AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies § 225.83 What are...

  17. 48 CFR 225.401-71 - Products or services in support of operations in Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... support of operations in Iraq or Afghanistan. 225.401-71 Section 225.401-71 Federal Acquisition... Afghanistan. When acquiring products or services, other than small arms, in support of operations in Iraq or Afghanistan— (a) If using the procedure specified in 225.7703-1(a)(1), the purchase restriction at FAR 25.403...

  18. 40 CFR 1068.225 - What are the provisions for exempting engines/equipment for national security?

    Science.gov (United States)

    2010-07-01

    ... engines/equipment for national security? 1068.225 Section 1068.225 Protection of Environment ENVIRONMENTAL...) Manufacturers may request a national security exemption for engines/equipment not meeting the conditions of... applicable): (i) “THIS ENGINE HAS AN EXEMPTION FOR NATIONAL SECURITY UNDER 40 CFR 1068.225.” (ii) “THIS...

  19. 48 CFR 52.225-4 - Buy American Act-Free Trade Agreement-Israeli Trade Act Certificate.

    Science.gov (United States)

    2010-10-01

    ... Trade Agreement-Israeli Trade Act Certificate. 52.225-4 Section 52.225-4 Federal Acquisition Regulations... CLAUSES Text of Provisions and Clauses 52.225-4 Buy American Act—Free Trade Agreement—Israeli Trade Act... Agreement—Israeli Trade Act Certificate (JUN 2009) (a) The offeror certifies that each end product, except...

  20. 48 CFR 252.225-7036 - Buy American Act-Free Trade Agreements-Balance of Payments Program.

    Science.gov (United States)

    2010-10-01

    ... Trade Agreements-Balance of Payments Program. 252.225-7036 Section 252.225-7036 Federal Acquisition... Trade Agreements—Balance of Payments Program. As prescribed in 225.1101(11)(i), use the following clause: Buy American Act—Free Trade Agreements—Balance of Payments Program (JUL 2009) (a) Definitions. As used...

  1. 48 CFR 752.225-9 - Buy American Act-Trade Agreements Act-Balance of Payments Program.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Texts of Provisions and Clauses 752.225-9 Buy American Act—Trade Agreements Act—Balance of... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Buy American Act-Trade Agreements Act-Balance of Payments Program. 752.225-9 Section 752.225-9 Federal Acquisition Regulations...

  2. 48 CFR 252.225-7035 - Buy American Act-Free Trade Agreements-Balance of Payments Program Certificate.

    Science.gov (United States)

    2010-10-01

    ... Trade Agreements-Balance of Payments Program Certificate. 252.225-7035 Section 252.225-7035 Federal... Trade Agreements—Balance of Payments Program Certificate. As prescribed in 225.1101(10), use the following provision: Buy American Act—Free Trade Agreements—Balance of Payments Program Certificate (DEC...

  3. Nuclear structure effects in the exotic decay of $^{225}$Ac via $^{14}$C emission

    CERN Document Server

    Bonetti, R; Guglielmetti, A; Matheoud, R; Migliorino, C; Pasinetti, A L; Ravn, H L

    1993-01-01

    By using a $^{225}$Ac source produced at the electromagnetic separator Isolde we collected on our track-recording glass detectors 305 $^{14}$C events from the radioactive decays of $^{225}$Ac and its daughter $^{221}$Fr and obtained, for $^{225}$Ac, a branching ratio B($^{14}$C/$\\alpha$)=(6.0 $\\pm$ 1.3) x 10$^{-12}$. Our result suggests that such a decay from an odd proton nucleus is dominated by transition to the ground or to the first excited state of daughter nucleus.

  4. 225m Outdoor W-Band Radio-over-Fiber Link Using an Optical SFP+ Module

    DEFF Research Database (Denmark)

    Rommel, Simon; Rodríguez Páez, Juan Sebastián; Chorchos, Łukasz

    2016-01-01

    A W-band radio-over-fiber link based on a commercial SFP+ module is demonstrated, allowing easy integration into existing PON solutions. Without active laser control good RF frequency stability and 225m wireless distance are achieved...

  5. 41 CFR 102-38.225 - What are the additional requirements in the bid process?

    Science.gov (United States)

    2010-07-01

    ... OF PERSONAL PROPERTY Bids Acceptance of Bids § 102-38.225 What are the additional requirements in the bid process? All sales except fixed price sales must contain a certification of independent price...

  6. Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J

    2007-09-01

    The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.

  7. 48 CFR 252.225-7008 - Restriction on Acquisition of Specialty Metals.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions And Clauses 252.225-7008 Restriction on Acquisition of Specialty Metals. As... more of the following limits: Manganese, 1.65 percent; silicon, 0.60 percent; or copper, 0.60 percent...

  8. Design and test of a 2.25-MW transformer rectifier assembly

    Science.gov (United States)

    Cormier, R.; Daeges, J.

    1989-01-01

    A new 2.25-MW transformer rectifier assembly was fabricated for DSS-13 at Goldstone, California. The transformer rectifier will provide constant output power of 2.25 MW at any voltage from 31 kV to 125 kV. This will give a new capability of 1 MW of RF power at X-band, provided appropriate microwave tubes are in the power amplifier. A description of the design and test results is presented.

  9. EGFR inhibitor C225 increases the radiosensitivity of human lung squamous cancer cells

    Directory of Open Access Journals (Sweden)

    Yang Ruijie

    2010-10-01

    Full Text Available Abstract Background The purpose of the present study is to investigate the direct biological effects of the epidermal growth factor receptor (EGFR inhibitor C225 on the radiosensitivity of human lung squamous cancer cell-H520. H520 cells were treated with different dosage of 60Co γ ray irradiation (1.953 Gy/min in the presence or absence of C225. The cellular proliferation, colony forming capacity, apoptosis, the cell cycle distribution as well as caspase-3 were analyzed in vitro. Results We found that C225 treatment significantly increased radiosensitivity of H-520 cells to irradiation, and led to cell cycle arrest in G1 phase, whereas 60Co γ ray irradiation mainly caused G2 phase arrest. H-520 cells thus displayed both the G1 and G2 phase arrest upon treatment with C225 in combination with 60Co γ ray irradiation. Moreover, C225 treatment significantly increased the apoptosis percentage of H-520 cells (13.91% ± 1.88% compared with the control group (5.75% ± 0.64%, P Conclusion In this regard, C225 treatment may make H-520 cells more sensitive to irradiation through the enhancement of caspase-3 mediated tumor cell apoptosis and cell cycle arrest.

  10. Composite outcomes in 2.25-mm drug eluting stents: a systematic review

    International Nuclear Information System (INIS)

    Lee, Justin Z.; Singh, Nirmal; Ortega, Gilbert; Low, See Wei; Kanakadandi, Uday; Fortuin, F. David; Lassar, Tom; Lee, Kwan S.

    2015-01-01

    Background: Coronary atherosclerosis often involves small-caliber coronaries, yet the safety and efficacy of 2.25-mm DES have been poorly defined, with a general lack of separation of 2.25 with 2.5-mm performance. No randomized head-to-head 2.25 mm DES studies have been reported. There are several single-arm prospective studies, and we aim to systematically review all published specific 2.25-mm data to estimate composite DES-specific performance and highlight current knowledge gaps. Methods: We performed a systematic literature search of PubMed, EMBASE, Web of Science and Cochrane database for clinical trials of 2.25-mm DES. Angiographic and composite clinical outcomes were compared with descriptive statistics. Results: 2.25 mm-Paclitaxel (PES), sirolimus (SES), everolimus (EES) and platinum chromium EES DES-specific outcomes have been reported. Death at 12 months for SES, PES, EES and platinum chromium EES was 1.3%, 3.0%, 1.5%, and 4.4%. Rates of target vessel revascularization at 12 months for SES, PES, EES and platinum chromium EES were 5.7%, 13.3%, 8.8%, and 3.3%. Angiographic outcomes at 9 months to one year were as follows: mean late lumen loss (LLL) for SES, PES, and EES was 0.15 ± 0.11-mm, 0.28 ± 0.11-mm, and 0.16 ± 0.41-mm and mean diameter restenosis for SES, PES, and EES were 29.5 ± 6.2%, 34.7 ± 4.2%, and 20.9 ± 22.5%. Reported stent thrombosis rates for 2.25-mm DES were low ranging from 0% to 2.2% in up to 24-months of follow-up. Conclusions: This systematic review summarizes and tabulates all available specific data on 2.25-mm DES. Based on our descriptive analysis, 2.25-mm DESs have a favorable safety and efficacy profile for the treatment of very small coronary lesions. - Highlights: • Safety and efficacy of 2.25-mm DES have been poorly defined. • We performed a systematic review on all published 2.25 mm data to estimate composite DES-specific performance and highlight current knowledge gaps. • We pooled data from 9 clinical studies and 1

  11. Composite outcomes in 2.25-mm drug eluting stents: a systematic review

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Justin Z. [Department of Medicine, University of Arizona, 1501 N Campbell Avenue, Tucson, AZ, 85724 (United States); Singh, Nirmal [Department of Cardiovascular Diseases, University of Arizona, 1501 N Campbell Ave, Tucson, AZ, 85724 (United States); Ortega, Gilbert [College of Medicine, University of Arizona, 1501 N Campbell Ave, Tucson, AZ, 85724 (United States); Low, See Wei; Kanakadandi, Uday [Department of Cardiovascular Diseases, University of Arizona, 1501 N Campbell Ave, Tucson, AZ, 85724 (United States); Fortuin, F. David [Department of Cardiovascular Diseases, Mayo Clinic Arizona, 5777 East Mayo Boulevard, Phoenix, AZ, 85054 (United States); Lassar, Tom [Department of Cardiovascular Diseases, University of Arizona, 1501 N Campbell Ave, Tucson, AZ, 85724 (United States); Lee, Kwan S., E-mail: klee@shc.arizona.edu [Department of Cardiovascular Diseases, University of Arizona, 1501 N Campbell Ave, Tucson, AZ, 85724 (United States)

    2015-06-15

    Background: Coronary atherosclerosis often involves small-caliber coronaries, yet the safety and efficacy of 2.25-mm DES have been poorly defined, with a general lack of separation of 2.25 with 2.5-mm performance. No randomized head-to-head 2.25 mm DES studies have been reported. There are several single-arm prospective studies, and we aim to systematically review all published specific 2.25-mm data to estimate composite DES-specific performance and highlight current knowledge gaps. Methods: We performed a systematic literature search of PubMed, EMBASE, Web of Science and Cochrane database for clinical trials of 2.25-mm DES. Angiographic and composite clinical outcomes were compared with descriptive statistics. Results: 2.25 mm-Paclitaxel (PES), sirolimus (SES), everolimus (EES) and platinum chromium EES DES-specific outcomes have been reported. Death at 12 months for SES, PES, EES and platinum chromium EES was 1.3%, 3.0%, 1.5%, and 4.4%. Rates of target vessel revascularization at 12 months for SES, PES, EES and platinum chromium EES were 5.7%, 13.3%, 8.8%, and 3.3%. Angiographic outcomes at 9 months to one year were as follows: mean late lumen loss (LLL) for SES, PES, and EES was 0.15 ± 0.11-mm, 0.28 ± 0.11-mm, and 0.16 ± 0.41-mm and mean diameter restenosis for SES, PES, and EES were 29.5 ± 6.2%, 34.7 ± 4.2%, and 20.9 ± 22.5%. Reported stent thrombosis rates for 2.25-mm DES were low ranging from 0% to 2.2% in up to 24-months of follow-up. Conclusions: This systematic review summarizes and tabulates all available specific data on 2.25-mm DES. Based on our descriptive analysis, 2.25-mm DESs have a favorable safety and efficacy profile for the treatment of very small coronary lesions. - Highlights: • Safety and efficacy of 2.25-mm DES have been poorly defined. • We performed a systematic review on all published 2.25 mm data to estimate composite DES-specific performance and highlight current knowledge gaps. • We pooled data from 9 clinical studies and 1

  12. Preparation and characterization of Fe3O4@Au-C225 composite targeted nanoparticles for MRI of human glioma.

    Science.gov (United States)

    Ge, Yaoqi; Zhong, Yuejiao; Ji, Guozhong; Lu, Qianling; Dai, Xinyu; Guo, Zhirui; Zhang, Peng; Peng, Gang; Zhang, Kangzhen; Li, Yuntao

    2018-01-01

    To study the characterization of Fe3O4@Au-C225 composite targeted MNPs. Fe3O4@Au-C225 was prepared by the absorption method. The immunosorbent assay was used to evaluate its absorption efficiency at C225 Fc. ZETA SIZER3000 laser particle size analyzer, ultraviolet photometer and its characteristics were analyzed by VSM. the targeting effect of Fe3O4@Au-C225 composite targeted MNPs on U251 cells in vitro were detected by 7.0 Tesla Micro-MR; and subcutaneous transplanted human glioma in nude mice were performed the targeting effect in vivo after tail vein injection of Fe3O4@Au-C225 composite targeted MNPs by MRI. The self-prepared Fe3O4@Au composite MNPs can adsorb C225 with high efficiency of adsorption so that Fe3O4@Au-C225 composite targeted MNPs were prepared successfully. Fe3O4@Au-C225 composite targeted MNPs favorably targeted human glioma cell line U251 in vitro; Fe3O4@Au-C225 composite targeted MNPs have good targeting ability to xenografted glioma on nude mice in vivo, and can be traced by MRI. The Fe3O4@Au-C225 composite targeted MNPs have the potential to be used as a tracer for glioma in vivo.

  13. Radiosensitization of C225 on human non-small cell lung cancer cell line H-520

    International Nuclear Information System (INIS)

    Zhang Yingdong; Wang Junjie; Liu Feng; Zhao Yong

    2008-01-01

    Objective: To investigate the efficacy of C225 (cetuximab), a chimeric human-mouse anti-epithelial growth factor receptor monoclonal antibody, combined with 60 Co gamma irradiation against human non-small cell lung cancer cell line H-520. Methods: H-520 cells were treated either with different dose of 60 Co irradiation (1,2,4,6,8 and 10 Gy)alone or together with C225 (100 nmol/L). Colony forming capacity was determined to create the survival curve 10 days after the treatment. Cells in different groups were harvested 72 hours after irradiation for apoptosis analysis or 48 hours after irradiation for cell cycle analysis by flow cytometry assay. Results: The clone number in combinational treatment group was less than that in irradiation only group, which suggested that the cell survival rate in the combinational treatment group was significantly decreased comparing with irradiation only group (F=6.36, P O + G 1 phases for C225 treatment, in G 2 + M phases for 60 Co irradiation, and in both G 0 + G 1 and G 2 + M phases for C225 in combination with 60 Co irradiation. Conclusions: C225 has radiosensitizing effects on H-520 cells, which may through the enhancement of 60 Co irradiation-induced cell death and cell cycle arrest. This study provides a supportive evidence for clinical treatment in non-small cell lung cancer. (authors)

  14. Applications of the INFCIRC225/rev5 to the national physical protection regime

    International Nuclear Information System (INIS)

    Kim, Jae Gwang

    2011-01-01

    The IAEA's first effort for playing a key role in physical protection of nuclear material and facilities resulted in the publication of 'Recommendations for the physical protection of nuclear material' in 1972. These recommendations were revised by a group of experts in co-operation with the IAEA Secretariat and the revised version was published in 1975 in INFCIRC/225. The document was subsequently revised in 1977(rev.1), 1989(rev.2), in 1993(rev.3) and 1998(rev4). The Physical Protection regime in ROK has been established on the basis of INFCIRC225 rev4 since 2004 IAEA recently published The INFCIRC 225 rev5 through the 2 years expert consultations. The publication recommended 12 nuclear security fundamentals and requirements of physical protection of nuclear material and nuclear facility to the member states. This paper suggests the several applications to the national physical protection system from the 12 fundamentals and the requirements

  15. Functionalized NaA nanozeolites labeled with 224,225Ra for targeted alpha therapy.

    Science.gov (United States)

    Piotrowska, Agata; Leszczuk, Edyta; Bruchertseifer, Frank; Morgenstern, Alfred; Bilewicz, Aleksander

    2013-01-01

    The 223 Ra, 224 Ra, and 225 Ra radioisotopes exhibit very attractive nuclear properties for application in radionuclide therapy. Unfortunately the lack of appropriate bifunctional ligand for radium is the reason why these radionuclides have not found application in receptor-targeted therapy. In the present work, the potential usefulness of the NaA nanozeolite as a carrier for radium radionuclides has been studied. 224 Ra and 225 Ra, α-particle emitting radionuclides, have been absorbed in the nanometer-sized NaA zeolite (30-70 nm) through simple ion exchange. 224,225 Ra-nanozeolites exhibited very high stability in solutions containing physiological salt, EDTA, amino acids, and human serum. To make NaA nanozeolite particles dispersed in water their surface was modified with a silane coupling agent containing poly(ethylene glycol) molecules. This functionalization approach let us covalently attach a biomolecule to the NaA nanozeolite surface.

  16. Performance and beam characteristics of the PANTAK THERAPAX HF225 X-ray therapy machine

    Energy Technology Data Exchange (ETDEWEB)

    Yiannakkaras, C; Papadopoulos, N; Christodoulides, G [Department of Medical Physics, Nicosia General Hospital, 1450 Nicosia (Cyprus)

    1999-12-31

    The performance and beam characteristics of the new PANTAK THERAPAX HF225 X-ray therapy machine have been measured, evaluated and discussed. Eight beam qualities within the working range of generating potentials between 50 and 225 kVp are used in our department. These beam qualities have been investigated in order to provide a data base specific to our machine. Beam Quality, Central Axis Depth Dose, Output, Relative Field Uniformity and Timer Error were investigated. (authors) 11 refs., 4 figs., 9 tabs.

  17. 12 CFR 225.107 - Acquisition of stock in small business investment company.

    Science.gov (United States)

    2010-01-01

    ...) of the Act makes it unlawful for a bank to invest any of its funds in the capital stock of any other... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Acquisition of stock in small business...) Regulations Financial Holding Companies Interpretations § 225.107 Acquisition of stock in small business...

  18. 48 CFR 225.7303-3 - Government-to-government agreements.

    Science.gov (United States)

    2010-10-01

    ... Military Sales 225.7303-3 Government-to-government agreements. If a government-to-government agreement... support of a specifically defined weapon system, major end item, or support item, contains language in conflict with the provisions of this section, the language of the government-to-government agreement...

  19. 33 CFR 162.225 - Columbia and Willamette Rivers, Washington and Oregon; administration and navigation.

    Science.gov (United States)

    2010-07-01

    ... the river as appropriate such temporary speed regulations as he may deem necessary to protect the... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Columbia and Willamette Rivers... NAVIGATION REGULATIONS § 162.225 Columbia and Willamette Rivers, Washington and Oregon; administration and...

  20. Determination of ''226Ra by Alpha Spectrometry by Using ''225Ra as Yield Tracer

    International Nuclear Information System (INIS)

    Crespo, M. T.; Oller, O.

    1999-01-01

    A method for the determination of low-level ''226 Ra in environmental and geological samples by alpha spectrometry is described. The method is based on the use of ''225 Ra from ''229 Th as yield tracer and has been developed to analyze U, Th and Ra in the same sample. (Author) 12 refs

  1. 25 CFR 225.36 - Minerals agreement cancellation; Bureau of Indian Affairs notice of noncompliance.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Minerals agreement cancellation; Bureau of Indian Affairs... INTERIOR ENERGY AND MINERALS OIL AND GAS, GEOTHERMAL, AND SOLID MINERALS AGREEMENTS Minerals Agreements § 225.36 Minerals agreement cancellation; Bureau of Indian Affairs notice of noncompliance. (a) If the...

  2. 48 CFR 225.872-7 - Industrial security for qualifying countries.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Industrial security for... Agreements and Coordination 225.872-7 Industrial security for qualifying countries. The required procedures... qualifying country sources are in the DoD Industrial Security Regulation DoD 5220.22-R (implemented for the...

  3. 12 CFR 225.143 - Policy statement on nonvoting equity investments by bank holding companies.

    Science.gov (United States)

    2010-01-01

    ... CONTROL (REGULATION Y) Regulations Financial Holding Companies Interpretations § 225.143 Policy statement on nonvoting equity investments by bank holding companies. (a) Introduction. (1) In recent months, a... company has the power, directly or indirectly, to exercise a controlling influence over the management or...

  4. 12 CFR 225.21 - Prohibited nonbanking activities and acquisitions; exempt bank holding companies.

    Science.gov (United States)

    2010-01-01

    ... CONTROL (REGULATION Y) Regulations Nonbanking Activities and Acquisitions by Bank Holding Companies § 225... company or a subsidiary may not engage in, or acquire or control, directly or indirectly, voting... Internal Revenue Code (26 U.S.C. 501(c)). (3) Companies granted hardship exemption. Any bank holding...

  5. 7 CFR Appendix C to Part 225 - Child Nutrition (CN) Labeling Program

    Science.gov (United States)

    2010-01-01

    ...). EC17SE91.006 (c) The CN label statement includes the following: (1) The product identification number... 7 Agriculture 4 2010-01-01 2010-01-01 false Child Nutrition (CN) Labeling Program C Appendix C to... Appendix C to Part 225—Child Nutrition (CN) Labeling Program 1. The Child Nutrition (CN) Labeling Program...

  6. 12 CFR 225.118 - Computer services for customers of subsidiary banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Computer services for customers of subsidiary...) Regulations Financial Holding Companies Interpretations § 225.118 Computer services for customers of... status if it should provide data processing services for customers of the subsidiary banks. (b) The Board...

  7. 2 CFR Appendix B to Part 225 - Selected Items of Cost

    Science.gov (United States)

    2010-01-01

    ... PRINCIPLES FOR STATE, LOCAL, AND INDIAN TRIBAL GOVERNMENTS (OMB CIRCULAR A-87) Pt. 225, App. B Appendix B to.... Royalties and other costs for the use of patents 39. Selling and marketing 40. Taxes 41. Termination costs... principles to be applied in establishing the allowability or unallowability of certain items of cost. These...

  8. 21 CFR 225.102 - Master record file and production records.

    Science.gov (United States)

    2010-04-01

    ... or production run of medicated feed to which it pertains. The Master Record File or card shall... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Master record file and production records. 225.102....102 Master record file and production records. (a) The Master Record File provides the complete...

  9. 12 CFR 225.122 - Bank holding company ownership of mortgage companies.

    Science.gov (United States)

    2010-01-01

    ... counseling” and “advertising, public relations, developing new business, organization, operations, preparing tax returns, and personnel”. The legislative history further indicates that some other activities also... the 1958 Federal Reserve Bulletin at page 431 (12 CFR 225.104), the legislative history of the...

  10. 25 CFR 225.35 - Inspection of premises; books and accounts.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises; books and accounts. 225.35...; books and accounts. (a) Operators shall allow Indian mineral owners, their authorized representatives... submit all related reports required by the minerals agreement and applicable regulations. Books and...

  11. Replacement of HCFC-225 Solvent for Cleaning NASA Propulsion Oxygen Systems

    Science.gov (United States)

    Mitchell, Mark A.; Lowrey, Nikki M.

    2015-01-01

    Since the 1990's, when the Class I Ozone Depleting Substance (ODS) chlorofluorocarbon-113 (CFC-113) was banned, NASA's rocket propulsion test facilities at Marshall Space Flight Center (MSFC) and Stennis Space Center (SSC) have relied upon hydrochlorofluorocarbon-225 (HCFC-225) to safely clean and verify the cleanliness of large scale propulsion oxygen systems. Effective January 1, 2015, the production, import, export, and new use of HCFC-225, a Class II ODS, was prohibited by the Clean Air Act. In 2012 through 2014, leveraging resources from both the NASA Rocket Propulsion Test Program and the Defense Logistics Agency - Aviation Hazardous Minimization and Green Products Branch, test labs at MSFC, SSC, and Johnson Space Center's White Sands Test Facility (WSTF) collaborated to seek out, test, and qualify a replacement for HCFC-225 that is both an effective cleaner and safe for use with oxygen systems. Candidate solvents were selected and a test plan was developed following the guidelines of ASTM G127, Standard Guide for the Selection of Cleaning Agents for Oxygen Systems. Solvents were evaluated for materials compatibility, oxygen compatibility, cleaning effectiveness, and suitability for use in cleanliness verification and field cleaning operations. Two solvents were determined to be acceptable for cleaning oxygen systems and one was chosen for implementation at NASA's rocket propulsion test facilities. The test program and results are summarized. This project also demonstrated the benefits of cross-agency collaboration in a time of limited resources.

  12. The feasibility of 225Ac as a source of α-particles in radioimmunotherapy

    International Nuclear Information System (INIS)

    Geerlings, M.W.; Hout, R. van der; Kaspersen, F.M.; Apostolides, C.

    1993-01-01

    This paper proposes the utilization of 225 Ac for the α-radioimmunotherapy of cancer. The isotope decays with a radioactive half-life of 10 days into a cascade of short-lived α-and β-emitting isotopes. In addition, when indicated by the pharmacokinetic requirements of particular clinical applications, 213 Bi, with a radioactive half-life of 47 min, can be chosen as an alternative source of α-particles in radioimmunotherapy. This isotope is the last α emitter in the 225 Ac decay-cascade and can be extracted from a 225 Ac source at the bedside of the patient. 225 Ac can quasi ad infinitum be obtained from one of its precursors, 229 Th, which can be made available by various means. The indications for the use of α-particles as an alternative to more traditional classes of radiation are derived from the particle-kinetic characteristics and the radioactive half-life of their source isotope, as well as from the properties of the target-selective carrier moiety for the source isotope. It may be expected that useful applications, complementary to and/or in conjunction with other means of therapy will be identified. (author)

  13. 12 CFR 225.140 - Disposition of property acquired in satisfaction of debts previously contracted.

    Science.gov (United States)

    2010-01-01

    ... relation to the overall financial position of the company, and the company has made good faith efforts to... (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies Interpretations § 225.140 Disposition of...

  14. 20 CFR 225.43 - PIA's subject to cost-of-living increases.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false PIA's subject to cost-of-living increases... RETIREMENT ACT PRIMARY INSURANCE AMOUNT DETERMINATIONS Cost-of-Living Increases § 225.43 PIA's subject to cost-of-living increases. The Retirement Tier I, Overall Minimum, Survivor Tier I, Employee RIB and RLS...

  15. 20 CFR 225.44 - When a cost-of-living increase is payable.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a cost-of-living increase is payable... RETIREMENT ACT PRIMARY INSURANCE AMOUNT DETERMINATIONS Cost-of-Living Increases § 225.44 When a cost-of-living increase is payable. A cost-of-living increase is payable beginning with December of the year for...

  16. 20 CFR 225.41 - How a cost-of-living increase is determined and applied.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How a cost-of-living increase is determined... RAILROAD RETIREMENT ACT PRIMARY INSURANCE AMOUNT DETERMINATIONS Cost-of-Living Increases § 225.41 How a cost-of-living increase is determined and applied. Depending on the condition of the social security...

  17. 12 CFR 225.127 - Investment in corporations or projects designed primarily to promote community welfare.

    Science.gov (United States)

    2010-01-01

    .... For bank holding companies that file the FR Y-9C (Consolidated Financial Statements for Bank Holding... the FR Y-SP (Parent Company Only Financial Statements for Small Bank Holding Companies), an... CONTROL (REGULATION Y) Regulations Financial Holding Companies Interpretations § 225.127 Investment in...

  18. A=225 implantation for $^{221}$Fr source for TRIUMF atom trap

    CERN Multimedia

    The FrPNC Collaboration is mounting an atom trap for parity violation experiments and precision spectroscopy on francium atoms at TRIUMF's ISAC facility. We would like to use ISOLDE's capability of simultaneously implanting A=225 (while another experiment runs online) to make a long-lived source feeding $^{221}$Fr for tests of the trap. $^{225}$Ra $\\beta$-decays to $^{225}$Ac, which then $\\alpha$-decays, producing 100 keV $^{221}$Fr t$_{1/2}$= 4.8 minute recoils. The implanted A=225 source would be shipped to TRIUMF, where it would be held for several minutes at a time a few mm from the same yttrium foil that normally receives the ISAC beam. SRIM calculations imply that 20% of the $^{221}$Fr will be implanted in a 1 cm diameter spot on the yttrium. Then the yttrium foil is moved to the trap and heated to release the Fr atoms, just as in normal ISAC online operation. A test implantation will be done at 10$^{7}$/sec production for 1 day, testing whether carbon cracking on the implantation foil in the mass separ...

  19. 12 CFR 225.92 - How does an election by a foreign bank become effective?

    Science.gov (United States)

    2010-01-01

    ...) Regulations Financial Holding Companies § 225.92 How does an election by a foreign bank become effective? (a... company that its election to be treated as a financial holding company is effective prior to the 31st day... treated as a financial holding company shall not be effective if, during the period provided in paragraph...

  20. 48 CFR 225.770 - Prohibition on acquisition of United States Munitions List items from Communist Chinese military...

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Prohibition on acquisition of United States Munitions List items from Communist Chinese military companies. 225.770 Section 225... of United States Munitions List items from Communist Chinese military companies. This section...

  1. 48 CFR 252.225-7007 - Prohibition on Acquisition of United States Munitions List Items from Communist Chinese Military...

    Science.gov (United States)

    2010-10-01

    ... of United States Munitions List Items from Communist Chinese Military Companies. 252.225-7007 Section... Chinese Military Companies. As prescribed in 225.1103(4), use the following clause: Prohibition On Acquisition of United States Munitions List Items From Communist Chinese Military Companies (SEP 2006) (a...

  2. 12 CFR 225.111 - Limit on investment by bank holding company system in stock of small business investment companies.

    Science.gov (United States)

    2010-01-01

    .... L. 90-104, 81 Stat. 268, 270), a national bank may invest in stock of small business investment... system in stock of small business investment companies. 225.111 Section 225.111 Banks and Banking FEDERAL... Limit on investment by bank holding company system in stock of small business investment companies. (a...

  3. 48 CFR 225.7303-2 - Cost of doing business with a foreign government or an international organization.

    Science.gov (United States)

    2010-10-01

    ... reasonable and allocable costs of doing business with a foreign government or international organization... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost of doing business with a foreign government or an international organization. 225.7303-2 Section 225.7303-2 Federal...

  4. 77 FR 56253 - Ninth Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems-Small...

    Science.gov (United States)

    2012-09-12

    ... 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size AGENCY: Federal Aviation... 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. SUMMARY: The FAA is..., Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. DATES: The meeting will be held...

  5. 76 FR 70531 - Fifth Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems-Small...

    Science.gov (United States)

    2011-11-14

    ... 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size AGENCY: Federal Aviation..., Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 225, Rechargeable Lithium Battery and...

  6. 77 FR 66084 - Tenth Meeting: RTCA Special Committee 225, Rechargeable Lithium Battery and Battery Systems-Small...

    Science.gov (United States)

    2012-11-01

    ... 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size AGENCY: Federal Aviation... 225, Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. SUMMARY: The FAA is..., Rechargeable Lithium Battery and Battery Systems--Small and Medium Size. DATES: The meeting will be held...

  7. 41 CFR 102-41.225 - Are there special provisions to reporting and transferring drug paraphernalia forfeited under 21...

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are there special provisions to reporting and transferring drug paraphernalia forfeited under 21 U.S.C. 863? 102-41.225 Section 102-41.225 Public Contracts and Property Management Federal Property Management Regulations System...

  8. 21 CFR 172.225 - Methyl and ethyl esters of fatty acids produced from edible fats and oils.

    Science.gov (United States)

    2010-04-01

    ... from edible fats and oils. 172.225 Section 172.225 Food and Drugs FOOD AND DRUG ADMINISTRATION... Methyl and ethyl esters of fatty acids produced from edible fats and oils. Methyl esters and ethyl esters of fatty acids produced from edible fats and oils may be safely used in food, subject to the...

  9. 48 CFR 52.225-7 - Waiver of Buy American Act for Civil Aircraft and Related Articles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Waiver of Buy American Act for Civil Aircraft and Related Articles. 52.225-7 Section 52.225-7 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT...

  10. 48 CFR 52.225-12 - Notice of Buy American Act Requirement-Construction Materials Under Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... Requirement-Construction Materials Under Trade Agreements. 52.225-12 Section 52.225-12 Federal Acquisition...—Construction Materials Under Trade Agreements. As prescribed in 25.1102(d)(1), insert the following provision: Notice of Buy American Act Requirement—Construction Materials Under Trade Agreements (FEB 2009) (a...

  11. Alpha radioisotopes Ac-225 and Bi-213: a production and labelling of antibodies and peptides for clinical use

    Energy Technology Data Exchange (ETDEWEB)

    Bruchertseifer, Frank, E-mail: frank.bruchertseifer@ec.europa.eu [European Commission, Joint Research Centre, Karlsruhe (Germany)

    2017-07-01

    Full text: In various preclinical and clinical works the potential of the alpha emitters {sup 225}Ac and {sup 213}Bi as therapeutic radionuclides for application in targeted alpha therapy of cancer and infectious diseases was demonstrated. Both alpha emitters are available with high specific activity from established radionuclide generators. Their favorable chemical and physical properties have led to the conduction of a large number of preclinical studies and several clinical trials, demonstrating the feasibility, safety and therapeutic efficacy of targeted alpha therapy with {sup 225}Ac and {sup 213}Bi. This presentation will give an overview about the methods for the production of {sup 225}Ac and {sup 213}Bi, the {sup 225}Ac/{sup 213}Bi radionuclide generator systems, labelling of peptides and antibodies with {sup 225}Ac and {sup 213}Bi and relevant in vivo and in vitro works. (author)

  12. A theoretical model for the production of Ac-225 for cancer therapy by neutron capture transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Melville, P

    2013-02-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation by bombarding Ra-226 with high-energy neutrons from a neutron source to produce Ra-225 and hence Ac-225, which can be used as a generator to produce Bi-213 for use in 'Targeted Alpha Therapy' for cancer. This paper examines the possibility of producing Ac-225 by neutron capture using a theoretical model in which neutron energy is convoluted with the corresponding neutron cross sections of Ra-226. The total integrated yield can then be obtained. This study shows that an intense beam of high-energy neutrons could initiate neutron capture on Ra-226 to produce Ra-225 and hence practical amounts of Ac-225 and a useful reduction of Ra-226. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Results of the Test Program for Replacement of AK-225G Solvent for Cleaning NASA Propulsion Oxygen Systems

    Science.gov (United States)

    Lowrey, Nikki M.; Mitchell, Mark A.

    2016-01-01

    Since the 1990's, when the Class I Ozone Depleting Substance (ODS) chlorofluorocarbon-113 (CFC-113) was banned, NASA's propulsion test facilities at Marshall Space Flight Center (MSFC) and Stennis Space Center (SSC) have relied upon the solvent AsahiKlin AK-225 (hydrochlorofluorocarbon-225ca/cb or HCFC-225ca/cb) and, more recently AK-225G (the single isomer form, HCFC-225cb) to safely clean and verify the cleanliness of large scale propulsion oxygen systems. Effective January 1, 2015, the production, import, export, and new use of Class II Ozone Depleting Substances, including AK-225G, was prohibited in the United States by the Clean Air Act. In 2012 through 2014, NASA test labs at MSFC, SSC, and Johnson Space Center's White Sands Test Facility (WSTF) collaborated to seek out, test, and qualify a solvent replacement for AK-225G that is both an effective cleaner and safe for use with oxygen systems. This paper summarizes the tests performed, results, and lessons learned.

  14. Multiple S and O isotope constraints on O2 at 2.25 Ga

    Science.gov (United States)

    Killingsworth, B.; Sansjofre, P.; Philippot, P.; Thomazo, C.; Cartigny, P.; Lalonde, S.

    2017-12-01

    The composition of Earth's atmosphere around the time of the Great Oxidation Event (GOE) at the Archean-Proterozoic boundary is of great interest for reconstructing the redox evolution of the Earth. Sulfate has been shown to be a valuable recorder of isotopic signals of atmospheric O2 but its records are sparse around the time of the GOE. To constrain O2 around the GOE, we have measured quadruple sulfur and triple oxygen isotopes of sulfate from barite in sedimentary drill core from the Turee Creek Group, Australia from 2.25 Ga. A combined sulfur and oxygen approach for estimating the triple oxygen isotope composition of O2 at 2.25 Ga will be presented and its implications for the Paleoproterozoic atmosphere will be discussed.

  15. Wind turbine test Vestas V27-225 kW

    Energy Technology Data Exchange (ETDEWEB)

    Markkilde Petersen, S

    1990-10-15

    The report describes fundamental measurements performed on a Vestas-V27-225 kW pitch regulated wind turbine. The measurements carried out and reported here comprises the power output, system efficiency, energy production, transmission efficiency, rotor power, rotor efficiency, air-brakes efficiency, structural dynamics, loads at cut-in and braking, yaw error statistics, flapwise root bending moment and rotor thrust. (author).

  16. Strange quark suppression in 225 GeV/c pi-minus beryllium interactions

    International Nuclear Information System (INIS)

    Schoessow, P.V.

    1983-01-01

    The Chicago Cyclotron Magnet Spectrometer at Fermilab was used to study the production of #betta#(783) and phi(1020) mesons in 225 GeV/c π - Be interactions via their decays into μ + μ - . Basedon the observed phi/#betta# production ratio, the strange quark suppression factor lambda was determined to be 0.31 +- 0.05, in good agreement with a world average of about 0.29

  17. 27 CFR 70.225 - Suspension of running of period of limitation; assets of taxpayer in control or custody of court.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Suspension of running of period of limitation; assets of taxpayer in control or custody of court. 70.225 Section 70.225 Alcohol... (Occupational) Tax Limitations § 70.225 Suspension of running of period of limitation; assets of taxpayer in...

  18. 12 CFR 225.88 - How to request the Board to determine that an activity is financial in nature or incidental to a...

    Science.gov (United States)

    2010-01-01

    ... activity is financial in nature or incidental to a financial activity? 225.88 Section 225.88 Banks and... COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies § 225.88 How to request the Board to determine that an activity is financial in nature or incidental to a financial...

  19. 12 CFR 225.171 - What are the limitations on managing or operating a portfolio company held as a merchant banking...

    Science.gov (United States)

    2010-01-01

    ... of the portfolio company. Examples of the types of actions that may be subject to these types of... operating a portfolio company held as a merchant banking investment? 225.171 Section 225.171 Banks and... COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Merchant Banking Investments § 225.171 What...

  20. Probing Into the Atmosphere of the Young Exoplanet K2-25b

    Science.gov (United States)

    Chia Thao, Pa; Mann, Andrew

    2018-01-01

    Planets are most transformative during their early life, yet there remains little research on this developmental stage. In order to construct a more accurate picture of the diversity and evolution of planetary atmospheres, we present Spitzer infrared photometry of five transits both in 3.6 μm and 4.5 μm bands of the young exoplanet, K2-25b (650-800 Myr). To correct for the intra-pixel photometric response, we interpolated high-resolution sensitivity maps. Light curves were then created using a transit model and an MCMC framework to find the planet parameters in each wavelength. In comparison to atmospheric theoretical models, we find K2-25b unlikely to have a solar-metallicity atmosphere. However, observed through a full transmission spectrum, K2-25b is consistent with either a high-metallicity atmosphere or a cloudy/hazy layer. Further HST data would provide significantly more detail on the structure of the atmosphere. In a future project, we plan to apply this same method to a younger planet, K2-33b (11 Myr), to determine if cloudy/hazy atmospheres are primordial.

  1. Toughness of 2,25Cr-1Mo steel and weld metal

    Science.gov (United States)

    Acarer, Mustafa; Arici, Gökhan; Acar, Filiz Kumdali; Keskinkilic, Selcuk; Kabakci, Fikret

    2017-09-01

    2,25Cr-1Mo steel is extensively used at elevated temperature structural applications in fossil fire power plants for steam pipes, nozzle chambers and petrochemical industry for hydrocracking unit due to its excellent creep resistance and good redundant to oxidation. Also they should have acceptable weldability and toughness. The steels are supplied in quenched and tempered condition and their welded components are subjected to post-weld heat treatment (PWHT). Tempering process is carried out at 690-710°C to improve toughness properties. However they are sensitive to reheat cracking and temper embrittlement. To measure temper embrittlement of the steels and their weld metal, temper embrittlement factor and formula (J factor - Watanabe and X formula- Bruscato) are used. Step cooling heat treatment is also applied to determine temper embrittlement. In this study, toughness properties of Cr Mo (W) steels were reviewed. Also transition temperature curves of 2,25Cr-1Mo steel and its weld metal were constructed before and after step cool heat treatment as experimental study. While 2,25Cr-1Mo steel as base metal was supplied, all weld metal samples were produced in Gedik Welding Company. Hardness measurements and microstructure evaluation were also carried out.

  2. Guidance and considerations for implementation of INFCIRC/225/Rev.3, the physical protection of nuclear material

    International Nuclear Information System (INIS)

    1997-09-01

    The Physical Protection of Nuclear Material, INFCIRC/225/Rev.3, provides recommendations for the physical protection of nuclear material against theft in use, storage and transport, whether national or international and whether peaceful or military, and contains provisions relating to the sabotage of nuclear material or facilities. The recommendations contained in INFCIRC/225/Rev.3 detail the elements that should be included in a State's system of physical protection. It also recognizes the adverse health and safety consequences arising from the theft of nuclear material and the sabotage of nuclear material or facilities. Most industrial and developing countries use these recommendations to some extent in the establishment and operation of their physical protection systems. Although INFCIRC/225/Rev.3 provides recommendations for protecting materials and facilities from theft or sabotage, it does not provide in-depth details for these recommendations. In June 1996, the IAEA convened a consultants meeting to consider this matter. This report is the result of continuing discussions and drafts over a period of nine months. The intent of this guidance is to provide a broader basis for relevant State organizations to prescribe appropriate requirements for the use of nuclear materials which are compatible with accepted international practice

  3. Hydrogen induced plastic damage in pressure vessel steel of 2.25Cr-1Mo

    International Nuclear Information System (INIS)

    Han, G.W.; Song, Y.J.

    1995-01-01

    2.25Cr-1Mo steel is generally employed as a hydrogenation reaction vessel material used at elevated temperature and in a hydrogen containing environment. During service of the reaction vessel, a large number of hydrogen atoms would enter its wall. When the reaction vessel is shutdown and the temperature reduces to about ambient temperature, the hydrogen atoms remaining in the wall would induce plastic damage in the steel. The mechanism of hydrogen induced plastic damage is different for various materials with different microstructures. Investigations have demonstrated that the hydrogen induced plastic damage in carbide annealed carbon steels is caused by hydrogen accelerating the initiating and growing of microvoids from the carbide particles. However, SEM examination on the fracture surface of hydrogen charged tensile specimen of 2.25Cr-1Mo steel show that a large number of fisheyes appear on the fracture surface. This indicates that hydrogen induced plastic damage in 2.25Cr-1Mo steel is related to the occurrence of fisheye cracks during plastic deformation. By means of micro-fracture mechanics to analyze fisheye crack occurrence from the first generation microvoid, the mechanism of hydrogen induced plastic damage in the pressure vessel steel is investigated

  4. Inhibition of radiation-induced EGFR nuclear import by C225 (Cetuximab) suppresses DNA-PK activity

    International Nuclear Information System (INIS)

    Dittmann, Klaus; Mayer, Claus; Rodemann, Hans-Peter

    2005-01-01

    Background and purpose: Inhibition of EGFR-function can induce radiosensitization in tumor cells. Purpose of our investigation was to identify the possible molecular mechanism of radiosensitization following treatment with anti-EGFR-antibody C225 (Cetuximab). Materials and methods: The effect of C225 on radiation response was determined in human cell lines of bronchial carcinoma (A549) and breast adenoma cells (MDA MB 231). The molecular effects of C225 on EGFR-function after irradiation were analyzed applying western blotting, immune-precipitation and kinase assays. Effects on DNA-repair were detected by quantification of γ-H2AX positive foci 24 h after irradiation. Results: The EGFR specific antibody C225 induced radiosensitization in A549 and also in MDA MB 231 cells. Radiosensitization in A549 was associated with blockage of radiation-induced EGFR transport into the nucleus, and immobilized the complex of EGFR with DNA-dependent protein kinase (DNA-PK) in the cytoplasm. As a consequence radiation-induced DNA-PK activation was abolished, a process that is essential for DNA-repair after radiation exposure. Likewise C225 treatment increased the residual amount of γ-H2AX-positive foci 24 h after irradiation in A549 and in MDA MB 231 cells. Conclusions: Our results suggest that irradiation induced DNA-PK activation-essential for DNA repair-may be hampered specifically by use of the anti-EGFR-antibody C225. This process is associated with radiosensitization

  5. 22.5% efficient silicon heterojunction solar cell with molybdenum oxide hole collector

    Energy Technology Data Exchange (ETDEWEB)

    Geissbühler, Jonas, E-mail: jonas.geissbuehler@epfl.ch; Werner, Jérémie; Martin de Nicolas, Silvia; Hessler-Wyser, Aïcha; Tomasi, Andrea; Niesen, Bjoern; De Wolf, Stefaan [Photovoltaics and Thin Film Electronics Laboratory, Institute of Microengineering (IMT), École Polytechnique Fédérale de Lausanne (EPFL), Rue de la Maladière 71b, CH-2000 Neuchâtel (Switzerland); Barraud, Loris; Despeisse, Matthieu; Nicolay, Sylvain [CSEM PV-Center, Jaquet-Droz 1, CH-2000 Neuchâtel (Switzerland); Ballif, Christophe [Photovoltaics and Thin Film Electronics Laboratory, Institute of Microengineering (IMT), École Polytechnique Fédérale de Lausanne (EPFL), Rue de la Maladière 71b, CH-2000 Neuchâtel (Switzerland); CSEM PV-Center, Jaquet-Droz 1, CH-2000 Neuchâtel (Switzerland)

    2015-08-24

    Substituting the doped amorphous silicon films at the front of silicon heterojunction solar cells with wide-bandgap transition metal oxides can mitigate parasitic light absorption losses. This was recently proven by replacing p-type amorphous silicon with molybdenum oxide films. In this article, we evidence that annealing above 130 °C—often needed for the curing of printed metal contacts—detrimentally impacts hole collection of such devices. We circumvent this issue by using electrodeposited copper front metallization and demonstrate a silicon heterojunction solar cell with molybdenum oxide hole collector, featuring a fill factor value higher than 80% and certified energy conversion efficiency of 22.5%.

  6. Effect of boron on the hot ductility of 2.25Cr1Mo steel

    International Nuclear Information System (INIS)

    Song, S.-H.; Guo, A.-M.; Shen, D.-D.; Yuan, Z.-X.; Liu, J.; Xu, T.-D.

    2003-01-01

    The effect of boron on the hot ductility of 2.25Cr1Mo steel is investigated by means of a Gleeble 2000 thermomechanical simulator. There is a trough in the hot ductility-temperature curve, which is located between 1000 and 700 deg. C. The ductility trough shifts to lower temperatures with increasing boron content and the hot brittle range becomes shallow and narrow. In general, boron may improve the steel hot ductility in that it may retard the formation of pro-eutectoid ferrite and increase grain boundary cohesion. These effects may be related to the segregation of boron to austenite grain boundaries

  7. Increasing The Electric Field For An Improved Search For Time-Reversal Violation Using Radium-225

    Science.gov (United States)

    Powers, Adam

    2017-09-01

    Radium-225 atoms, because of their unusual pear-shaped nuclei, have an enhanced sensitivity to the violation of time reversal symmetry. A breakdown of this fundamental symmetry could help explain the apparent scarcity of antimatter in the Universe. Our goal is to improve the statistical sensitivity of an ongoing experiment that precisely measures the EDM of Radium-225. This can be done by increasing the electric field acting on the Radium atoms. We do this by increasing the voltage that can be reliably applied between two electrodes, and narrowing the gap between them. We use a varying high voltage system to condition the electrodes using incremental voltage ramp tests to achieve higher voltage potential differences. Using an adjustable gap mount to change the distance between the electrodes, specific metals for their composition, and a clean room procedure to keep particulates out of the system, we produce a higher and more stable electric field. Progress is marked by measurements of the leakage current between the electrodes during our incremental voltage ramp tests or emulated tests of the actual experiment, with low and constant current showing stability of the field. This project is supported by Michigan State University, and the US DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  8. Neutron-deuteron analyzing power data at En=22.5 MeV

    Science.gov (United States)

    Weisel, G. J.; Tornow, W.; Crowell, A. S.; Esterline, J. H.; Hale, G. M.; Howell, C. R.; O'Malley, P. D.; Tompkins, J. R.; Witała, H.

    2014-05-01

    We present measurements of n-d analyzing power, Ay(θ), at En=22.5 MeV. The experiment uses a shielded neutron source which produced polarized neutrons via the 2H(d⃗,n⃗)3He reaction. It also uses a deuterated liquid-scintillator center detector and six pairs of liquid-scintillator neutron side detectors. Elastic neutron scattering events are identified by using time-of-flight techniques and by setting a window in the center detector pulse-height spectrum. The beam polarization is monitored by using a high-pressure helium gas cell and an additional pair of liquid-scintillator side detectors. The n-d Ay(θ) data were corrected for finite-geometry and multiple-scattering effects using a Monte Carlo simulation of the experiment. The 22.5-MeV data demonstrate that the three-nucleon analyzing power puzzle also exists at this energy. They show a significant discrepancy with predictions of high-precision nucleon-nucleon potentials alone or combined with Tucscon-Melbourne or Urbana IX three-nucleon forces, as well as currently available effective-field theory based potentials of next-to-next-to-next-to-leading order.

  9. Antimelanoma monoclonal antibody 225-28S. Evaluation of toxicity in man

    Energy Technology Data Exchange (ETDEWEB)

    Cascinelli, N; Attili, A; Belli, F; Buraggi, G; Turrin, A; Gasparini, M; Terno, G; Vaglini, M

    1988-01-01

    To investigate possible undesirable due to the intravenous administration of a reagent of a xenogenic nature (monoclonal antibody 225-28S) in man, a toxicologic study was carried out on 85 patients with metastatic cutaneous melanoma. Two reagents were tested in this study: purified monoclonal antybody (MoAb) 225-28S and its F(ab')2 fragment. Purified MoAb was labelled with /sup 131/I and F(ab')2 fragment with /sup 131/I, or /sup 123/I, or /sup 111/In or /sup 99/Tc. The quantity of MoAb or F(ab')2 injected ranged from 14 to 750 ..mu..g, and the specific activity from 37.0 to 2116.4 MBqmg. The total radioactivity injected varied from 25.9 to 891.7 MBqmg. In addition to a careful clinical examination, the following tests were done to monitor possible adverse effects: blood glucose, azotemia, RBC WBC, platelet count, serum creatine, creatine clearence, plasma electrolyte levels, serum proteins, albuminglobulin ratio, serum bilirubin, SGOT, SgPT, /sub ..gamma../GT, and CPK. These tests were done before the injection and on days 7 and 14. No patient experienced adverse general effects like fever, nausea, vomiting or allergic reaction. None of the afore mentioned hematometric and biochemical tests showed significant variations compared with the initial values. It is concluded that a single injection of these reagents at the dosages tested is completely atoxic.

  10. A theoretical model for the production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Fan Liu, Sau; Allen, B J

    2006-09-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation on a small scale by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) to produce Ra-225, which subsequently decays to Ac-225, which can be used as a generator to produce Bi-213 for use in 'targeted alpha therapy' for cancer. This paper examines the possibility of producing Ac-225 with a linac using an accurate theoretical model in which the bremsstrahlung photon spectrum at 18 MV linac electron energy is convoluted with the corresponding photonuclear cross sections of Ra-226. The total integrated yield can then be obtained and is compared with a computer simulation. This study shows that at 18 MV, the photonuclear reaction on Ra-226 can produce low activities of Ac-225 with a linac. However, a high power linac with high current, pulse length and frequency is needed to produce practical amounts of Ac-225 and a useful reduction of Ra-226.

  11. Evaluation of an Anti-HER2 Nanobody Labeled with 225Ac for Targeted α-Particle Therapy of Cancer.

    Science.gov (United States)

    Pruszynski, Marek; D'Huyvetter, Matthias; Bruchertseifer, Frank; Morgenstern, Alfred; Lahoutte, Tony

    2018-04-02

    Human epidermal growth factor receptor type 2 (HER2) is overexpressed in numerous carcinomas. Nanobodies (Nbs) are the smallest antibody-derived fragments with beneficial characteristics for molecular imaging and radionuclide therapy. Therefore, HER2-targeting nanobodies could offer a valuable platform for radioimmunotherapy, especially when labeled with α-particle emitters, which provide highly lethal and localized radiation to targeted cells with minimal exposure to surrounding healthy tissues. In this study, the anti-HER2 2Rs15d-nanobody was conjugated with 2-(4-isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid ( p-SCN-Bn-DOTA) and radiolabeled with an α-emitter 225 Ac with a high yield (>90%) and a radiochemical purity above 95%. The 225 Ac-DOTA-Nb binding affinity was 4.12 ± 0.47 nM with an immunoreactive fraction above 80%. Binding to low HER2-expressing MDA-MB-231 cells was negligible, whereas HER2-overexpressing SKOV-3 cells could be blocked with an excess of unlabeled nanobody, confirming the specificity of binding. Noncompeting binding to HER2 was observed in the presence of an excess of trastuzumab. The cell-associated fraction of 225 Ac-DOTA-Nb was 34.72 ± 16.66% over 24 h. In vitro, the radioconjugate was toxic in an HER2-mediated and dose-dependent manner, resulting in IC 50 values of 10.2 and 322.1 kBq/mL for 225 Ac-DOTA-Nb and the 225 Ac-DOTA control, respectively, on SKOV-3 cells, and 282.2 kBq/mL for 225 Ac-DOTA-Nb on MDA-MB-231 cells. Ex vivo biodistribution studies, performed in mice bearing subcutaneous HER2-overexpressing and low HER2-expressing tumors, showed a fast uptake in SKOV-3 tumors compared to MDA-MB-231 (4.01 ± 1.58% ID/g vs 0.49 ± 0.20% ID/g after 2 h), resulting also in high tumor-to-normal tissue ratios. In addition, coinjection of 225 Ac-DOTA-Nb with Gelofusine reduced kidney retention by 70%. This study shows that 225 Ac-DOTA-Nb is a promising new radioconjugate for targeted α-particle therapy

  12. Time-resolved spectrophotometry of the AM Herculis system E2003 + 225

    Science.gov (United States)

    Mccarthy, Patrick; Bowyer, Stuart; Clarke, John T.

    1986-01-01

    Time-resolved, medium-resolution photometry is reported for the binary system E2003 + 225 over a complete orbital period in 1984. The object was 1.5-2 mag fainter than when viewed earlier in 1984. The fluxes, equivalent widths and full widths at FWHM for dominant lines are presented for four points in the cycle. A coincidence of emission lines and a 4860 A continuum line was observed for the faster component, which had a 500 km/sec velocity amplitude that was symmetric around the zero line. An aberrant emission line component, i.e., stationary narrow emission lines displaced about 9 A from the rest wavelengths, is modeled as Zeeman splitting of emission from material close to the primary.

  13. Welded joint properties of steel 2.25Cr1MoNiNb

    International Nuclear Information System (INIS)

    Gladis, R.; Ivanek, J.; Gottwald, M.

    1981-01-01

    Welded joints of steel 08Cr2.25Mo1NiNb for fast reactor steam generators made using manual arc welding with electrodes of identical compositions attain short-term mechanical properties and times to fracture when creep tested that match those of the base material. The reduction of the carbidic phase content in the steel and the welded joint metal did not adversely affect the tensile properties of the welded joint while increasing notch toughness of the heat-affected zone. Reduced carbon and niobium contents in the steel and the welded joint resulted in significant reduction in the proportion of carbidic eutectic particles in both the heat-affected zone and the weld metal. (Ha)

  14. Elevated temperature creep and fatigue damage of a 2.25 Cr--1 Mo steel weldment

    International Nuclear Information System (INIS)

    Van Den Avyle, J.A.

    1978-01-01

    In weldments between dissimilar metals wide variations occur in metallurgical structure and mechanical properties, so that for good structural design it is necessary to understand the mechanical response of individual microstructural segments of the weld. This study investigates elevated temperature properties of a 2.25 Cr--1 Mo ferritic steel base metal welded with Chromenar 382V (Inconel 82) filler metal. Creep and low-cycle fatigue tests at 866 0 K (1100 0 F) show the filler metal and heat affected zone to be much stronger than the base metal. Optical microscopy does not show significant aging effects in the short-term fatigue tests or creep tests of 1180 hour duration

  15. Cyclic and isothermal oxidation behavior of 2.25Cr-1Mo steel

    International Nuclear Information System (INIS)

    Proy, M.; Utrilla, M. v.; Otero, E.

    2014-01-01

    Cyclic and isothermal oxidation of chromium-molybdenum steel 2.25Cr-1Mo were analyzed at 550 degree centigrade and 650 degree centigrade during 360 hours in air atmospheres. The cycles were performed with two stages; one of heating in furnace during 90 minutes and then the sample were cooled to 50 degree centigrade by air flow. Thermogravimetric analyses were performed to obtain high temperature corrosion kinetics. Several characterization techniques have been used to identify the corrosion mechanism, as X-Ray Diffraction (XRD), Optical Microscopy (OM) and Scanning Electron Microscopy (SEM). Thermal cycling tests can changes the corrosion mechanism, due cracks propagation in oxide scale, that witch can favors the access of oxidant agent to the substrate. (Author)

  16. Microstructural evaluation and non-destructive examination of 2.25 Cr--1 Mo steel

    International Nuclear Information System (INIS)

    Van Den Avyle, J.A.; Jones, W.B.; Gieske, J.H.

    1978-07-01

    Specimens of 2.25 Cr-1 Mo steel were damaged to various levels by creep and combined creep-fatigue cycling at 886 0 K (1100 0 F) with hold periods. Ultrasonic shear wave velocity measurements were performed and showed small changes with large amounts of creep or fatigue damage; these changes were deemed too small for practical application. Measurements of magnetic properties were unsuccessful in following damage. Optical and transmission electron microscopy (TEM) were performed on the samples. TEM observations showed that microstructural changes which occurred at 886 0 K (1100 0 F) did not occur homogeneously throughout the matrix; during creep, carbide spheroidization and coarsening began in widely separated regions, with an increasing fraction of the material undergoing the process with time. A precipitate was observed to form during fatigue which did not occur during simple aging or creep

  17. Hardness prediction for the repair welding of 2.25Cr-1Mo pressure vessels

    International Nuclear Information System (INIS)

    Oddy, A.S.; Chandel, R.S.

    1991-01-01

    Reactor vessels used for the hydrotreating of heavy oils and tar sand bitumen are frequently made of 2.25Cr-1Mo steel in thicknesses of 150 to 300 nm. Defects developed during installation or service are often repaired by welding. For practical reasons, postweld heat treatment of the repair welds is undesirable. This has led to continued effort to develop weld repair techniques that do not involve postweld heat treatment. Recently a six-layer automatic gas tungsten arc welding (GTAW) technique has been proposed for the repair welding of nuclear reactor vessels made of SA508 Class 2 Steel. In this technique, the second and third passes refine the microstructure of the first pass, and the last three passes temper the first pass. Alberry has developed a set of empirical rules predicting the hardness after each pass in multipass welds made in SA508 Class 2 Steels. This algorithm has been used to predict the number of layers required to achieve desired hardness. A transformation and tempering algorithm for 2.25Cr-1Mo, similar to that of the above steel, is presented. The tempering algorithm of Alberry suffers from several minor problems and can be improved. A mathematically correct method for the calculation of the tempering occurring in an anisothermal cycle is demonstrated. In addition, the rules used to relate the softening that occurs during temperature are heuristic. Separate rules are proposed for the kinetics of softening depending on the peak temperature. A re-examination of those rules reveals that they can be recast in the form of a single rule for the material examined. Reassessing the basic data presented by Alberry leads to a single softening rule with better theoretical justification

  18. Bandwidth-Efficient Communication through 225 MHz Ka-band Relay Satellite Channel

    Science.gov (United States)

    Downey, Joseph; Downey, James; Reinhart, Richard C.; Evans, Michael Alan; Mortensen, Dale John

    2016-01-01

    The communications and navigation space infrastructure of the National Aeronautics and Space Administration (NASA) consists of a constellation of relay satellites (called Tracking and Data Relay Satellites (TDRS)) and a global set of ground stations to receive and deliver data to researchers around the world from mission spacecraft throughout the solar system. Planning is underway to enhance and transform the infrastructure over the coming decade. Key to the upgrade will be the simultaneous and efficient use of relay transponders to minimize cost and operations while supporting science and exploration spacecraft. Efficient use of transponders necessitates bandwidth efficient communications to best use and maximize data throughput within the allocated spectrum. Experiments conducted with NASA's Space Communication and Navigation (SCaN) Testbed on the International Space Station provides a unique opportunity to evaluate advanced communication techniques, such as bandwidth-efficient modulations, in an operational flight system. Demonstrations of these new techniques in realistic flight conditions provides critical experience and reduces the risk of using these techniques in future missions. Efficient use of spectrum is enabled by using high-order modulations coupled with efficient forward error correction codes. This paper presents a high-rate, bandwidth-efficient waveform operating over the 225 MHz Ka-band service of the TDRS System (TDRSS). The testing explores the application of Gaussian Minimum Shift Keying (GMSK), 248-phase shift keying (PSK) and 1632- amplitude PSK (APSK) providing over three bits-per-second-per-Hertz (3 bsHz) modulation combined with various LDPC encoding rates to maximize throughput. With a symbol rate of 200 Mbaud, coded data rates of 1000 Mbps were tested in the laboratory and up to 800 Mbps over the TDRS 225 MHz channel. This paper will present on the high-rate waveform design, channel characteristics, performance results, compensation

  19. Bandwidth-Efficient Communication through 225 MHz Ka-band Relay Satellite Channel

    Science.gov (United States)

    Downey, Joseph A.; Downey, James M.; Reinhart, Richard C.; Evans, Michael A.; Mortensen, Dale J.

    2016-01-01

    The communications and navigation space infrastructure of the National Aeronautics and Space Administration (NASA) consists of a constellation of relay satellites (called Tracking and Data Relay Satellites (TDRS)) and a global set of ground stations to receive and deliver data to researchers around the world from mission spacecraft throughout the solar system. Planning is underway to enhance and transform the infrastructure over the coming decade. Key to the upgrade will be the simultaneous and efficient use of relay transponders to minimize cost and operations while supporting science and exploration spacecraft. Efficient use of transponders necessitates bandwidth efficient communications to best use and maximize data throughput within the allocated spectrum. Experiments conducted with NASA's Space Communication and Navigation (SCaN) Testbed on the International Space Station provides a unique opportunity to evaluate advanced communication techniques, such as bandwidth-efficient modulations, in an operational flight system. Demonstrations of these new techniques in realistic flight conditions provides critical experience and reduces the risk of using these techniques in future missions. Efficient use of spectrum is enabled by using high-order modulations coupled with efficient forward error correction codes. This paper presents a high-rate, bandwidth-efficient waveform operating over the 225 MHz Ka-band service of the TDRS System (TDRSS). The testing explores the application of Gaussian Minimum Shift Keying (GMSK), 2/4/8-phase shift keying (PSK) and 16/32- amplitude PSK (APSK) providing over three bits-per-second-per-Hertz (3 b/s/Hz) modulation combined with various LDPC encoding rates to maximize through- put. With a symbol rate of 200 M-band, coded data rates of 1000 Mbps were tested in the laboratory and up to 800 Mbps over the TDRS 225 MHz channel. This paper will present on the high-rate waveform design, channel characteristics, performance results

  20. Hedgehog pathway blockade with the cancer drug LDE225 disrupts taste organs and taste sensation.

    Science.gov (United States)

    Kumari, Archana; Ermilov, Alexandre N; Allen, Benjamin L; Bradley, Robert M; Dlugosz, Andrzej A; Mistretta, Charlotte M

    2015-02-01

    Taste sensation on the anterior tongue requires chorda tympani nerve function and connections with continuously renewing taste receptor cells. However, it is unclear which signaling pathways regulate the receptor cells to maintain chorda tympani sensation. Hedgehog (HH) signaling controls cell proliferation and differentiation in numerous tissues and is active in taste papillae and taste buds. In contrast, uncontrolled HH signaling drives tumorigenesis, including the common skin cancer, basal cell carcinoma. Systemic HH pathway inhibitors (HPIs) lead to basal cell carcinoma regression, but these drugs cause severe taste disturbances. We tested the hypothesis that taste disruption by HPIs reflects a direct requirement for HH signaling in maintaining taste organs and gustatory sensation. In mice treated with the HPI LDE225 up to 28 days, HH-responding cells were lost in fungiform papilla epithelium, and papillae acquired a conical apex. Taste buds were either absent or severely reduced in size in more than 90% of aberrant papillae. Taste bud remnants expressed the taste cell marker keratin 8, and papillae retained expression of nerve markers, neurofilament and P2X3. Chorda tympani nerve responses to taste stimuli were markedly reduced or absent in LDE225-treated mice. Responses to touch were retained, however, whereas cold responses were retained after 16 days of treatment but lost after 28 days. These data identify a critical, modality-specific requirement for HH signaling in maintaining taste papillae, taste buds and neurophysiological taste function, supporting the proposition that taste disturbances in HPI-treated patients are an on-target response to HH pathway blockade in taste organs. Copyright © 2015 the American Physiological Society.

  1. Preliminary Therapy Evaluation of 225Ac-DOTA-c(RGDyK) Demonstrates that Cerenkov Radiation Derived from 225Ac Daughter Decay Can Be Detected by Optical Imaging for In Vivo Tumor Visualization

    Science.gov (United States)

    Pandya, Darpan N.; Hantgan, Roy; Budzevich, Mikalai M.; Kock, Nancy D.; Morse, David L.; Batista, Izadora; Mintz, Akiva; Li, King C.; Wadas, Thaddeus J.

    2016-01-01

    The theranostic potential of 225Ac-based radiopharmaceuticals continues to increase as researchers seek innovative ways to harness the nuclear decay of this radioisotope for therapeutic and imaging applications. This communication describes the evaluation of 225Ac-DOTA-c(RGDyK) in both biodistribution and Cerenkov luminescence imaging (CLI) studies. Initially, La-DOTA-c(RGDyK) was prepared as a non-radioactive surrogate to evaluate methodologies that would contribute to an optimized radiochemical synthetic strategy and estimate the radioactive conjugate's affinity for αvβ3, using surface plasmon resonance spectroscopy. Surface plasmon resonance spectroscopy studies revealed the IC50 and Ki of La-DOTA-c(RGDyK) to be 33 ± 13 nM and 26 ± 11 nM, respectively, and suggest that the complexation of the La3+ ion to the conjugate did not significantly alter integrin binding. Furthermore, use of this surrogate allowed optimization of radiochemical synthesis strategies to prepare 225Ac-DOTA-c(RGDyK) with high radiochemical purity and specific activity similar to other 225Ac-based radiopharmaceuticals. This radiopharmaceutical was highly stable in vitro. In vivo biodistribution studies confirmed the radiotracer's ability to target αvβ3 integrin with specificity; specificity was detected in tumor-bearing animals using Cerenkov luminescence imaging. Furthermore, tumor growth control was achieved using non-toxic doses of the radiopharmaceutical in U87mg tumor-bearing nude mice. To our knowledge, this is the first report to describe the CLI of αvβ3+ tumors in live animals using the daughter products derived from 225Ac decay in situ. This concept holds promise to further enhance development of targeted alpha particle therapy. PMID:27022417

  2. 20 CFR 225.42 - Notice of the percentage amount of a cost-of-living increase.

    Science.gov (United States)

    2010-04-01

    ... THE RAILROAD RETIREMENT ACT PRIMARY INSURANCE AMOUNT DETERMINATIONS Cost-of-Living Increases § 225.42 Notice of the percentage amount of a cost-of-living increase. The percentage amount of the cost-of-living... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Notice of the percentage amount of a cost-of...

  3. The oxidation of 2,2,5-three methyl-6-spiro cyclo hexane di hydro pyranol-5(X CI)

    International Nuclear Information System (INIS)

    Nikitin, V.I.

    1961-01-01

    In this chapter of book author as a result of oxidation of 2,2,5-three methyl-6-spiro cyclo hexane di hydro pyranol-5 evolved acetone, cyclopentanone, formic acid, acetic acid, oxalic acid, α-oxi isobutyric acid and adipinic acids

  4. 24 CFR 21.225 - What actions must I take concerning employees who are convicted of drug violations in the workplace?

    Science.gov (United States)

    2010-04-01

    ... calendar days of learning about an employee's conviction, you must either— (1) Take appropriate personnel... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false What actions must I take concerning employees who are convicted of drug violations in the workplace? 21.225 Section 21.225 Housing and Urban...

  5. 20 CFR 30.225 - What are the criteria for eligibility for benefits under Part B of EEOICPA for certain uranium...

    Science.gov (United States)

    2010-04-01

    ... benefits under Part B of EEOICPA for certain uranium employees? 30.225 Section 30.225 Employees' Benefits... COMPENSATION PROGRAM ACT OF 2000, AS AMENDED Eligibility Criteria Eligibility Criteria for Certain Uranium... of EEOICPA for certain uranium employees? In order to be eligible for benefits under this section...

  6. Neutron capture therapy of epidermal growth factor (+) gliomas using boronated cetuximab (IMC-C225) as a delivery agent

    Energy Technology Data Exchange (ETDEWEB)

    Barth, Rolf F. E-mail: barth.1@osu.edu; Wu Gong; Yang Weilian; Binns, Peter J.; Riley, Kent J.; Patel, Hemant; Coderre, Jeffrey A.; Tjarks, Werner; Bandyopadhyaya, A.K.; Thirumamagal, B.T.S.; Ciesielski, Michael J.; Fenstermaker, Robert A

    2004-11-01

    Cetuximab (IMC-C225) is a monoclonal antibody directed against both the wild-type and mutant vIII isoform of the epidermal growth factor receptor (EGFR). The purpose of the present study was to evaluate the monoclonal antibody (MoAb), cetuximab, as a boron delivery agent for neutron capture therapy (NCT) of brain tumors. Twenty-four hours following intratumoral (i.t.) administration of boronated cetuximab (C225-G5-B{sub 1100}), the mean boron concentration in rats bearing either F98{sub EGFR} or F98{sub WT} gliomas were 92.3{+-}23.3 {mu}g/g and 36.5{+-}18.8 {mu}g/g, respectively. In contrast, the uptake of boronated dendrimer (G5-B{sub 1000}) was 6.7{+-}3.6 {mu}g/g. Based on its favorable in vivo uptake, C225-G5-B{sub 1100} was evaluated as a delivery agent for BNCT in F98{sub EGFR} glioma bearing rats. The mean survival time (MST) of rats that received C225-G5-B{sub 1100}, administered by convection enhanced delivery (CED), was 45{+-}3 d compared to 25{+-}3 d for untreated control animals. A further enhancement in MST to >59 d was obtained by administering C225-G5-B{sub 1100} in combination with i.v. boronophenylalanine (BPA). These data are the first to demonstrate the efficacy of a boronated MoAb for BNCT of an intracerebral (i.c.) glioma and are paradigmatic for future studies using a combination of boronated MoAbs and low molecular weight delivery agents.

  7. Machine Vision System for Characterizing the Electric Field for the 225 Ra EDM Experiment

    Science.gov (United States)

    Sanchez, Andrew

    2017-09-01

    If an atom or fundamental particle possesses an electric dipole moment (EDM), that would imply time-reversal violation. At our current capability, if an EDM is detected in such a particle, that would suggest the discovery of beyond the standard model (BSM) physics. The unique structure of 225 Ra makes its atomic EDM favorable in the BSM search. An upgraded Ra-EDM apparatus will increase experimental sensitivity and the target electric field of 150 kV/cm will more than double the electric field used in previous experiments. To determine the electric field, the potential difference and electrode separation distance must be known. The optical method I have developed is a high-precision, non-invasive technique to measure electrode separation without making contact with the sensitive electrode surfaces. A digital camera utilizes a bi-telecentric lens to reduce parallax error and produce constant magnification throughout the optical system, regardless of object distance. A monochrome LED backlight enhances sharpness of the electrode profile, reducing uncertainty in edge determination and gap width. A program utilizing an edge detection algorithm allows precise, repeatable measurement of the gap width to within 1% and measurement of the relative angle of the electrodes. This work (SAM, Ra EDM) is supported by Michigan State University. This work (REU Program) is supported by U.S. National Science Foundation under Grant Number #1559866.

  8. Properties of welded joints of 2,25Cr-1Mo steel with various carbon content

    International Nuclear Information System (INIS)

    Vornovitskij, I.N.; Brodetskaya, E.Z.; Pozdnyakova, A.S.

    1980-01-01

    Properties of welded joints of 2,25 Cr - 1 Mo steel pipelines with different carbon content are considered. It is shown that application of electrodes developed in some countries for welding permits in many cases to exclude heat treatment of welded joints owing to high ductility of weld deposited metal. To improve the ductility, it is necessary to limit both carbon content down to 0,03-0,06% and detrimental elements (sulfur, phosphorus). Heat affected zone hardness may be increased at the expense of carbon. Weld deposited metal possesses the highest long-term strength at the given test temperature; in this case long-term strength of welded joints and base metal is practically the same. The long-term strength of high-carbon steel is higher at the test temperature of 565 deg C as compared to mean-carbon and low-carbon steels, whose long-term strength is practically equal at this temperature. The long-term strength of high-carbon and mean-carbon steels is practically the same and higher as compared with low-carbon one at the test temperature of 510 deg C

  9. Production of charmonium states in 225 GeV/c pi-minus beryllium interactions

    International Nuclear Information System (INIS)

    Hahn, S.R.

    1983-01-01

    This thesis reports on the analysis of data obtained during the FNAL experiment E610. The Chicago Cyclotron Magnet Spectrometer was used to perform a study of the hadronic production of charmonium. A 225 GeV/c negative pion beam was incident on a beryllium target. The trigger required a dimuon signature which favored opposite sign muon pairs with a large combined p/sub tau/. A search was then made for chi mesons of the charmonium spectrum by combining J/psi mesons found in the dimuon spectrum with photons detected in a large lead glass shower detector. These events were used to determine the fraction of J/psis produced from chis. A psi(3685) signal seen in the dimuon spectrum was used to determine the fraction of J/psis resulting from psi(3685). Assuming that these are the only particles decaying to J/psi, we obtain the fraction of J/psis produced directly in hadronic collisions - 0.58 +- 0.09 - which is relevant to the production mechanism for charmonium in strong interactions

  10. Study of 225 deg C thermoluminescent of quartz inclusions extracted from cementitious building materials

    International Nuclear Information System (INIS)

    Campos, Simara S.; Almeida, Geangela M. de; Souza, Suzana O.

    2009-01-01

    Incidents of excessive exposure of the population to ionizing radiation could result from a nuclear explosion, the direct exposure to a source theft or loss or an accidental exposure to a source without shielding, for example. During these incidents the victims seldom are using individual protection equipment used in the measurement and control of the doses that were exposed. One of the ways found to the doses assessment due to exposure to this type of accident is the retrospective dosimetry, which determines the excessive doses of radiation exposure, whether chronological or acute, using common materials available in the public domain. The methodology for the application of retrospective dosimetry for thermoluminescence in buildings previously burned, as bricks, it is already well established. Interest is now turning to the use of cementitious building materials such as mortar and concrete to enlarge the scope of application. This study aimed to examine some of these materials and techniques for their possible application in the doses assessment from an accidental irradiation by thermoluminescence. For this the peak about 225 deg C of natural quartz and it extracted of mortar and concrete was certain your stability for the plateau and storage tests, and also the dependence of your luminescent intensity with radiation dose. Presenting a life relatively tans compared enough to that of the accumulation of natural and long radiation sign for dosimetric applications, besides other favorable characteristics, the mortar presented evidence that is possible for retrospective dosimetry through thermoluminescence. (author)

  11. Physical Protection of Nuclear Material and Nuclear Facilities (Implementation of INFCIRC/225/Revision 5). Implementing Guide

    International Nuclear Information System (INIS)

    2018-01-01

    This publication is the lead Implementing Guide in a suite of guidance on implementing the Nuclear Security Recommendations on Physical Protection of Nuclear Material and Nuclear Facilities (INFCIRC/225/Revision 5), IAEA Nuclear Security Series No. 13. It provides guidance and suggestions to assist States and their competent authorities in establishing, strengthening and sustaining their national physical protection regime and implementing the associated systems and measures, including operators’ physical protection systems. The structure of this publication is as follows. After this introduction, Section 2 describes the objectives of physical protection and the overall approach to managing the risks of the unauthorized removal of nuclear material and the sabotage of nuclear facilities. Section 3 provides guidance for the State and its competent authorities on the physical protection elements of the nuclear security regime; this guidance is based on the fundamental principles set out in the Recommendations publication. Section 4 provides guidance on the operator’s physical protection system and describes a systematic, integrated approach. Appendix I gives an annotated outline of the typical contents of an operator’s security plan. Appendix II provides similar guidance for the contingency plan. Appendix III provides a description of nuclear material aggregation that can be used to categorize nuclear material and determine the appropriate level of protection against unauthorized removal. Appendix IV presents a table of paragraph cross-references between the Recommendations publication and this Implementing Guide.

  12. Crystal structure of histone demethylase LSD1 and tranylcypromine at 2.25 A

    International Nuclear Information System (INIS)

    Mimasu, Shinya; Sengoku, Toru; Fukuzawa, Seketsu; Umehara, Takashi; Yokoyama, Shigeyuki

    2008-01-01

    Transcriptional activity and chromatin structure accessibility are correlated with the methylation of specific histone residues. Lysine-specific demethylase 1 (LSD1) is the first discovered histone demethylase, which demethylates Lys4 or Lys9 of histone H3, using FAD. Among the known monoamine oxidase inhibitors, tranylcypromine (Parnate) showed the most potent inhibitory effect on LSD1. Recently, the crystal structure of LSD1 and tranylcypromine was solved at 2.75 A, revealing a five-membered ring fused to the flavin of LSD1. In this study, we refined the crystal structure of the LSD1-tranylcypromine complex to 2.25 A. The five-membered ring model did not fit completely with the electron density, giving R work /R free values of 0.226/0.254. On the other hand, the N(5) adduct gave the lowest R work /R free values of 0.218/0.248, among the tested models. These results imply that the LSD1-tranylcypromine complex is not completely composed of the five-membered adduct, but partially contains an intermediate, such as the N(5) adduct

  13. Effect of cold work on decarburization of 2.25Cr-1Mo steel in high temperature sodium

    International Nuclear Information System (INIS)

    Aoki, Norichika; Yoshida, Eiichi; Wada, Yusaku.

    1994-01-01

    It is known that the mechanical properties of a 2.25Cr-1Mo steel deteriorated due to the decarburization during immersion in the melt sodium at high temperatures. In low-alloy steel as well as a 2.25Cr-1Mo steel, precipitation reactions of carbides are known to be accelerated by cold working and aging. Thus, it may be expected that cold working and aging effectively suppress the decarburization of the mechanical properties of a 2.25Cr-1Mo steel because the decarburization will be restrained owing to fixation of carbon as precipitates of the carbides. In the present article, effects of cold-working and heat treatments on the kinetics of the decarburization of a 2.25Cr-1Mo steel has been studied experimentally. The annealed, cold-rolled, and normalized and tempered specimens were immersed in the melt of sodium at 500, 600 and 700degC for 425, 437 and 432h, respectively. On the basis of the observations obtained from these specimens, the experiment was also carried out at 450, 500 and 550degC for 2270 and 5465h. The microstructures before and after the immersion were observed with optical and scanning electron microscopes. An average concentration of carbon in each specimen was analyzed by an inert gas fusion method. The carbides extracted from the specimens were identified by X-ray diffraction. At immersion temperatures of 450 and 500degC, a 10% reduction of the decarburization in thickness by cold-working is sufficiently effective for retardation of the decarburization at both 2270 and 5465h. Whereas, at 550degC, more than 30% reduction in thickness by cold-working is needed for it at 2270h but even 80% reduction in thickness by cold-working causes merely slight retardation of the decarburization at 5465h. (author)

  14. Combined equilibrium and non-equilibrium phosphorus segregation to grain boundaries in a 2.25Cr1Mo steel

    International Nuclear Information System (INIS)

    Song, S.-H.; Shen, D.-D.; Yuan, Z.-X.; Liu, J.; Xu, T.-D.; Weng, L.-Q.

    2003-01-01

    Grain boundary segregation of phosphorus in a P-doped 2.25Cr1Mo steel during ageing at 540 deg. C after quenching from 980 deg. C is examined by Auger electron spectroscopy. The segregation is a combined effect of equilibrium segregation and non-equilibrium segregation. The effect of phosphorus non-equilibrium segregation is to enhance the kinetics of its equilibrium segregation

  15. MAGNETICALLY DOMINATED PARALLEL INTERSTELLAR FILAMENTS IN THE INFRARED DARK CLOUD G14.225-0.506

    International Nuclear Information System (INIS)

    Santos, Fábio P.; Busquet, Gemma; Girart, Josep Miquel; Franco, Gabriel A. P.; Zhang, Qizhou

    2016-01-01

    The infrared dark cloud G14.225-0.506 (IRDC G14.2) displays a remarkable complex of parallel dense molecular filaments projected on the plane of the sky. Previous studies of dust emission and molecular lines have speculated whether magnetic fields could have played an important role in the formation of such elongated structures, which are hosts to numerous young stellar sources. In this work we have conducted a vast polarimetric survey at optical and near-infrared wavelengths in order to study the morphology of magnetic field lines in IRDC G14.2 through the observation of background stars. The orientation of interstellar polarization, which traces magnetic field lines, is perpendicular to most of the filamentary features within the cloud. Additionally, the larger-scale molecular cloud as a whole exhibits an elongated shape also perpendicular to magnetic fields. Estimates of magnetic field strengths indicate values in the range 320–550 μ G, which allow sub-alfvénic conditions, but do not prevent the gravitational collapse of hub–filament structures, which in general are close to the critical state. These characteristics suggest that magnetic fields played the main role in regulating the collapse from large to small scales, leading to the formation of series of parallel elongated structures. The morphology is also consistent with numerical simulations that show how gravitational instabilities develop when subjected to strong magnetic fields. Finally, the results corroborate the hypothesis that strong support from internal magnetic fields might explain why the cloud seems to be contracting on a timescale 2–3 times longer than what is expected from a free-fall collapse.

  16. MAGNETICALLY DOMINATED PARALLEL INTERSTELLAR FILAMENTS IN THE INFRARED DARK CLOUD G14.225-0.506

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Fábio P. [Department of Physics and Astronomy, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Busquet, Gemma; Girart, Josep Miquel [Institut de Ciències de l’Espai (CSIC-IEEC), Campus UAB, Carrer de Can Magrans, S/N E-08193 Bellaterra, Catalunya (Spain); Franco, Gabriel A. P. [Departamento de Física—ICEx—UFMG, Caixa Postal 702, 30.123-970 Belo Horizonte, MG (Brazil); Zhang, Qizhou, E-mail: fabiops@northwestern.edu, E-mail: busquet@ice.cat, E-mail: girart@ice.cat, E-mail: franco@fisica.ufmg.br, E-mail: qzhang@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, 60, Garden Street, Cambridge, MA 02138 (United States)

    2016-12-01

    The infrared dark cloud G14.225-0.506 (IRDC G14.2) displays a remarkable complex of parallel dense molecular filaments projected on the plane of the sky. Previous studies of dust emission and molecular lines have speculated whether magnetic fields could have played an important role in the formation of such elongated structures, which are hosts to numerous young stellar sources. In this work we have conducted a vast polarimetric survey at optical and near-infrared wavelengths in order to study the morphology of magnetic field lines in IRDC G14.2 through the observation of background stars. The orientation of interstellar polarization, which traces magnetic field lines, is perpendicular to most of the filamentary features within the cloud. Additionally, the larger-scale molecular cloud as a whole exhibits an elongated shape also perpendicular to magnetic fields. Estimates of magnetic field strengths indicate values in the range 320–550 μ G, which allow sub-alfvénic conditions, but do not prevent the gravitational collapse of hub–filament structures, which in general are close to the critical state. These characteristics suggest that magnetic fields played the main role in regulating the collapse from large to small scales, leading to the formation of series of parallel elongated structures. The morphology is also consistent with numerical simulations that show how gravitational instabilities develop when subjected to strong magnetic fields. Finally, the results corroborate the hypothesis that strong support from internal magnetic fields might explain why the cloud seems to be contracting on a timescale 2–3 times longer than what is expected from a free-fall collapse.

  17. Water availability and vulnerability of 225 large cities in the United States

    Science.gov (United States)

    Padowski, Julie C.; Jawitz, James W.

    2012-12-01

    This study presents a quantitative national assessment of urban water availability and vulnerability for 225 U.S. cities with population greater than 100,000. Here, the urban assessments account for not only renewable water flows, but also the extracted, imported, and stored water that urban systems access through constructed infrastructure. These sources represent important hydraulic components of the urban water supply, yet are typically excluded from water scarcity assessments. Results from this hydraulic-based assessment were compared to those obtained using a more conventional method that estimates scarcity solely based on local renewable flows. The inclusion of hydraulic components increased the mean availability to cities, leading to a significantly lower portion of the total U.S. population considered "at risk" for water scarcity (17%) than that obtained from the runoff method (47%). Water vulnerability was determined based on low-flow conditions, and smaller differences were found for this metric between at-risk populations using the runoff (66%) and hydraulic-based (54%) methods. The large increase in the susceptible population between the scarcity measures evaluated using the hydraulic method may better reconcile the seeming contradiction in the United States between perceptions of natural water abundance and widespread water scarcity. Additionally, urban vulnerability measures developed here were validated using a media text analysis. Vulnerability assessments that included hydraulic components were found to correlate with the frequency of urban water scarcity reports in the popular press while runoff-based measures showed no significant correlation, suggesting that hydraulic-based assessments provide better context for understanding the nature and severity of urban water scarcity issues.

  18. An analysis of international situation concerning nuclear security. Focused on the revision to INFCIRC/225/Rev.5

    International Nuclear Information System (INIS)

    Inamura, Tomoaki; Tanabe, Tomoyuki

    2011-01-01

    Since the September 11 attacks in 2001, counterterrorism measures have become not just domestic issues but critical issues that need international cooperation. Various nuclear security measures are in place as part of international counterterrorism measures. This report looks at the trend of international nuclear security measures to get implications for Japan, focusing on INFCIRC/225/Rev.5, an international guideline for physical protection of nuclear materials and nuclear facilities drawn up by IAEA. The observations of this report are as follows: 1) While legally binding nuclear security measures such as multilateral treaties and United Nations Security Council Resolutions impose minimum requirements on individual countries, the approaches led by IAEA or individual countries or private associations aim at more detailed consideration or information sharing to further improve nuclear security. 2) INFCIRC/225/Rev.5 comprises new concepts such as risk-based physical protection and nuclear security culture, as well as extended range of threats such as insiders or stand-off attacks and broader scope of measures to response. Japan should consider incorporation of INFCIRC/225/Rev.5 to its national laws and regulations putting in mind that it may have heavy influence and that Japan pledged to role leadership about nuclear security to international society. (author)

  19. Three-component synthesis of dialkyl 2-(alkylimino-methylene)3- (2,2,5-trimethyl-4,6-dioxo-1,3-dioxan-5-yl)-succinates.

    Science.gov (United States)

    Yavari, Issa; Zare, Hasan; Mohtat, Bita

    2006-05-01

    The adduct produced in the reaction between alkyl isocyanides and dialkyl acetylenedicarboxylates was trapped by 2,2,5-trimethyl-1,3-dioxane-4,6-dione (methyl Meldrum's acid), to afford highly functionalized ketenimines in good yields.

  20. Galaxy evolution in groups. NGC 3447/NGC 3447A: the odd couple in LGG 225

    Science.gov (United States)

    Mazzei, P.; Marino, A.; Rampazzo, R.; Plana, H.; Rosado, M.; Arias, L.

    2018-02-01

    Context. Local Group (LG) analogs (LGAs) are galaxy associations dominated by a few bright spirals reminiscent of the LG. The NGC 3447/NGC 3447A system is a member of the LGG 225 group, a nearby LGA. This system is considered a physical pair composed of an intermediate-luminosity late-type spiral, NGC 3447 itself, and an irregular companion, NGC 3447A, linked by a faint, short filament of matter. A ring-like structure in the NGC 3447 outskirts has been emphasised by Galaxy Evolution Explorer (GALEX) observations. Aims: This work aims to contribute to the study of galaxy evolution in low-density environments, a favourable habitat to highly effective encounters, shedding light on the evolution of the NGC 3447/NGC 3447A system. Methods: We performed a multi-λ analysis of the surface photometry of this system to derive its spectral energy distribution and structural properties using ultraviolet (UV), Swift UVOT, and optical Sloan Digital Sky Survey (SDSS) images complemented with available far-IR observations. We also characterised the velocity field of the pair using two-dimensional Hα kinematical observations of the system obtained with PUMA Fabry-Perot interferometer at the 2.1 m telescope of San Pedro Mártir (Mexico). All these data are used to constrain smooth particle hydrodynamic simulations with chemo-photometric implementation to shed light on the evolution of this system. Results: The luminosity profiles, from UV to optical wavelengths, are all consistent with the presence of a disc extending and including NGC 3447A. The overall velocity field does not emphasise any significant rotation pattern, rather a small velocity gradient between NGC 3447 and NGC 3447A. Our simulation, detached from a large grid explored to best-fit the global properties of the system, suggests that this arises from an encounter between two halos of equal mass. Conclusions: NGC 3447 and NGC 3447A belong to the same halo, NGC 3447A being a substructure of the same disk including NGC

  1. Efficacy of the National Football League-225 Test to Track Changes in One Repetition Maximum Bench Press After Training in National Collegiate Athletic Association Division IA Football Players.

    Science.gov (United States)

    Mann, J Bryan; Ivey, Pat A; Stoner, Josh D; Mayhew, Jerry L; Brechue, William F

    2015-11-01

    Numerous investigations have attested to the efficacy of the National Football League (NFL)-225 test to estimate one repetition maximum (1RM) bench press. However, no studies have assessed the efficacy of the test to track changes in strength across a training program. The purpose of this study was to determine the accuracy of the NFL-225 test for determining the change in 1RM bench press in National Collegiate Athletic Association Division IA college football players after training. Over a 4-year period, players (n = 203) were assessed before and after a 6-week off-season resistance program for 1RM bench press and repetitions completed with 102.3 kg (225 lbs). Test sessions typically occurred within 1 week of each other. Players significantly increased 1RM by 4.2 ± 8.6 kg and NFL-225 repetitions by 0.9 ± 2.3, although the effect size (ES) for each was trivial (ES = 0.03 and 0.07, respectively). National Football League 225 prediction equations had higher correlations with 1RM before training (intraclass correlation coefficient [ICC] = 0.95) than after training (ICC = 0.75). The correlation between the change in NFL-225 repetitions and change in 1RM was low and negative (r = -0.22, p bench press strength after short-term training.

  2. HYC-24L Demonstrates Greater Effectiveness With Less Pain Than CPM-22.5 for Treatment of Perioral Lines in a Randomized Controlled Trial.

    Science.gov (United States)

    Butterwick, Kimberly; Marmur, Ellen; Narurkar, Vic; Cox, Sue Ellen; Joseph, John H; Sadick, Neil S; Tedaldi, Ruth; Wheeler, Sarah; Kolodziejczyk, Julia K; Gallagher, Conor J

    2015-12-01

    This trial compares the effectiveness and safety of HYC-24L (Juvéderm Ultra XC; Allergan plc, Dublin, Ireland) (24 mg/mL of hyaluronic acid, 0.3% lidocaine) and CPM-22.5 (Belotero Balance; Merz Aesthetics, Raleigh, NC) (22.5 mg/mL of hyaluronic acid) for the treatment of perioral lines. Men and women aged 35 years or older with moderate-to-severe perioral lines were recruited for this randomized controlled, rater-blinded, 2-arm trial. The primary endpoint was a comparison of rater-assessed responder rates by the validated 4-point Perioral Lines Severity Scale at Month 6; responders were those who showed a ≥1 point improvement. A secondary endpoint was subject-assessed change in perioral lines measured by the Global Assessment of Change Scale. A total of 136 subjects received treatment and 132 completed the trial (mean age: 58 ± 8 years). Total volume injected was 1.18 mL (HYC-24L) and 1.32 mL (CPM-22.5). At Month 6, a significantly greater proportion of HYC-24L subjects responded to treatment (87%) than CPM-22.5 subjects (72%) (p CPM-22.5 subjects, with the greatest difference at Month 6. No unexpected adverse events occurred. HYC-24L subjects showed a higher response rate and a greater improvement in their perioral lines than CPM-22.5 subjects for up to 6 months.

  3. Design, synthesis and biological evaluation of new hybrid anticonvulsants derived from N-benzyl-2-(2,5-dioxopyrrolidin-1-yl)propanamide and 2-(2,5-dioxopyrrolidin-1-yl)butanamide derivatives.

    Science.gov (United States)

    Kamiński, Krzysztof; Rapacz, Anna; Łuszczki, Jarogniew J; Latacz, Gniewomir; Obniska, Jolanta; Kieć-Kononowicz, Katarzyna; Filipek, Barbara

    2015-05-15

    The purpose of this study was to synthesize the library of 33 new N-benzyl-2-(2,5-dioxopyrrolidin-1-yl)propanamides, 2-(3-methyl-2,5-dioxopyrrolidin-1-yl)propanamides, and 2-(2,5-dioxopyrrolidin-1-yl)butanamides as potential new hybrid anticonvulsant agents. These hybrid molecules join the chemical fragments of well-known antiepileptic drugs (AEDs) such as ethosuximide, levetiracetam, and lacosamide. The coupling reaction of the 2-(2,5-dioxopyrrolidin-1-yl)propanoic acid, 2-(3-methyl-2,5-dioxopyrrolidin-1-yl)propanoic acid, or 2-(2,5-dioxopyrrolidin-1-yl)butanoic acid with the appropriately substituted benzylamines in the presence of the coupling reagent, N,N-carbonyldiimidazole (CDI) generated the final compounds 4-36. Spectral data acquired via (1)H NMR, (13)C NMR, and LC-MS confirmed the chemical structures of the newly prepared compounds. The initial anticonvulsant screening was performed in mice intraperitoneally (ip), using the maximal electroshock seizure (MES) and subcutaneous pentylenetetrazole (scPTZ) seizure tests. The rotarod test determined the acute neurological toxicity (NT). The results of preliminary pharmacological screening revealed that 25 compounds showed protection in half or more of the animals tested in the MES and/or scPTZ seizure models at the fixed dose of 100mg/kg. The broad spectra of activity across the preclinical seizure models displayed compounds 4, 7, 8, 13, 15-18, 24, and 26. The quantitative pharmacological studies in mice demonstrated the highest protection for compounds 4 (ED50 MES=67.65 mg/kg, ED50scPTZ=42.83 mg/kg); 8 (ED50 MES=54.90 mg/kg, ED50scPTZ=50.29 mg/kg); and 20 (ED50scPTZ=47.39 mg/kg). These compounds were distinctly more potent and provided better safety profiles in the rotarod test compared to valproic acid or ethosuximide, which were used as model AEDs. Compound 8 underwent only a slight metabolic change by the human liver microsomes (HLMs), and also did not affect the activity of human cytochrome P450 isoform

  4. Nuclear Security Recommendations on Physical Protection of Nuclear Material and Nuclear Facilities (INFCIRC/225/Revision 5). Recommendations (Spanish Edition); Recomendaciones de Seguridad Fisica Nuclear sobre la Proteccion Fisica de los Materiales y las Instalaciones Nucleares (INFCIRC/225/Rev.5). Recomendaciones

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-06-15

    This publication, Revision 5 of Physical Protection of Nuclear Material and Nuclear Facilities (INFCIRC/225), is intended to provide guidance to States and their competent authorities on how to develop or enhance, implement and maintain a physical protection regime for nuclear material and nuclear facilities, through the establishment or improvement of their capabilities to implement legislative and regulatory programmes. The recommendations presented in this publication reflect a broad consensus among IAEA Member States on the requirements which should be met for the physical protection of nuclear materials and nuclear facilities.

  5. Guidance and considerations for the implementation of INFCIRC/225/Rev.4, the physical protection of nuclear material and nuclear facilities

    International Nuclear Information System (INIS)

    2000-05-01

    This publication is intended to provide guidance and considerations for a State's competent authority to better understand and prescribe appropriate requirements, consistent with INFCIRC/225/Rev.4 for the protection of nuclear material and nuclear facilities which are compatible with accepted international practice. This report, together with a more detailed report, Handbook on the Physical Protection of Nuclear Material and Facilities, which addresses to the licencee or designer of physical protection systems who has specific implementation and compliance responsibilities, should be used in conjunction to each other to provide better and comprehensive guidance on physical protection

  6. Accurate and precise determination of 2-25mg amounts of uranium by means of a special automatic potentiometric titration

    International Nuclear Information System (INIS)

    Slanina, J.; Bakker, F.; Groen, A.J.P.; Lingerak, W.A.

    1978-01-01

    A precise and accurate potentiometric titration of 2-25 mg of uranium is described. The uranium is reduced to U(IV) according to the method of Eberle et al. [3], and titrated with 0.05 N potassium dichromate, using a platinum indicator electrode. During the sample preparation the walls of the titration vessel are cleaned by centrifugation. To avoid overshoot of the set point a special differentiator is described, that interrupts the titration until equilibrium is reached. The precision of the method is 0.02%, the accuracy is better than 0.04% rel. Each titration takes 5 min. (orig.) [de

  7. Guidance and considerations for the implementation of INFCIRC/225/Rev.4, the physical protection of nuclear material and nuclear facilities

    International Nuclear Information System (INIS)

    2002-05-01

    This publication is intended to provide guidance and considerations for a State's competent authority to better understand and prescribe appropriate requirements, consistent with INFCIRC/225/Rev.4 for the protection of nuclear material and nuclear facilities which are compatible with accepted international practice. This report, together with a more detailed report, Handbook on the Physical Protection of Nuclear Material and Facilities, which addresses to the licensee or designer of physical protection systems who has specific implementation and compliance responsibilities, should be used in conjunction to each other to provide better and comprehensive guidance on physical protection

  8. Nuclear Security Recommendations on Physical Protection of Nuclear Material and Nuclear Facilities (INFCIRC/225/Revision 5): Recommendations

    International Nuclear Information System (INIS)

    2011-01-01

    This publication, Revision 5 of Physical Protection of Nuclear Material and Nuclear Facilities (INFCIRC/225), is intended to provide guidance to States and their competent authorities on how to develop or enhance, implement and maintain a physical protection regime for nuclear material and nuclear facilities, through the establishment or improvement of their capabilities to implement legislative and regulatory programmes. The recommendations presented in this publication reflect a broad consensus among IAEA Member States on the requirements which should be met for the physical protection of nuclear materials and nuclear facilities.

  9. Development of Cr{sub 3}C{sub 2}-25(Ni20Cr) nanostructured coatings; Desenvolvimento de revestimentos nanostruturados de Cr{sub 3}C{sub 2}-25(Ni20Cr)

    Energy Technology Data Exchange (ETDEWEB)

    Cunha, Cecilio Alvares da

    2012-07-01

    This study is divided in two parts. The first part is about the preparation of nanostructured Cr{sub 3}C{sub 2}-25(Ni20Cr) powders by high energy milling followed by characterization of the milled and the as received powder. Analyses of some of the data obtained were done using a theoretical approach. The second part of this study is about the preparation and characterization of coatings prepared with the nanostructured as well as the as received Cr{sub 3}C{sub 2}-25(Ni20Cr) powders. The high temperature erosion-oxidation (E-O) behavior of the coatings prepared with the two types of powders has been compared based on a technological approach. The average crystallite size of the Cr{sub 3}C{sub 2}-25(Ni20Cr) powder decreased rapidly from 145 nm to 50 nm in the initial stages of milling and thereafter decreased slowly to a steady state value of around 10 nm with further increase in milling time. This steady state corresponds to the beginning of a dynamic recovery process. The maximum lattice strain ({epsilon} = 1,17%) was observed in powders milled for 16 hours, and this powders critical crystallite size was 28 nm. In contrast, the lattice parameter attained a minimum for powders milled for 16 hours. Upon reaching the critical crystallite size, the dislocation density attained a steady state regime and all plastic deformation introduced in the material there after was in the form of events occurring at the grain boundaries, due mainly to grain boundary sliding. The deformation energy stored in the crystal lattice of the Cr{sub 3}C{sub 2}-25(Ni20Cr) powders milled for different times was determined from enthalpy variation measurements. These results indicated that the maximum enthalpy variation ({delta}H = 722 mcal) also occurred for powders milled for 16 hours. In a similar manner, the maximum specific heat variation ({delta}C{sub p} = 0,278 cal/gK) occurred for powders milled for 16 hours. The following mechanical properties of Cr{sub 3}C{sub 2}-25(Ni20Cr) coatings

  10. Fe2.25W0.75O4/reduced graphene oxide nanocomposites for novel bifunctional photocatalyst: One-pot synthesis, magnetically recyclable and enhanced photocatalytic property

    International Nuclear Information System (INIS)

    Guo, Jinxue; Jiang, Bin; Zhang, Xiao; Zhou, Xiaoyu; Hou, Wanguo

    2013-01-01

    Fe 2.25 W 0.75 O 4 /reduced graphene oxide (RGO) composites were prepared for application of novel bifunctional photocatalyst via simple one-pot hydrothermal method, employing graphene oxide (GO), Na 2 WO 4 , FeSO 4 and sodium dodecyl benzene sulfonate (SDBS) as the precursors. Transmission electron microscope (TEM) results indicate that the well-dispersed Fe 2.25 W 0.75 O 4 nanoparticles were deposited on the surface of RGO sheets homogeneously. Magnetic characterization reveals that Fe 2.25 W 0.75 O 4 and Fe 2.25 W 0.75 O 4 /RGO show ferromagnetic behaviors. So this novel bifunctional photocatalyst could achieve magnetic separation and collection with the aid of external magnet. The composites exhibit enhanced photocatalytic performance on degradation of methyl orange (MO) compared with pure Fe 2.25 W 0.75 O 4 under low-power ultraviolet light irradiation due to the introduction of RGO. Moreover, this hybrid catalyst possesses long-term excellent photocatalytic performance due to its good thermal stability. This bifunctional photocatalyst, which combines magnetic property and excellent photocatalytic activity, would be a perfect candidate in applications of catalytic elimination of environmental pollutants and other areas. - Graphical abstract: Magnetically recyclable Fe 2.25 W 0.75 O 4 /reduced graphene oxide nanocomposites with enhanced photocatalytic property Display Omitted - Highlights: ●Fe 2.25 W 0.75 O 4 growth, deposition and GO reduction occurred simultaneously. ●Composite possessed ferromagnetic and enhanced photocatalytic properties. ●Composite is utilized as a magnetically separable and high-efficient photocatalyst. ●Photocatalyst showed good photocatalytic and thermal stability during cyclic use

  11. Boronated monoclonal antibody 225.28S for potential use in neutron capture therapy of malignant melanoma

    International Nuclear Information System (INIS)

    Tamat, S.R.; Moore, D.E.; Patwardhan, A.; Hersey, P.

    1989-01-01

    The concept of conjugating boron cluster compounds to monoclonal antibodies has been examined by several groups of research workers in boron neutron capture therapy (BNCT). The procedures reported to date for boronation of monoclonal antibodies resulted in either an inadequate level of boron incorporation, the precipitation of the conjugates, or a loss of immunological activity. The present report describes the conjugation of dicesium-mercapto-undecahydrododecaborate (Cs2B12H11SH) to 225.28S monoclonal antibody directed against high molecular weight melanoma-associated antigens (HMW-MAA), using poly-L-ornithine as a bridge to increase the carrying capacity of the antibody and to minimize change in the conformational structure of antibody. The method produces a boron content of 1,300 to 1,700 B atoms per molecule 225.28S while retaining the immunoreactivity. Characterization in terms of the homogeneity of the conjugation of the boron-monoclonal antibody conjugates has been studied by gel electrophoresis and ion-exchange HPLC

  12. Aromatic oxygen compounds boiling from 180/sup 0/ to 225/sup 0/ from acid oils in low-temperature tar

    Energy Technology Data Exchange (ETDEWEB)

    Jaeger, A; Kattwinkel, G

    1950-01-01

    To determine the composition of the Krupp-Lurgi low-temperature coal tar and to develop methods for isolating the various compounds, a quantitative investigation was made of the dry tar acid mixture. The aromatic O compounds boiling up to 225/sup 0/ were secured by fractionation with one of the several columns that are described. Large volumes of tar were fractionated under vacuum in an apparatus with a 10-liter flask, electrically heated, and provided with a fractionating column (packed) with a jacket supplied by recirculated oil, externally heated. Large volumes were fractionated to give sufficient quantities of the O compounds. The method of fractional extraction, not described herein, made the separation of the acid oils by fractional distillation much easier. The aromatic O compounds present in greatest proportion are relatively easily isolated; those present in small quantities and more difficult to separate can be removed as a mixture, which can be hydrogenated directly to solvents. Phenols and cresols are formed in about equal fractions in low-temperature carbonization. Of the various xylenols, the sym-xylenol is present to the greatest extent. O compounds with longer side chains than C/sub 2/ were present only to a very slight extent. At the temperature of formation of these tars, side chains of three or more C atoms formed closed ring compounds (indan derivatives, etc.). Little change appears to occur up to 225/sup 0/ in the fractionation of these acid oils.

  13. Improving the Optical Trapping Efficiency in the 225Ra Electric Dipole Moment Experiment via Monte Carlo Simulation

    Science.gov (United States)

    Fromm, Steven

    2017-09-01

    In an effort to study and improve the optical trapping efficiency of the 225Ra Electric Dipole Moment experiment, a fully parallelized Monte Carlo simulation of the laser cooling and trapping apparatus was created at Argonne National Laboratory and now maintained and upgraded at Michigan State University. The simulation allows us to study optimizations and upgrades without having to use limited quantities of 225Ra (15 day half-life) in experiment's apparatus. It predicts a trapping efficiency that differs from the observed value in the experiment by approximately a factor of thirty. The effects of varying oven geometry, background gas interactions, laboratory magnetic fields, MOT laser beam configurations and laser frequency noise were studied and ruled out as causes of the discrepancy between measured and predicted values of the overall trapping efficiency. Presently, the simulation is being used to help optimize a planned blue slower laser upgrade in the experiment's apparatus, which will increase the overall trapping efficiency by up to two orders of magnitude. This work is supported by Michigan State University, the Director's Research Scholars Program at the National Superconducting Cyclotron Laboratory, and the U.S. DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  14. Therapeutic efficacy and toxicity of {sup 225}Ac-labelled vs. {sup 213}Bi-labelled tumour-homing peptides in a preclinical mouse model of peritoneal carcinomatosis

    Energy Technology Data Exchange (ETDEWEB)

    Essler, Markus; Gaertner, Florian C.; Blechert, Birgit; Senekowitsch-Schmidtke, Reingard; Seidl, Christof [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Neff, Frauke [Helmholtz Zentrum Muenchen, Institute of Pathology, Neuherberg (Germany); Bruchertseifer, Frank; Morgenstern, Alfred [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)

    2012-04-15

    Targeted delivery of alpha-particle-emitting radionuclides is a promising novel option in cancer therapy. We generated stable conjugates of the vascular tumour-homing peptide F3 both with {sup 225}Ac and {sup 213}Bi that specifically bind to nucleolin on the surface of proliferating tumour cells. The aim of our study was to determine the therapeutic efficacy of {sup 225}Ac-DOTA-F3 in comparison with that of {sup 213}Bi-DTPA-F3. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were determined via clonogenic assays. The therapeutic efficacy of both constructs was assayed by repeated treatment of mice bearing intraperitoneal MDA-MB-435 xenograft tumours. Therapy was monitored by bioluminescence imaging. Nephrotoxic effects were analysed by histology. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were 53 kBq/ml and 67 Bq/ml, respectively. The median survival of control mice treated with phosphate-buffered saline was 60 days after intraperitoneal inoculation of 1 x 10{sup 7} MDA-MB-435 cells. Therapy with 6 x 1.85 kBq of {sup 225}Ac-DOTA-F3 or 6 x 1.85 MBq of {sup 213}Bi-DTPA-F3 prolonged median survival to 95 days and 97 days, respectively. While F3 labelled with short-lived {sup 213}Bi (t{sub 1/2} 46 min) reduced the tumour mass at early time-points up to 30 days after treatment, the antitumour effect of {sup 225}Ac-DOTA-F3 (t{sub 1/2} 10 days) increased at later time-points. The difference in the fraction of necrotic cells after treatment with {sup 225}Ac-DOTA-F3 (43%) and with {sup 213}Bi-DTPA-F3 (36%) was not significant. Though histological analysis of kidney samples revealed acute tubular necrosis and tubular oedema in 10-30% of animals after treatment with {sup 225}Ac-DOTA-F3 or {sup 213}Bi-DTPA-F3, protein casts were negligible (2%), indicating only minor damage to the kidney. Therapy with both {sup 225}Ac-DOTA-F3 and {sup 213}Bi-DTPA-F3 increased survival of mice with peritoneal carcinomatosis. Mild renal toxicity of both

  15. The effects of minor alloy modifications and heat treatment on the microstructure and creep rupture behavior of 2.25Cr-1Mo Steel

    International Nuclear Information System (INIS)

    Todd, J.A.; Chung, D.W.; Parker, E.R.

    1983-01-01

    The effects of alloy additions on the microstructure of simulated cooled and tempered 2.25Cr-1Mo steels have been studied using transmission electron microscopy. Carbide precipitation sequences have been identified in the modification 3Cr-1Mo-1Mn-1Ni and compared to those in 2.25Cr-1Mo steels modified with Mn and Ni and also with Ti, V and B. The influence of minor compositional changes on the creep rupture behavior of 2.25Cr-1Mo steel has been studied at 500 C, 560 C, and 600 C. The most significant effect of alloy modifications on creep properties resulted from additions of Mn and Cr. Preliminary studies show that 1% Mn and 0.5Mn + 1Ni + 0.75Cr additions significantly reduce creep strength at all three temperatures for tests up to 2000 hours duration. The 3Cr-1Mo-1Mn-1Ni steel showed improvements in rupture ductility at all temperatures when compared with the base 2.25Cr-1Mo steel and the manganese-nickel modifications. Plots of the Larson-Miller parameter for both these modifications lay within the scatter band for commercial 2.25Cr-1Mo steels

  16. Cyclic and isothermal oxidation behavior of 2.25Cr-1Mo steel; Estudio del comportamiento del acero 2.25Cr-1Mo frente a los fenomenos de oxidacion ciclica e isoterma

    Energy Technology Data Exchange (ETDEWEB)

    Proy, M.; Utrilla, M. v.; Otero, E.

    2014-04-01

    Cyclic and isothermal oxidation of chromium-molybdenum steel 2.25Cr-1Mo were analyzed at 550 degree centigrade and 650 degree centigrade during 360 hours in air atmospheres. The cycles were performed with two stages; one of heating in furnace during 90 minutes and then the sample were cooled to 50 degree centigrade by air flow. Thermogravimetric analyses were performed to obtain high temperature corrosion kinetics. Several characterization techniques have been used to identify the corrosion mechanism, as X-Ray Diffraction (XRD), Optical Microscopy (OM) and Scanning Electron Microscopy (SEM). Thermal cycling tests can changes the corrosion mechanism, due cracks propagation in oxide scale, that witch can favors the access of oxidant agent to the substrate. (Author)

  17. MC225, a Novel Probe for P-glycoprotein PET Imaging at the Blood-brain Barrier: In Vitro Cardiovascular Safety Evaluation.

    Science.gov (United States)

    Fusi, Fabio; Durante, Miriam; Gorelli, Beatrice; Perrone, Maria Grazia; Colabufo, Nicola Antonio; Saponara, Simona

    2017-12-01

    The P-glycoprotein (P-gp) substrate MC225, at concentrations ≤10 nM, is a valuable radiotracer for positron emission tomography imaging of P-gp function in rats and mice. The aim of this study was to evaluate its potential toxic hazard toward the cardiovascular system through an in-depth analysis of its effects on rat aorta rings, on CaV1.2 channel current (ICa1.2) of A7r5 cells and on Langendorff-perfused rat heart. In aortic rings, MC225 relaxed phenylephrine-induced contraction in a concentration-dependent and endothelium-independent manner, with an IC50 value of about 1 μM. At concentrations ≥3 μM, it antagonized the response to cumulative concentrations of K. MC225, 1 and 10 μM, inhibited ICa1.2 by 15% and 31%, respectively, without affecting either current activation or inactivation kinetics. In Langendorff-perfused rat hearts, only 10 μM MC225 significantly decreased left ventricular pressure and increased coronary perfusion pressure while reducing heart rate and prolonging the cardiac cycle length as well as the atrioventricular conduction time (PQ interval) on the electrocardiogram. Lower concentrations of the drug were ineffective. These findings demonstrate that MC225-induced cardiovascular effects took place at concentrations that are at least 2 orders of magnitude higher than those allowing in vivo measurement of P-gp function. Therefore, MC225 represents a promising positron emission tomography tool for in vivo straightforward P-gp quantification.

  18. A short gamma-ray burst apparently associated with an elliptical galaxy at redshift z = 0.225.

    Science.gov (United States)

    Gehrels, N; Sarazin, C L; O'Brien, P T; Zhang, B; Barbier, L; Barthelmy, S D; Blustin, A; Burrows, D N; Cannizzo, J; Cummings, J R; Goad, M; Holland, S T; Hurkett, C P; Kennea, J A; Levan, A; Markwardt, C B; Mason, K O; Meszaros, P; Page, M; Palmer, D M; Rol, E; Sakamoto, T; Willingale, R; Angelini, L; Beardmore, A; Boyd, P T; Breeveld, A; Campana, S; Chester, M M; Chincarini, G; Cominsky, L R; Cusumano, G; de Pasquale, M; Fenimore, E E; Giommi, P; Gronwall, C; Grupe, D; Hill, J E; Hinshaw, D; Hjorth, J; Hullinger, D; Hurley, K C; Klose, S; Kobayashi, S; Kouveliotou, C; Krimm, H A; Mangano, V; Marshall, F E; McGowan, K; Moretti, A; Mushotzky, R F; Nakazawa, K; Norris, J P; Nousek, J A; Osborne, J P; Page, K; Parsons, A M; Patel, S; Perri, M; Poole, T; Romano, P; Roming, P W A; Rosen, S; Sato, G; Schady, P; Smale, A P; Sollerman, J; Starling, R; Still, M; Suzuki, M; Tagliaferri, G; Takahashi, T; Tashiro, M; Tueller, J; Wells, A A; White, N E; Wijers, R A M J

    2005-10-06

    Gamma-ray bursts (GRBs) come in two classes: long (> 2 s), soft-spectrum bursts and short, hard events. Most progress has been made on understanding the long GRBs, which are typically observed at high redshift (z approximately 1) and found in subluminous star-forming host galaxies. They are likely to be produced in core-collapse explosions of massive stars. In contrast, no short GRB had been accurately (burst GRB 050509B. Its position on the sky is near a luminous, non-star-forming elliptical galaxy at a redshift of 0.225, which is the location one would expect if the origin of this GRB is through the merger of neutron-star or black-hole binaries. The X-ray afterglow was weak and faded below the detection limit within a few hours; no optical afterglow was detected to stringent limits, explaining the past difficulty in localizing short GRBs.

  19. Low cycle fatigue of 2.25Cr1Mo steel with tensile and compressed hold loading at elevated temperature

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Junfeng; Yu, Dunji; Zhao, Zizhen; Zhang, Zhe; Chen, Gang; Chen, Xu, E-mail: xchen@tju.edu.cn

    2016-06-14

    A series of uniaxial strain-controlled fatigue and creep-fatigue tests of the bainitic 2.25Cr1Mo steel forging were performed at 455 °C in air. Three different hold periods (30 s, 120 s, 300 s) were employed at maximum tensile strain and compressive strain under fully reversed strain cycling. Both tensile and compressive holds significantly reduce the fatigue life. Fatigue life with tensile hold is shorter than that with compressive hold. A close relationship is found between the reduction of fatigue life and the amount of stress relaxation. Microstructural examination by scanning electron microscope reveals that strain hold introduces more crack sources, which can be probably ascribed to the intensified oxidation and the peeling-off of oxide layers. A modified plastic strain energy approach considering stress relaxation effect is proposed to predict the creep-fatigue life, and the predicted lives are in superior agreement with the experimental results.

  20. Elliott wave principle and the corresponding fractional Brownian motion in stock markets: Evidence from Nikkei 225 index

    International Nuclear Information System (INIS)

    Ilalan, Deniz

    2016-01-01

    Highlights: • Hausdorff dimension of the Elliott Wave trajectories is computed. • Linkage between Elliott Wave principle and fractional Brownian motion is proposed. • Log-normality of stock returns is discussed from a fractal point of view. - Abstract: This paper examines one of the vital technical analysis indicators known as the Elliott wave principle. Since these waves have a fractal nature with patterns that are not exact, we first determine the dimension of them. Our second aim is to find a linkage between Elliott wave principle and fractional Brownian motion via comparing their Hausdorff dimensions. Thirdly, we consider the Nikkei 225 index during Japan asset price bubble, which is a perfect example of an Elliott wave.

  1. Results of the independent verification of radiological remedial action at 225 South 2nd East Street, Monticello, Utah (MS00114)

    International Nuclear Information System (INIS)

    Crutcher, J.W.; Smuin, M.W.

    1989-12-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 225 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  2. The effect of hydrostatic pressure on the creep life of a 2.25% Cr1% Mo Steel

    International Nuclear Information System (INIS)

    Lonsdale, D.; Flewitt, P.E.J.

    1979-01-01

    The effect of superimposed hydrostatic pressures on the creep life of a 2.25% Cr 1% Mo steel, with a bainitic microstructure, is examined. Creep tests have been carried out at 923K with uniaxial stresses in the range 55 to 80 MPa and superimposed hydrostatic pressures up to 35 MPa. Optical and scanning electron microscopy have been used to evaluate the contribution of the hydrostatic stress to grain boundary cavitation. Increasing the hydrostatic pressure for a given uniaxial stress suppresses cavitation, but little changes the secondary creep rate, thereby excending the creep life. Furthermore, the time to failure depends on both the applied uniaxial stress and the hydrostatic pressure and not simply the principal stress. (orig.) [de

  3. Tracing the route of modern humans out of Africa by using 225 human genome sequences from Ethiopians and Egyptians.

    Science.gov (United States)

    Pagani, Luca; Schiffels, Stephan; Gurdasani, Deepti; Danecek, Petr; Scally, Aylwyn; Chen, Yuan; Xue, Yali; Haber, Marc; Ekong, Rosemary; Oljira, Tamiru; Mekonnen, Ephrem; Luiselli, Donata; Bradman, Neil; Bekele, Endashaw; Zalloua, Pierre; Durbin, Richard; Kivisild, Toomas; Tyler-Smith, Chris

    2015-06-04

    The predominantly African origin of all modern human populations is well established, but the route taken out of Africa is still unclear. Two alternative routes, via Egypt and Sinai or across the Bab el Mandeb strait into Arabia, have traditionally been proposed as feasible gateways in light of geographic, paleoclimatic, archaeological, and genetic evidence. Distinguishing among these alternatives has been difficult. We generated 225 whole-genome sequences (225 at 8× depth, of which 8 were increased to 30×; Illumina HiSeq 2000) from six modern Northeast African populations (100 Egyptians and five Ethiopian populations each represented by 25 individuals). West Eurasian components were masked out, and the remaining African haplotypes were compared with a panel of sub-Saharan African and non-African genomes. We showed that masked Northeast African haplotypes overall were more similar to non-African haplotypes and more frequently present outside Africa than were any sets of haplotypes derived from a West African population. Furthermore, the masked Egyptian haplotypes showed these properties more markedly than the masked Ethiopian haplotypes, pointing to Egypt as the more likely gateway in the exodus to the rest of the world. Using five Ethiopian and three Egyptian high-coverage masked genomes and the multiple sequentially Markovian coalescent (MSMC) approach, we estimated the genetic split times of Egyptians and Ethiopians from non-African populations at 55,000 and 65,000 years ago, respectively, whereas that of West Africans was estimated to be 75,000 years ago. Both the haplotype and MSMC analyses thus suggest a predominant northern route out of Africa via Egypt. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  4. UNVEILING A NETWORK OF PARALLEL FILAMENTS IN THE INFRARED DARK CLOUD G14.225–0.506

    International Nuclear Information System (INIS)

    Busquet, Gemma; Zhang, Qizhou; Ho, Paul T. P.; Palau, Aina; Girart, Josep M.; Liu, Hauyu Baobab; Sánchez-Monge, Álvaro; Estalella, Robert; De Gregorio-Monsalvo, Itziar; Pillai, Thushara; Wyrowski, Friedrich; Santos, Fábio P.; Franco, Gabriel A. P.

    2013-01-01

    We present the results of combined NH 3 (1,1) and (2,2) line emission observed with the Very Large Array and the Effelsberg 100 m telescope of the infrared dark cloud G14.225–0.506. The NH 3 emission reveals a network of filaments constituting two hub-filament systems. Hubs are associated with gas of rotational temperature T rot ∼ 15 K, non-thermal velocity dispersion σ NT ∼ 1 km s –1 , and exhibit signs of star formation, while filaments appear to be more quiescent (T rot ∼ 11 K and σ NT ∼ 0.6 km s –1 ). Filaments are parallel in projection and distributed mainly along two directions, at P.A. ∼ 10° and 60°, and appear to be coherent in velocity. The averaged projected separation between adjacent filaments is between 0.5 pc and 1 pc, and the mean width of filaments is 0.12 pc. Cores within filaments are separated by ∼0.33 ± 0.09 pc, which is consistent with the predicted fragmentation of an isothermal gas cylinder due to the s ausage - type instability. The network of parallel filaments observed in G14.225–0.506 is consistent with the gravitational instability of a thin gas layer threaded by magnetic fields. Overall, our data suggest that magnetic fields might play an important role in the alignment of filaments, and polarization measurements in the entire cloud would lend further support to this scenario.

  5. UNVEILING A NETWORK OF PARALLEL FILAMENTS IN THE INFRARED DARK CLOUD G14.225-0.506

    Energy Technology Data Exchange (ETDEWEB)

    Busquet, Gemma [INAF-Istituto di Astrofisica e Planetologia Spaziali, via Fosso del Cavaliere 100, I-00133 Roma (Italy); Zhang, Qizhou; Ho, Paul T. P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Palau, Aina; Girart, Josep M. [Institut de Ciencies de l' Espai (CSIC-IEEC), Campus UAB, Facultat de Ciencies, Torre C-5 parell, E-08193 Bellaterra, Catalunya (Spain); Liu, Hauyu Baobab [Academia Sinica Institute of Astronomy and Astrophysics, Taipei, Taiwan (China); Sanchez-Monge, Alvaro [INAF, Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-05125 Firenze (Italy); Estalella, Robert [Departament d' Astronomia i Meteorologia, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona, Catalunya (Spain); De Gregorio-Monsalvo, Itziar [European Southern Observatory, Karl-Schwarzschild-Strasse 2, D-85748 Garching (Germany); Pillai, Thushara [Caltech Astronomy Department, MC 249-17, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Wyrowski, Friedrich [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany); Santos, Fabio P.; Franco, Gabriel A. P., E-mail: gemma.busquet@iaps.inaf.it [Departamento de Fisica-ICEx-UFMG, Caixa Postal 702, 30.123-970 Belo Horizonte-MG (Brazil)

    2013-02-20

    We present the results of combined NH{sub 3} (1,1) and (2,2) line emission observed with the Very Large Array and the Effelsberg 100 m telescope of the infrared dark cloud G14.225-0.506. The NH{sub 3} emission reveals a network of filaments constituting two hub-filament systems. Hubs are associated with gas of rotational temperature T{sub rot} {approx} 15 K, non-thermal velocity dispersion {sigma}{sub NT} {approx} 1 km s{sup -1}, and exhibit signs of star formation, while filaments appear to be more quiescent (T{sub rot} {approx} 11 K and {sigma}{sub NT} {approx} 0.6 km s{sup -1}). Filaments are parallel in projection and distributed mainly along two directions, at P.A. {approx} 10 Degree-Sign and 60 Degree-Sign , and appear to be coherent in velocity. The averaged projected separation between adjacent filaments is between 0.5 pc and 1 pc, and the mean width of filaments is 0.12 pc. Cores within filaments are separated by {approx}0.33 {+-} 0.09 pc, which is consistent with the predicted fragmentation of an isothermal gas cylinder due to the {sup s}ausage{sup -}type instability. The network of parallel filaments observed in G14.225-0.506 is consistent with the gravitational instability of a thin gas layer threaded by magnetic fields. Overall, our data suggest that magnetic fields might play an important role in the alignment of filaments, and polarization measurements in the entire cloud would lend further support to this scenario.

  6. 212Pb-Labeled Antibody 225.28 Targeted to Chondroitin Sulfate Proteoglycan 4 for Triple-Negative Breast Cancer Therapy in Mouse Models

    Directory of Open Access Journals (Sweden)

    Benjamin B. Kasten

    2018-03-01

    Full Text Available Triple-negative breast cancer (TNBC is an aggressive subtype of breast cancer with a poor prognosis. There is a clinical need for effective, targeted therapy strategies that destroy both differentiated TNBC cells and TNBC cancer initiating cells (CICs, as the latter are implicated in the metastasis and recurrence of TNBC. Chondroitin sulfate proteoglycan 4 (CSPG4 is overexpressed on differentiated tumor cells and CICs obtained from TNBC patient specimens, suggesting that CSPG4 may be a clinically relevant target for the imaging and therapy of TNBC. The purpose of this study was to determine whether α-particle radioimmunotherapy (RIT targeting TNBC cells using the CSPG4-specific monoclonal antibody (mAb 225.28 as a carrier was effective at eliminating TNBC tumors in preclinical models. To this end, mAb 225.28 labeled with 212Pb (212Pb-225.28 as a source of α-particles for RIT was used for in vitro Scatchard assays and clonogenic survival assays with human TNBC cells (SUM159 and 2LMP grown as adherent cells or non-adherent CIC-enriched mammospheres. Immune-deficient mice bearing orthotopic SUM159 or 2LMP xenografts were injected i.v. with the targeted (225.28 or irrelevant isotype-matched control (F3-C25 mAbs, labeled with 99mTc, 125I, or 212Pb for in vivo imaging, biodistribution, or tumor growth inhibition studies. 212Pb-225.28 bound to adherent SUM159 and 2LMP cells and to CICs from SUM159 and 2LMP mammospheres with a mean affinity of 0.5 nM. Nearly ten times more binding sites per cell were present on SUM159 cells and CICs compared with 2LMP cells. 212Pb-225.28 was six to seven times more effective than 212Pb-F3-C25 at inhibiting SUM159 cell and CIC clonogenic survival (p < 0.05. Radiolabeled mAb 225.28 showed significantly higher uptake than radiolabeled mAb F3-C25 in SUM159 and 2LMP xenografts (p < 0.05, and the uptake of 212Pb-225.28 in TNBC xenografts was correlated with target epitope expression. 212Pb-225.28 caused dose

  7. Geology and petrography in basaltic rocks (Arapey formation) cropping out in road 30 between the Bella Union round point (27 km) and Penas cuesta (225 Km)

    International Nuclear Information System (INIS)

    Oyhantcabal, P.; Pineiro, G.

    2007-01-01

    This contribution presents a geological map of the basaltic flows of Arapey formation (Mezosoic) cropping out in Road 30 between the Bella Union round point (27 Km) and Pena s cuesta (225 Km) together with the description of the petrographic features of the different portions of the 20 recognized flow units

  8. Replacement of Hydrochlorofluorocarbon (HCFC) -225 Solvent for Cleaning and Verification Sampling of NASA Propulsion Oxygen Systems Hardware, Ground Support Equipment, and Associated Test Systems

    Science.gov (United States)

    Mitchell, Mark A.; Lowrey, Nikki M.

    2015-01-01

    Since the 1990's, when the Class I Ozone Depleting Substance (ODS) chlorofluorocarbon-113 (CFC-113) was banned, NASA's rocket propulsion test facilities at Marshall Space Flight Center (MSFC) and Stennis Space Center (SSC) have relied upon hydrochlorofluorocarbon-225 (HCFC-225) to safely clean and verify the cleanliness of large scale propulsion oxygen systems. Effective January 1, 2015, the production, import, export, and new use of HCFC-225, a Class II ODS, was prohibited by the Clean Air Act. In 2012 through 2014, leveraging resources from both the NASA Rocket Propulsion Test Program and the Defense Logistics Agency - Aviation Hazardous Minimization and Green Products Branch, test labs at MSFC, SSC, and Johnson Space Center's White Sands Test Facility (WSTF) collaborated to seek out, test, and qualify a replacement for HCFC-225 that is both an effective cleaner and safe for use with oxygen systems. Candidate solvents were selected and a test plan was developed following the guidelines of ASTM G127, Standard Guide for the Selection of Cleaning Agents for Oxygen Systems. Solvents were evaluated for materials compatibility, oxygen compatibility, cleaning effectiveness, and suitability for use in cleanliness verification and field cleaning operations. Two solvents were determined to be acceptable for cleaning oxygen systems and one was chosen for implementation at NASA's rocket propulsion test facilities. The test program and results are summarized. This project also demonstrated the benefits of cross-agency collaboration in a time of limited resources.

  9. 12 CFR 225.93 - What are the consequences of a foreign bank failing to continue to meet applicable capital and...

    Science.gov (United States)

    2010-01-01

    ... management requirements? (a) Notice by the Board. If a foreign bank or company has made an effective election to be treated as a financial holding company under this subpart and the Board finds that the foreign... HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies § 225...

  10. [Detection of leptospira by culture of vitreous humor and detection of antibodies against leptospira in vitreous humor and serum of 225 horses with equine recurrent uveitis].

    Science.gov (United States)

    Dorrego-Keiter, Elisa; Tóth, József; Dikker, Lieke; Sielhorst, Jutta; Schusser, Gerald Fritz

    2016-01-01

    In the ongoing discussion regarding the aetiopathogenesis of equine recurrent uveitis (ERU) it was the aim of the present study to elucidate the relationship of leptospira infection and ERU. In a population of 225 horses leptospira were examined in vitreous humor by culture and leptospira antibody were detected in vitreous humor and serum samples. Preoperative serum samples were collected from 221/225 ERU patients of different age, gender and breed. Undiluted vitreous humor was aseptically taken from 198/225 patients that underwent pars plana vitrectomy at the beginning of surgery and from 27/225 patients' eyeball after enucleation: Serum and vitreous humor were tested for specific leptospiral antibodies by microscopic agglutination test (MAT). Furthermore, vitreous humor was examined by culture. 20 patients which were euthanized due to a live-threatening disease other than ERU served as a control group. A total of 127/221 (57.5%) horses had serum antibodies (≥ 1:100). Most frequently antibodies against L. interrogans serovar Grippotyphosa were detected (79/127), followed by L. interrogans serovar lcterohaemorrhagiae (34/127) and L. interrogans serovar Bratislava (29/127). Only 79/225 horses (35.1%) had leptospiral antibodies in vitreous humor, in which L. interrogans serovar Grippotyphosa (67/79) was identified most frequently followed by L. interrogans serovar Pomona (18/79) and L. interrogans serovar lcterohaemorrhagiae (8/79) which was identified as single or multiple reaction. Isolation of leptospira from vitreous humor was positive in 34/212 horses (16%). 10/20 control horses had a positive antibody titer against leptospira in serum and 2/20 horses in vitreous humor, whereas there was no leptospira detected in culture. The result of 84% negative cultures from vitreous humor of 212 ERU patients is decisive for the diagnosis and therapy of ERU.

  11. Decreased repopulation as well as increased reoxygenation contribute to the improvement in local control after targeting of the EGFR by C225 during fractionated irradiation

    International Nuclear Information System (INIS)

    Krause, Mechthild; Ostermann, Gernot; Petersen, Cordula; Yaromina, Ala; Hessel, Franziska; Harstrick, Andreas; Kogel, Albert J van der; Thames, Howard D; Baumann, Michael

    2005-01-01

    Background and purpose: Inhibition of repopulation and enhanced reoxygenation has been suggested to contribute to improvement of local tumour control after fractionated irradiation combined with inhibitors of the epidermal growth factor receptor (EGFR). The present study addresses this hypothesis in FaDu human squamous cell carcinoma. For this tumour model marked repopulation and incomplete reoxygenation during fractionated irradiation has previously been demonstrated. Furthermore, the anti-EGFR monoclonal antibody C225 has been shown to significantly improve the results of fractionated irradiation in this tumour. Materials and methods: FaDu tumours in nude mice were irradiated with 18 fractions in 18 days (18f/18d) or 18 fractions in 36 days (18f/36d). Three Gy fractions were given either under ambient or under clamp hypoxic conditions. C225 or carrier was applied four times during the course of treatment. Fractionated irradiations were followed by graded top-up doses to obtain complete dose-response curves for local tumour control. Tumour control dose 50% (TCD 50 ) was determined at day 120 after end of treatment. Results: Significant repopulation and reoxygenation occurred during fractionated irradiation of FaDu tumours (P-values between 0.028 and 50 for 18f/36d under ambient conditions (P=0.04). Bootstrap analysis revealed decreased repopulation and increased reoxygenation after application of C225 (P=0.06 for the combined effect). This was further corroborated by a significant effect of C225 on the 'repopulated' dose under ambient conditions which is influenced by both, reoxygenation and repopulation (P=0.012). Conclusions: Our study provides evidence that both decreased repopulation as well as increased reoxygenation contribute to the improvement of local control after targeting of EGFR by C225 during fractionated irradiation of FaDu tumours

  12. The anti-epidermal growth factor receptor (EGFR) monoclonal antibody, C225, enhances radiation-induced apoptosis in primary glioma cell lines through mediation of MAPK/JNK/p38 signaling pathways

    International Nuclear Information System (INIS)

    Chakravarti, A.; Noll, E.; Black, P.M.; Loeffler, J.S.

    2001-01-01

    Purpose: Increasing evidence suggests that signaling mediated by the epidermal growth factor receptor (EGFR) pathway contributes to radiation resistance. The anti-EGFR monoclonal antibody, C225, has been shown to enhance radiation response for several tumor types in preclinical models. Malignant gliomas are known to express, and quite frequently overexpress, EGFR. Our objectives in this study were to 1) Evaluate the efficacy of C225 as a radiation response modifier in EGFR-expressing glioma cell lines and to 2) Investigate the underlying molecular mechanisms mediating C225-induced enhancement of radiation response. Materials and Methods: Twelve EGFR-expressing glioma cells lines, established from patient tumors, were used for this study. Cells were incubated with C225, irradiated, and then evaluated for radiation response. Assays used to evaluate efficacy of C225-mediated radiosensitization included time-course apoptosis assays (Annexin V and TUNEL), viability assays (MTT), and clonogenic survival assays. The changes along MAPK (p44/p42)/JNK/p38-MAPK signal transduction pathways were then investigated using quantitative Western analysis with phospho-specific antibodies to determine the molecular mechanisms by which C225 mediates a given response. Results: C225 clearly enhanced radiation response for 7 of the 12 primary glioma cell lines studied. Enhancement of both immediate and delayed apoptotic responses was evident in these 7 responsive cell lines after C225 administration. The average apoptosis index at 6 hours post-RT+C225 for the 7 responsive lines was 9.5%, compared to 1.2% for the RT-only controls. A pattern of delayed apoptosis was evident in these 7 lines, with secondary apoptotic peaks (∼ 8.0%) occurring at 24 hours post-RT+C225. Time course viability measurements revealed a steady decrease in viable tumor cells in these responsive cell lines from 75% at 6 hours post-RT+C225 to 20% at 7 days. Clonogenic survival was also diminished in these 7 lines

  13. Tensile flow behaviour of 2.25Cr-1Mo ferritic steel base metal an simulated heat affected zone structures of 2.25 Cr-1Mo weld joint

    International Nuclear Information System (INIS)

    Laha, K.; Chandravathi, K.S.; Rao, K.B.S.; Mannan, S. L.; Sastry, D.H.

    1999-01-01

    Tensile tests in the temperature range 298 to 873 K have been performed on 2.25Cr-1Mo base metal and simulated heat affected zone (HAZ) structures of its weld joint, namely coarse grain bainite, fine grain bainite and intercritical structure. Tensile flow behaviour of all the microstructural conditions could be adequately described by the Hollomon equation (σ = K 1 ε n1 ) at higher (>623 K) temperatures. Deviation from the Hollomon equation was observed at low strains and lower ( 1 ε n1 + exp (K 2 + n 2 ε), was found to describe the flow curve. In general, the flow parameters n 1 , K 1 , n 2 and K 2 were found to decrease with increase in temperature except in the intermediate temperature range (423 to 623 K). Peaks/plateaus were observed in their variation with temperature in the intermediate temperature range coinciding with the occurrence of serrated flow in the load-elongation curve. The n 1 value increased and the K 1 value decreased with the type of microstructure in the order: coarse grain bainite, fine grain bainite, base metal and intercritical structure. The variation of n 1 with microstructure has been rationalized on the basis of mean free path (MFP) of dislocations which is directly related to the inter-particle spacing. Larger MFP of dislocations lead to higher strain hardening exponents n 1 . (orig.)

  14. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  15. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  16. Carbide Precipitation in 2.25 Cr-1 Mo Bainitic Steel: Effect of Heating and Isothermal Tempering Conditions

    Science.gov (United States)

    Dépinoy, Sylvain; Toffolon-Masclet, Caroline; Urvoy, Stéphane; Roubaud, Justine; Marini, Bernard; Roch, François; Kozeschnik, Ernst; Gourgues-Lorenzon, Anne-Françoise

    2017-05-01

    The effect of the tempering heat treatment, including heating prior to the isothermal step, on carbide precipitation has been determined in a 2.25 Cr-1 Mo bainitic steel for thick-walled applications. The carbides were identified using their amount of metallic elements, morphology, nucleation sites, and diffraction patterns. The evolution of carbide phase fraction, morphology, and composition was investigated using transmission electron microscopy, X-ray diffraction, as well as thermodynamic calculations. Upon heating, retained austenite into the as-quenched material decomposes into ferrite and cementite. M7C3 carbides then nucleate at the interface between the cementite and the matrix, triggering the dissolution of cementite. M2C carbides precipitate separately within the bainitic laths during slow heating. M23C6 carbides precipitate at the interfaces (lath boundaries or prior austenite grain boundaries) and grow by attracting nearby chromium atoms, which results in the dissolution of M7C3 and, depending on the temperature, coarsening, or dissolution of M2C carbides, respectively.

  17. Interaction of a Mach 2.25 turbulent boundary layer with a fluttering panel using direct numerical simulation

    Science.gov (United States)

    Bodony, Daniel; Ostoich, Christopher; Geubelle, Philippe

    2013-11-01

    The interaction between a thin metallic panel and a Mach 2.25 turbulent boundary layer is investigated using a direct numerical simulation approach for coupled fluid-structure problems. The solid solution uses a finite-strain, finite-deformation formulation, while the direct numerical simulation of the boundary layer uses a finite-difference compressible Navier-Stokes solver. The initially laminar boundary layer contains low amplitude unstable eigenmodes that grow in time and excite traveling bending waves in the panel. As the boundary layer transitions to a fully turbulent state, with Reθ ~ 1200 , the panel's bending waves coalesce into a standing wave pattern exhibiting flutter with a final amplitude approximately 20 times the panel thickness. The corresponding panel deflection is roughly 25 wall units and reaches across the sonic line in the boundary layer profile. Once it reaches a limit cycle state, the panel/boundary layer system is examined in detail where it is found that turbulence statistics, especially the main Reynolds stress - , appear to be modified by the presence of the compliant panel, the effect of which is forgotten within one integral length downstream of the panel. Supported by the U.S. Air Force Research Laboratory Air Vehicles Directorate under contract number FA8650-06-2-3620.

  18. The Atomic Mass Dependence of Massive Muon Pair Production in 225 GeV/c $\\pi$ - Nucleus Interactions

    Energy Technology Data Exchange (ETDEWEB)

    Swartz, Morris L. [Chicago U.

    1984-03-01

    The production of massive muon pairs in 225 GeV/c $\\pi^-$-nucleus interactions has been studied for four nuclear targets. The dependence of the integrated cross section on atomic mass A was measured by comparing the relative cross sections for the targets. If one assumes that the cross section is proportional to $A^{\\alpha}$, a value of a= 1.00±0.06 for muon pair masses between 4.0 GeV/$c^2$ and 8.5 GeV/$c^2$ was obtained. The Drell-Yan model predicts an additional dependence of the cross section on the proton fraction Z/A. If one parametizes the integrated cross I section as a(Z/A)$A^{\\alpha}$ where $\\sigma$(Z/A) is a function of the proton fraction that includes the effects of the Drell-Yan model, Fermi Motion, and secondary pion production, a value of $\\alpha$ = 0.97±0.06 was obtained. The dependence of the muon pair transverse momentum distribution on nuclear size was also investigated. The second moment of the distribution <$P^2_T$> was found to be consistent with being independent of nuclear size. If the dependence of <$P^2_T$> on nuclear size is parametized as <$P^2_T$> = a + b $A^{1/3}$ the coefficient b was found to be less than 0.015 $GeV^2$/$c^2$ with 90% confidence.

  19. Measurement of the oxidation of spent fuel between 140/degree/ and 225/degree/C by thermogravimetric analysis

    International Nuclear Information System (INIS)

    Woodley, R.E.; Einziger, R.E.; Buchanan, H.C.

    1988-09-01

    A series of PWR spent fuel samples from Turkey Point Unit 3 have been oxidized at temperatures between 140/degree/ and 225/degree/C in air atmospheres with dew points between 14.5/degree/ and /minus/70/degree/C, using a thermogravimetric analysis system (TGA). Tests lasted between 400 and 2100 hours. At the conclusion of a test, the atmosphere was sampled to determine the release of fission gas during testing, and the fuel samples were analyzed for microstructural changes. It appears that the mechanism for oxidation of spent fuel to U/sub 3/O/sub 7/ takes place in two steps that occur somewhat simultaneously. Oxygen migrates along the grain boundaries, which are oxidized and enlarged. The grains oxidize by the inward progression of a layer of U/sub 4/O/sub 9/ saturated with oxygen. A simplified model of the mechanism, which considers oxygen diffusion through the product layer as the rate-controlling step, yields an activation energy of 27 /plus minus/ 4 kcal/mol. Moisture, between dew points of /minus/70/degree/ to +14.5/degree/C, i.e., water vapor partial pressures varying over four orders of magnitude, had no significant effect on the oxidation rate. 34 refs., 12 figs., 6 tabs

  20. Hadron production in high energy muon scattering. [Quark-parton model, 225 GeV, structure functions, particle ratios

    Energy Technology Data Exchange (ETDEWEB)

    Hicks, R.G.

    1978-01-01

    An experiment was performed to study muon-proton scattering at an incident energy of 225 GeV and a total effective flux of 4.3 x 10/sup 10/ muons. This experiment is able to detect charged particles in coincidence with the scattered muon in the forward hemisphere, and results are reported for the neutral strange particles K/sub s//sup 0/ and ..lambda../sup 0/ decaying into two charged particles. Within experimental limits the masses and lifetimes of these particles are consistent with previous measurements. The distribution of hadrons produced in muon scattering is determined, measuring momentum components parallel and transverse to the virtual photon direction, and these distributions are compared to other high energy experiments involving the scattering of pions, protons, and neutrinos from protons. Structure functions for hadron production and particle ratios are calculated. No azimuthal dependence is observed, and lambda production does not appear to be polarized. The physical significance of the results is discussed within the framework of the quark-parton model. 29 references.

  1. Structure of 3-ketoacyl-(acyl-carrier-protein) reductase from Rickettsia prowazekii at 2.25 Å resolution

    International Nuclear Information System (INIS)

    Subramanian, Sandhya; Abendroth, Jan; Phan, Isabelle Q. H.; Olsen, Christian; Staker, Bart L.; Napuli, A.; Van Voorhis, Wesley C.; Stacy, Robin; Myler, Peter J.

    2011-01-01

    The R. prowazekii 3-ketoacyl-(acyl-carrier-protein) reductase is similar to those from other prokaryotic pathogens but differs significantly from the mammalian orthologue, strengthening its case as a potential drug target. Rickettsia prowazekii, a parasitic Gram-negative bacterium, is in the second-highest biodefense category of pathogens of the National Institute of Allergy and Infectious Diseases, but only a handful of structures have been deposited in the PDB for this bacterium; to date, all of these have been solved by the SSGCID. Owing to its small genome (about 800 protein-coding genes), it relies on the host for many basic biosynthetic processes, hindering the identification of potential antipathogenic drug targets. However, like many bacteria and plants, its metabolism does depend upon the type II fatty-acid synthesis (FAS) pathway for lipogenesis, whereas the predominant form of fatty-acid biosynthesis in humans is via the type I pathway. Here, the structure of the third enzyme in the FAS pathway, 3-ketoacyl-(acyl-carrier-protein) reductase, is reported at a resolution of 2.25 Å. Its fold is highly similar to those of the existing structures from some well characterized pathogens, such as Mycobacterium tuberculosis and Burkholderia pseudomallei, but differs significantly from the analogous mammalian structure. Hence, drugs known to target the enzymes of pathogenic bacteria may serve as potential leads against Rickettsia, which is responsible for spotted fever and typhus and is found throughout the world

  2. The stability of DOTA-chelated radiopharmaceuticals within 225Ac decay pathway studied with density functional theory.

    Science.gov (United States)

    Karolak, Aleksandra; Khabibullin, Artem; Budzevich, Mikalai; Martinez, M.; Doliganski, Michael; McLaughlin, Mark; Woods, Lilia; Morse, David

    Ligand structures encapsulating metal ions play a central role as contrast agents in Magnetic Resonance Imaging (MRI) or as agents delivering toxic cargo directly to tumor cells in targeted cancer therapy. The structural stability and interaction with solutions of such complexes are the key elements in understanding the foundation of delivery process. We present a comparative study for the 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) chelated to radioactive isotopes of 225Ac, 221Fr, 217At, 213Bi and a control 68Gd. Using density functional theory methods we investigate the structural stability of complexes for cancer therapy including binding energies, charge transfer, electron densities. The van der Waals interactions are included in the simulations to take into account weak dispersion forces present in such structures. Our results reveal that Ac-DOTA, Bi-DOTA and Gd-DOTA are the most stable complexes in the group. We also show that the water environment is a key ingredient for the structural coordination of the DOTA structures. Support from the US Department of Energy under Grant No. DE-FG02-06ER46297 is acknowledged.

  3. Gain-of-function R225W mutation in human AMPKgamma(3 causing increased glycogen and decreased triglyceride in skeletal muscle.

    Directory of Open Access Journals (Sweden)

    Sheila R Costford

    Full Text Available BACKGROUND: AMP-activated protein kinase (AMPK is a heterotrimeric enzyme that is evolutionarily conserved from yeast to mammals and functions to maintain cellular and whole body energy homeostasis. Studies in experimental animals demonstrate that activation of AMPK in skeletal muscle protects against insulin resistance, type 2 diabetes and obesity. The regulatory gamma(3 subunit of AMPK is expressed exclusively in skeletal muscle; however, its importance in controlling overall AMPK activity is unknown. While evidence is emerging that gamma subunit mutations interfere specifically with AMP activation, there remains some controversy regarding the impact of gamma subunit mutations. Here we report the first gain-of-function mutation in the muscle-specific regulatory gamma(3 subunit in humans. METHODS AND FINDINGS: We sequenced the exons and splice junctions of the AMPK gamma(3 gene (PRKAG3 in 761 obese and 759 lean individuals, identifying 87 sequence variants including a novel R225W mutation in subjects from two unrelated families. The gamma(3 R225W mutation is homologous in location to the gamma(2R302Q mutation in patients with Wolf-Parkinson-White syndrome and to the gamma(3R225Q mutation originally linked to an increase in muscle glycogen content in purebred Hampshire Rendement Napole (RN- pigs. We demonstrate in differentiated muscle satellite cells obtained from the vastus lateralis of R225W carriers that the mutation is associated with an approximate doubling of both basal and AMP-activated AMPK activities. Moreover, subjects bearing the R225W mutation exhibit a approximately 90% increase of skeletal muscle glycogen content and a approximately 30% decrease in intramuscular triglyceride (IMTG. CONCLUSIONS: We have identified for the first time a mutation in the skeletal muscle-specific regulatory gamma(3 subunit of AMPK in humans. The gamma(3R225W mutation has significant functional effects as demonstrated by increases in basal and AMP

  4. Feasibility Study for Implementing Magnetic Suspension in the Glenn Research Center 225 cm2 Supersonic Wind Tunnel for Testing the Dynamic Stability of Blunt Bodies

    Science.gov (United States)

    Sevier, Abigail; Davis, David O.; Schoenenberger, Mark; Barnhart, Paul

    2016-01-01

    The implementation of a magnetic suspension system in the NASA Glenn Research Center (GRC) 225 cm2 Supersonic Wind Tunnel would be a powerful test technique that could accurately determine the dynamic stability of blunt body entry vehicles with no sting interference. This paper explores initial design challenges to be evaluated before implementation, including defining the lowest possible operating dynamic pressure and corresponding model size, developing a compatible video analysis technique, and incorporating a retractable initial support sting.

  5. Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl

    2000-01-01

    The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation......)], reporting a decrease of the crystallization temperature under pressure in a pressure range of 0-6 GPa for the bulk glass Zr41Ti14Cu12.5Ni9Be22.5C1 alloy. Compressibility with a volume reduction of approximately 22% at room temperature does not induce crystallization in the Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk...... glass alloy. This indicates that the densification effect induced by pressure in the pressure range investigated plays a minor role in the crystallization behavior of this bulk glass alloy. The different crystallization behavior of the carbon-free and the carbon-containing glassy alloys has been...

  6. The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

    International Nuclear Information System (INIS)

    Butabaev, Yu.S.

    1994-01-01

    The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

  7. Comment: 225 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available itute of Agrobiological Sciences), Daiki Horikawa (NASA Ames Research Center) licenced under CC Attribution2....1 Japan ヨコヅナクマムシ 電子顕微鏡写真 撮影:行弘文子(農業生物資源研究所)、堀川大樹(NASA Ames Research Center) bando 2010/02/15 14:55:04 2010/02/16 10:43:01 ...

  8. Termodinamica 225 problemi risolti

    CERN Document Server

    Abbott, Michael M

    1994-01-01

    Questo testo presenta i principi fondamentali della termodinamica classica ed illustra, mediante numerosi esempi svolti e problemi, molte delle loro applicazioni nel campo della scienza e dell'ingegneria.

  9. pages 217 - 225.pmd

    African Journals Online (AJOL)

    Administrator

    National Environmental Engineering Research Institute, CSIR-complex, Taramani, ... samples, suggesting its use in hospitals for preliminary assessment of indoor air quality and determine pathogenic ... especially in developing countries, where factors such .... Table 1: Ambient physical parameters at the sampling location.

  10. Characterization of solar cells for space applications. Volume 7: Electrical characteristics of Spectrolab HEWAC BSF, textured, 10 ohm-cm, 225 micron solar cells as a function of intensity and temperature

    Science.gov (United States)

    Anspaugh, B. E.; Beckert, D. M.; Downing, R. G.; Miyahira, T. F.; Weiss, R. S.

    1979-01-01

    Electrical characteristics of Spectrolab HEWAC BSF, textured, 10 ohm cm, 225 micron solar cells are presented in graphical and tabular format as a function of solar illumination intensity and temperature.

  11. Carbon disclosure project report 2006 : Canada 280 on behalf of 225 investors with assets of $31 trillion

    Energy Technology Data Exchange (ETDEWEB)

    Greenall, D. [Conference Board of Canada, Ottawa, ON (Canada)

    2006-10-15

    The Conference Board of Canada carried out the Canadian component of the fourth annual Carbon Disclosure Project (CDP). Climate change is a topical issue for investors and financial institutions such as pension funds, asset management firms, banks and insurance companies that want to assess the carbon exposure and risk profiles of their investment. This report outlined recent climate-change developments in Canada and examined the state of disclosure of greenhouse gas (GHG) emissions of 280 Canadian companies and the implications for investors and corporations. In February 2006, on behalf of its 225 signatory investors, CDP requested information on corporate risks and opportunities associated with climate change from more than 2,000 companies globally. This report described the steps that respondent companies are taking to address climate change. A methodology was also presented to guide investors who want to determine a company's net carbon risk. It was noted that although awareness of the risks and opportunities posed by climate change has grown significantly among investors, it has not translated into widespread planning and action by Canada's largest companies. It was emphasized that if the negative impacts of climate change are to be avoided, investors will have to put CDP data to work. The $31.5 trillion in assets behind CDP4 includes $1 trillion by Canadian-based investors, a significant increase over the previous report. Sixty-three per cent of respondents provided data on annual GHG emissions. However, different measuring and reporting approaches made it difficult for investors to compare company emission profiles. The response from Canadian companies showed that large companies are responding to investor interests, particularly gas and electrical utilities and other carbon intensive companies in the forest products, petroleum and mining sectors. Canada compared well to the response rates of other jurisdictions, but forward-looking financial and

  12. Targeted α-Therapy of Metastatic Castration-Resistant Prostate Cancer with 225Ac-PSMA-617: Swimmer-Plot Analysis Suggests Efficacy Regarding Duration of Tumor Control.

    Science.gov (United States)

    Kratochwil, Clemens; Bruchertseifer, Frank; Rathke, Hendrik; Hohenfellner, Markus; Giesel, Frederik L; Haberkorn, Uwe; Morgenstern, Alfred

    2018-05-01

    The aim of this evaluation was to identify the first indicators of efficacy for 225 Ac-labeled prostate-specific membrane antigen (PSMA)-617 therapy in a retrospectively analyzed group of patients. Methods: Forty patients with metastatic castration-resistant prostate cancer were selected for treatment with three 100 kBq/kg cycles of 225 Ac-PSMA-617 at 2-mo intervals. Prostate-specific antigen (PSA) and blood cell count were measured every 4 wk. PSMA PET/CT or PSMA SPECT/CT were used for baseline staging and imaging follow-up at month 6. Follow-up included the duration of PSA response and radiologic progression-free survival at month 6. Patient histories were reviewed for the duration of previous treatment lines, and a swimmer plot was used to intraindividually compare the duration of tumor control by PSMA therapy versus prior treatment modalities. Results: Thirty-one of 40 patients were treated per protocol. Five patients discontinued treatment because of nonresponse, and 4 because of xerostomia. Of the 38 patients surviving at least 8 wk, 24 (63%) had a PSA decline of more than 50%, and 33 (87%) had a PSA response of any degree. The median duration of tumor control under 225 Ac-PSMA-617 last-line therapy was 9.0 mo; 5 patients had an enduring response of more than 2 y. Because all patients had advanced disease, this result compares favorably with the tumor control rates associated with earlier-phase disease; the most common preceding first-, second-, third-, and fourth-line therapies were abiraterone (median duration 10.0 mo), docetaxel (6.5 mo), enzalutamide (6.5 mo), and cabazitaxel (6.0 mo), respectively. Conclusion: A positive response for surrogate parameters demonstrates remarkable antitumor activity for 225 Ac-PSMA-617. Swimmer-plot analysis indicates a promising duration of tumor control, especially considering the unfavorable prognostic profile of the selected advanced-stage patients. Xerostomia was the main reason patients discontinued therapy or refused

  13. Mechanical properties of Zr41.2Ti13.8Ni10Cu12.5Be22.5 bulk metallic glass with different geometric confinements

    Science.gov (United States)

    Zhang, Changqin; Zhang, Haifeng; Sun, Qilei; Liu, Kegao

    2018-03-01

    Zr41.2Ti13.8Ni10Cu12.5Be22.5 (Vit 1) bulk metallic glass with Cu sleeves at different positions was prepared by the Cu mold casting method, and the effects of different geometric confinements offered by Cu sleeves on the mechanical properties of Vit 1 were investigated. It was found that the mechanical properties were prominently influenced by different geometric confinements and the plasticity could be modified by optimizing the positions of Cu sleeves. The results revealed that shear band initiation and propagation could be efficiently intervened by changing the radial boundary restraints, which led to quite different mechanical behaviors.

  14. 99m Tc-MIP-1404-SPECT/CT for the detection of PSMA-positive lesions in 225 patients with biochemical recurrence of prostate cancer.

    Science.gov (United States)

    Schmidkonz, Christian; Hollweg, Claudia; Beck, Michael; Reinfelder, Julia; Goetz, Theresa I; Sanders, James C; Schmidt, Daniela; Prante, Olaf; Bäuerle, Tobias; Cavallaro, Alexander; Uder, Michael; Wullich, Bernd; Goebell, Peter; Kuwert, Torsten; Ritt, Philipp

    2018-01-01

    99m Tc-MIP-1404 (Progenics Pharmaceuticals, Inc., New York, NY) is a novel, SPECT-compatible 99m Tc-labeled PSMA inhibitor for the detection of prostate cancer. We present results of its clinical use in a cohort of 225 men with histologically confirmed prostate cancer referred for workup of biochemical relapse. From April 2013 to April 2017, 99m Tc-MIP1404-scintigraphy was performed in 225 patients for workup of PSA biochemical relapse of prostate cancer. Whole-body planar and SPECT/CT images of the lower abdomen and thorax were obtained 3-4 h p.i. of 710 ± 64 MBq 99m Tc-MIP-1404. Images were visually analyzed for presence and location of abnormal uptake. In addition, quantitative analysis of the SPECT/CT data was carried out on a subset of 125 patients. Follow-up reports of subsequent therapeutic interventions were available for 59% (139) of all patients. Tracer-positive lesions were detected in 77% (174/225) of all patients. Detections occurred at the area of local recurrence in the prostate in 25% of patients (or a total of 56), with metastases in lymph nodes in 47% (105), bone in 27% (60), lung in 5% (12), and other locations in 2% (4) of patients. Detection rates were 90% at PSA levels ≥2 ng/mL and 54% below that threshold. Lesional SUVmax values were, on average, 32.2 ± 29.6 (0.8-142.2), and tumor-to-normal ratios 146.6 ± 160.5 (1.9-1482.4). The PSA level correlated significantly with total uptake of MIP-1404 in tumors (P Tc-MIP-1404-imaging and other information, an interdisciplinary tumor board review recommended changes to treatment plans in 74% (104/139) of those patients for whom the necessary documentation was available. SPECT/CT with 99m Tc-labeled MIP-1404 has a high probability in detecting PSMA-positive lesions in patients with elevated PSA. Statistical analysis disclosed significant relationship between quantitative 99m Tc-MIP-1404 uptake, PSA level, and Gleason score. © 2017 Wiley Periodicals, Inc.

  15. Análisis mediante HPLC de la fracción fenólica del aceite de oliva virgen de la variedad Arbequina. Relación con la medida del amargor K225 y la estabilidad

    Directory of Open Access Journals (Sweden)

    Uceda, M.

    2000-10-01

    Full Text Available Phenolic compounds have a high importance because of their effect on shelf life and sensorial characteristics of virgin olive oil. In this paper, the phenolic fraction of Arbequina virgin olive oils has been characterized by HPLC. Bitterness index K225, total phenols and autoxidation stability have been evaluated for olive oil samples. From the phenolic compounds separated using HPLC method, one of then (tr: 34,49 min was close correlated both with bitterness K225 and oil stability Rancimat at 98ºC. The regression coefficients, with high significance p<0,001, were r: 0.974 and r: 0.918 respectively. Phenolic compound responsible of bitterness K225 and oil stability has been found for the Arbequina virgin olive oils.Los compuestos fenólicos tienen gran importancia por su efecto sobre la estabilidad y las características sensoriales de los aceites de oliva vírgenes. En este trabajo se ha analizado mediante cromatografía líquida de alta resolución la fracción fenólica de los aceites de oliva de la variedad Arbequina. Se han determinado el amargor K225, el contenido de polifenoles totales y la estabilidad de los aceites. De los compuestos fenólicos separados por HPLC, existe uno de ellos, con un tr: 34,49 min que presenta un elevado nivel de correlación con el amargor K225 y la estabilidad Rancimat a 98ºC, presentando unos coeficientes de regresión altamente significativos, p<0.001, de r: 0.974 y r: 0.918 respectivamente. Por tanto, se ha establecido el principal responsable del amargor K225 y la estabilidad oxidativa de los aceites de la variedad Arbequina.

  16. NPV-LDE-225 (Erismodegib) inhibits epithelial mesenchymal transition and self-renewal of glioblastoma initiating cells by regulating miR-21, miR-128, and miR-200.

    Science.gov (United States)

    Fu, Junsheng; Rodova, Mariana; Nanta, Rajesh; Meeker, Daniel; Van Veldhuizen, Peter J; Srivastava, Rakesh K; Shankar, Sharmila

    2013-06-01

    Glioblastoma multiforme is the most common form of primary brain tumor, often characterized by poor survival. Glioblastoma initiating cells (GICs) regulate self-renewal, differentiation, and tumor initiation properties and are involved in tumor growth, recurrence, and resistance to conventional treatments. The sonic hedgehog (SHH) signaling pathway is essential for normal development and embryonic morphogenesis. The objectives of this study were to examine the molecular mechanisms by which GIC characteristics are regulated by NPV-LDE-225 (Smoothened inhibitor; (2,2'-[[dihydro-2-(4-pyridinyl)-1,3(2H,4H)-pyrimidinediyl]bis(methylene)]bis[N,N-dimethylbenzenamine). Cell viability and apoptosis were measured by XTT and annexin V-propidium iodide assay, respectively. Gli translocation and transcriptional activities were measured by immunofluorescence and luciferase assay, respectively. Gene and protein expressions were measured by quantitative real-time PCR and Western blot analyses, respectively. NPV-LDE-225 inhibited cell viability, neurosphere formation, and Gli transcriptional activity and induced apoptosis by activation of caspase-3 and cleavage of poly(ADP-ribose) polymerase. NPV-LDE-225 increased the expression of tumor necrosis factor-related apoptosis inducing ligand (TRAIL)-R1/DR4, TRAIL-R2/DR5, and Fas and decreased the expression of platelet derived growth factor receptor-α and Bcl2, and these effects were abrogated by Gli1 plus Gli2 short hairpin RNAs. NPV-LDE-225 enhanced the therapeutic potential of FasL and TRAIL by upregulating Fas and DR4/5, respectively. Interestingly, NPV-LDE-225 induced expression of programmed cell death 4 and apoptosis and inhibited cell viability by suppressing micro RNA (miR)-21. Furthermore, NPV-LDE-225 inhibited pluripotency-maintaining factors Nanog, Oct4, Sox2, and cMyc. The inhibition of Bmi1 by NPV-LDE-225 was regulated by induction of miR-128. Finally, NPV-LDE-225 suppressed epithelial-mesenchymal transition by

  17. Rational Speculative Bubble Size in Gold, Hang Seng, S&P 500 and Nikkei 225 Index During Year 2008 to 2016

    Science.gov (United States)

    Borhan, Nurharyanti; Halim, Nurfadhlina Abdul; Amir, W. Ahmad Wan Muhammad

    2017-09-01

    A rational speculative bubble is a surge in asset prices that exceed its intrinsic value. Rational speculative bubbles are among the ascription which may lead to the collapse of an economic system. Rational speculative bubble cannot be created but it comes into existence when assets started to be traded. Financial rational speculative bubble and burst have negative effect on the economy and markets. Financial rational speculative bubbles are difficult to detect. This study aims to shows the size of rational speculative bubble in four markets, which are gold, Hang Seng, S&P500 and Nikkei 225 during year 2008 to 2016. In this study, generalized Johansen-Ledoit-Sornette model are used to find the size of the rational speculative bubble. Bubble detection is important for both sides of macro-economic decision makers and to the trader. Especially for a trading system that requires detailed knowledge about the time and the stage of the bubble burst.

  18. Tailoring of K0.8Al0.7Fe0.15Si2.25O6 Leucite Based Dental Ceramic Material

    Directory of Open Access Journals (Sweden)

    Aleksandar Kremenović

    2016-06-01

    Full Text Available Potassium based ceramic materials composed from leucite in which 5 % of Al is exchanged with Fe and 4 % of hematite was synthesized by mechanochemical homogenization and annealing of K2O-SiO2-Al2O3-Fe2O3 mixtures. Synthesized material was characterized by X-ray Powder Diffraction (XRPD and Scanning Electron Microscopy coupled with Energy Dispersive X-ray spectroscopy (SEM/EDX. The two methods are in good agreement in regard to the specimen chemical composition suggesting that a leucite chemical formula is K0.8Al0.7Fe0.15Si2.25O6. Rietveld structure refinement results reveal that about 20 % of vacancies exist in the position of K atoms. This work is licensed under a Creative Commons Attribution 4.0 International License.

  19. Measurement of inclusive muon pair production by 225-GeV/c π+, π-, and proton beams with a large acceptance spectrometers

    International Nuclear Information System (INIS)

    Brason, J.G.

    1977-05-01

    Inclusive muon pair production by 225 GeV/c π + , π - and proton beams incident upon carbon and tin targets was measured over a large range of kinematic variables (2m/sub μ/ 2 , 0 4 sigma/dmdx/sub f/dp 2 /sub perpendicular to/ is presented as a function of these variables. The vector mesons rho, ω, phi, J and psi' appear in the data along with apparently nonresonant μ-pairs. By looking for additional muons accompanying J → μ + μ - events, a 1.0% upper limit on production of pairs of charmed particles in association with the J is obtained. Aspects of the continuum muon pair data are compared to Drell-Yan model calculations. The ratio of μ-pairs produced by π + beam particles to μ-pairs produced by π - beam particles supports electromagnetic production at high mass

  20. The effect of strain rate and temperature on the elevated temperature tensile flow behavior of service-exposed 2.25Cr-1Mo steel

    International Nuclear Information System (INIS)

    Girish Shastry, C.; Parameswaran, P.; Mathew, M.D.; Bhanu Sankara Rao, K.; Mannan, S.L.

    2007-01-01

    The elevated temperature tensile flow behavior of service-exposed 2.25Cr-1Mo steel has been critically examined with respect to strain rate sensitivity (m) and apparent activation energy (Q) for tensile deformation. The predominant role of forest dislocations in determining the relative flow response at true plastic strains greater than 0.01 is inferred from the profile of 'm' against flow stress. The variation of 'm' with temperature and strain is discussed based on the kinetics of dislocation generation and recovery. The decrease in Q with the increase in strain rate or temperature is attributed to the increase in recovery processes like dislocation annihilation and subcell/subgrain formation. This suggestion has been supported by transmission electron microscopy

  1. Phase decomposition in a mechanically alloyed Cu-44.5 at%Ni-22.5 at%Fe alloy during isothermal aging

    International Nuclear Information System (INIS)

    Lopez-Hirata, Victor M.; Saucedo-Munoz, Maribel L.; Diaz-Barriga-Arceo, Lucia G.

    2006-01-01

    A supersaturated solid solution of Cu-44.5 at%Ni-22.5 at%Fe alloy was produced by ball milling of a pure chemical elemental mixture for 1080 ks. An fcc supersaturated solid solution with a grain size of about 20 nm was obtained after milling. This alloy was subsequently aged at 803, 898 and 1003 K for different times. The growth kinetics of the modulation wavelength was determined from the X-ray diffraction results and followed the Lifshitz-Slyozov-Wagner theory for a diffusion-controlled coarsening in the MA alloy after aging. The growth kinetics of composition modulation wavelength for the MA alloy was faster at 803 and 898 K than that for the same alloy composition obtained by a conventional processing and then aged at the same temperatures. The activation energy for the decomposed phase coarsening process in the MA alloy was lower than that corresponding to the conventionally-processed alloy. (author)

  2. Analysis of elevated temperature flow and work hardening behaviour of service-exposed 2.25Cr-1Mo steel using Voce equation

    International Nuclear Information System (INIS)

    Girish Shastry, C.; Mathew, M.D.; Bhanu Sankara Rao, K.; Mannan, S.L.

    2004-01-01

    The Voce equation was used to model the tensile flow and work-hardening behaviour of a service-exposed 2.25Cr-1Mo steel. The applicability of Voce parameters obtained from the fit to experimental true stress-true strain datasets for estimating the validity of the fit was examined. The Voce equation was found to model the stress-strain curve closely. The Voce parameter n v was correlated to the underlying dislocation activities. It was found that the values of Voce parameters at various temperatures and strain rates can be used to infer the operating recovery mechanism during stage III hardening. A low absolute value of n v is indicative of recovery by cross-slip, whereas the high temperature transition to climb or sub-boundary migration driven recovery is accompanied by an increase in the value of n v

  3. Periodic oxide cracking on Fe2.25Cr1Mo produced by high-temperature fatigue tests with a compression hold

    International Nuclear Information System (INIS)

    Hecht, R.L.; Weertman, J.R.

    1993-01-01

    Long, straight cracks perpendicular to the stress axis are seen on the oxidized surface of specimens of Fe2.25Cr1Mo cycled with a compressive hold at high temperatures. The cracks in the oxide are periodically spaced. They resemble cracks observed in a brittle film on a ductile substrate after a tension test of the substrate. They also resemble the parallel multiple fractures that occur in a brittle matrix of a composite with ductile fibers undergoing tension. The authors apply both the model of a brittle film on a ductile substrate and of the brittle matrix composite to explain the observed intercrack spacing. Cracks in the oxide film lead to localized oxidation of the metal in the region around their intersection with the oxide-metal interface. These cracks are seen to penetrate the metal. Stress concentrations from deep grooves that form during compression hold fatigue, together with crack initiation from the oxide, lead to a shortened cycle life

  4. Use of Radioactive Ion Beams for Biomedical Research 1. in vivo labelling of monoclonal antibodies with radio-lanthanides and $^{225}$Ac

    CERN Multimedia

    2002-01-01

    % IS330 \\\\ \\\\\\begin{enumerate} \\item The aim of this study was to contribute to developments of new radiopharmaceuticals for tumour diagnosis and therapy. CERN-ISOLDE is the leading facility in the world to provide radioactive ion beams with high selectivity, purity and intensity. Radioisotope production by spallation makes available a complete range of rare earth isotopes having as complete a diversity of types and energy of radiation, of half-life, and of ionic properties as one would wish. The availability of exotic nuclei, e.g. radionuclides of rare earth elements and $^{225}$Ac, opens new possibilities for the development of radiopharmaceuticals for diagnosis and therapy.\\\\ \\\\ \\item Two approaches were followed within the experimental program. The radioactive metal ions are bound either to bio-specific ligands (monoclonal antibodies or peptides) or to unspecific low molecular weight form. The aim of the experimental program is to evaluate relationships between physico-chemical parameters of the tracer m...

  5. High temperature corrosion behavior of different grain size specimens of 2.25 Cr-1 Mo steel in SO2+O2 environment

    International Nuclear Information System (INIS)

    Ghosh, D.; Mitra, S.K.

    2011-01-01

    The investigation is primarily aimed at the high temperature corrosion behavior of different grain sizes of 2.25 Cr-1 Mo steel at SO 2 +O 2 (mixed oxidation and sulfidation). The various grain sizes (18 μm,26 μm, 48 μm, and 72 μm) are obtained by different annealing treatment. Isothermal corrosion studies are carried out in different grain size specimens at 973K for 8 hours. The corrosion growth rate and the reaction kinetics are studied by weight gain method. The external scales of the post corroded specimen are studied in Scanning Electron Microscope (SEM) to examine the corrosion products morphology on the scale. X-ray mapping analysis of the different elements (Fe, O, Cr and S) is carried out by Energy Dispersive Spectroscopy (EDS) attached with SEM. The X-ray Diffraction Analysis (XRD) is also carried out to identify the corrosion products in the external scale. Finally, it is concluded that that the corrosion rate of 2.25 Cr-1 Mo steel strongly depend on grain sizes of the specimens. The corrosion rate increases with the decreases of grain size. The finer grain (18 μm) show higher corrosion rate than the coarse grains (72 μm). The weight gain kinetics follows the parabolic growth rate which further indicates that the corrosion process is diffusion controlled. The scale analysis shows the thicker scale and extensive scale cracking and spallations in case of finer grain size specimen (18 μm), whereas the coarse grain specimen (72 μm) shows compact and adherent layer. The XRD analysis shows that the corrosion products consist of mixtures of iron oxides( Fe 3 O 4 and Fe 2 O 3 ) and iron sulfides (FeS). The details mechanism of the corrosion is discussed to explain the difference in corrosion rate for different grain sizes. (author)

  6. Guidance and considerations for the implementation of INFCIRC/225/Rev.4, the physical protection of nuclear material and nuclear facilities; Orientaciones y sugerencias para la aplicacion del documento INFCIRC/225/Rev.4, proteccion fisica de los materiales y las instalaciones nucleares

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-05-01

    This publication is intended to provide guidance and considerations for a State's competent authority to better understand and prescribe appropriate requirements, consistent with INFCIRC/225/Rev.4 for the protection of nuclear material and nuclear facilities which are compatible with accepted international practice. This report, together with a more detailed report, Handbook on the Physical Protection of Nuclear Material and Facilities, which addresses to the licensee or designer of physical protection systems who has specific implementation and compliance responsibilities, should be used in conjunction to each other to provide better and comprehensive guidance on physical protection.

  7. “Direct modulation of a hybrid III-V/Si DFB laser with MRR filtering for 22.5-Gb/s error-free dispersion-uncompensated transmission over 2.5-km SSMF

    DEFF Research Database (Denmark)

    Cristofori, Valentina; Da Ros, Francesco; Ding, Yunhong

    2016-01-01

    Error-free and penalty-free transmission over 2.5 km SSMF of a 22.5 Gb/s data signal from a directly modulated hybrid III-V/Si DFB laser is achieved by enhancing the dispersion tolerance using a silicon micro-ring resonator....

  8. A Single-Amino-Acid Substitution at Position 225 in Hemagglutinin Alters the Transmissibility of Eurasian Avian-Like H1N1 Swine Influenza Virus in Guinea Pigs.

    Science.gov (United States)

    Wang, Zeng; Yang, Huanliang; Chen, Yan; Tao, Shiyu; Liu, Liling; Kong, Huihui; Ma, Shujie; Meng, Fei; Suzuki, Yasuo; Qiao, Chuanling; Chen, Hualan

    2017-11-01

    Efficient transmission from human to human is the prerequisite for an influenza virus to cause a pandemic; however, the molecular determinants of influenza virus transmission are still largely unknown. In this study, we explored the molecular basis for transmission of Eurasian avian-like H1N1 (EAH1N1) swine influenza viruses by comparing two viruses that are genetically similar but differ in their transmissibility in guinea pigs: the A/swine/Guangxi/18/2011 virus (GX/18) is highly transmissible by respiratory droplet in guinea pigs, whereas the A/swine/Heilongjiang/27/2012 virus (HLJ/27) does not transmit in this animal model. We used reverse genetics to generate a series of reassortants and mutants in the GX/18 background and tested their transmissibility in guinea pigs. We found that a single-amino-acid substitution of glycine (G) for glutamic acid (E) at position 225 (E225G) in the HA1 protein completely abolished the respiratory droplet transmission of GX/18, whereas the substitution of E for G at the same position (G225E) in HA1 enabled HLJ/27 to transmit in guinea pigs. We investigated the underlying mechanism and found that viruses bearing 225E in HA1 replicated more rapidly than viruses bearing 225G due to differences in assembly and budding efficiencies. Our study indicates that the amino acid 225E in HA1 plays a key role in EAH1N1 swine influenza virus transmission and provides important information for evaluating the pandemic potential of field influenza virus strains. IMPORTANCE Efficient transmission among humans is a prerequisite for a novel influenza virus to cause a human pandemic. Transmissibility of influenza viruses is a polygenic trait, and understanding the genetic determinants for transmissibility will provide useful insights for evaluating the pandemic potential of influenza viruses in the field. Several amino acids in the hemagglutinin (HA) protein of influenza viruses have been shown to be important for transmissibility, usually by

  9. Different classes of EGFR inhibitors may have different potential to improve local tumour control after fractionated irradiation: a study on C225 in FaDu hSCC

    International Nuclear Information System (INIS)

    Krause, M.; Schuetze, C.; Petersen, C.; Pimentel, N.; Hessel, F.; Harstrick, A.; Baumann, M.

    2005-01-01

    Background and purpose: Previous experiments reported from this laboratory have shown that simultaneous application of the selective epidermal growth factor receptor tyrosine kinase (EGFR-TK) inhibitor BIBX1382BS during fractionated irradiation significantly prolonged growth delay of FaDu human squamous cell carcinoma but did not improve local tumour control. The present study investigates the effect of the EGFR monoclonal antibody (mAb) C225 on local tumour control of FaDu tumours after combined treatment with single dose and fractionated irradiation to address whether different classes of EGFR inhibitors have different potential to improve the outcome of radiotherapy in the same tumour model. Material and methods: In unirradiated tumours, C225 was given either once or 4 times i.p. to the nude mice. Irradiation experiments were performed with graded single doses under clamp hypoxic conditions or with 30 fractions in 6 weeks with graded total doses under ambient blood flow. C225 was given 6 h before or 6 h before and 2, 5 and 7 days after single dose irradiation. During fractionated irradiation C225 was given once per week. Experimental endpoints were tumour growth delay and local tumour control 120 after end of irradiation. Results: C225 treatment resulted in prolongation of tumour growth delay after drug treatment alone as well as after single dose and fractionated irradiation. TCD 50 values were reduced from 56.3 Gy [95% CI 50; 62 Gy] after single dose irradiation alone to 46.0 Gy [41;51] (enhancement ratio [ER]=1.22, P 50 ) was 73.0 Gy [64; 82] in control tumours and 63.1 Gy [57; 69] after simultaneous C225 treatment, corresponding to an ER of 1.2 (P=0.01). Conclusion: Treatment of FaDu hSCC with the anti-EGFR mAb C225 resulted in a significant prolongation of tumour growth delay after single dose and fractionated irradiation. In contrast to previous results on the EGFR-TK inhibitor BIBX1382BS, this prolongation of growth delay translated into a slight but

  10. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  11. A survey of photoproducts of an irradiated oligodeoxynucleotide by monochromatic photons with the energy ranged from 6.5 to 22.5 eV

    International Nuclear Information System (INIS)

    Ito, Takashi; Saito, Mikio; Taniguchi, Taketoshi

    1987-01-01

    We have irradiated 2'-deoxyadenylyl-(3'-5')-2'-deoxyadenosine (dephospho(dA) 2 ) in solid state with a newly developed synchrotron irradiation system over 6.5 to 22.5 eV photon energy range (190 to 55 nm in wavelength). Densitometric analysis of thin-layer chromatogram of photoproducts indicated that adenine and deoxyadenosine monophosphate were commonly produced above 7.3 eV (170 nm) in approximately equal amount. Deoxyribose was not detected by the fluorescence method with scratched materials from the chromatogram at any location except deoxyadenosine monophosphate and parent oligonucleotide positions. The photoproducts above mentioned were not observed at 6.5 eV (190 nm) even after very high radiation fluence. The energy dependence of this degradation indicates that the shorter the wavelength in use the smaller the fluence it requires. Careful examination of irradiated oligonucleotide on the chromatograms shows that the major portion of deoxyadenosine monophosphate so produced was the 5'phospho derivative. This site-selective degradation, independent of photon energy, seemed to be a remarkable characteristic of vacuum-UV induced effects above 7 eV. It is hypothesised that the deoxypentose moiety was first destroyed in one of the nucleoside residues due to the strong absorption in the sugar-phosphate group, liberating adenine on the one hand and leaving 5'-deoxyadenosine monophosphate. (author)

  12. Fractal and probability analysis of creep crack growth behavior in 2.25Cr–1.6W steel incorporating residual stresses

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Mengjia; Xu, Jijin, E-mail: xujijin_1979@sjtu.edu.cn; Lu, Hao; Chen, Jieshi; Chen, Junmei; Wei, Xiao

    2015-12-30

    Graphical abstract: - Highlights: • Statistical and fractal analysis is applied to study the creep fracture surface. • The tensile residual stresses promote the initiation of creep crack. • The fractal dimension of a mixed mode fracture surface shows a wavy variation. • The fractal dimension increases with increasing intergranular fracture percentage. • Height coordinates of intergranular fracture surface fit Gaussian distribution. - Abstract: In order to clarify creep crack growth behavior in 2.25Cr–1.6W steel incorporating residual stresses, creep crack tests were carried out on the tension creep specimens, in which the residual stresses were generated by local remelting and cooling. Residual stresses in the specimens were measured using Synchrotron X-ray diffraction techniques. The fracture surface of the creep specimen was analyzed using statistical methods and fractal analysis. The relation between fractal dimension of the fracture surface and fracture mode of the creep specimen was discussed. Due to different fracture mechanisms, the probability density functions of the height coordinates vary with the intergranular crack percentage. Good fitting was found between Gaussian distribution and the probability function of height coordinates of the high percentage intergranular crack surface.

  13. Evaluation of the neutron induced reactions on 235U from 2.25 keV up to 30 MeV

    Science.gov (United States)

    Trkov, Andrej; Capote, Roberto; Pigni, Marco T.; Pronyaev, Vladimir G.; Sin, Mihaela; Soukhovitskii, Efrem S.

    2017-09-01

    An evaluation of fast neutron induced reactions on 235U is performed in the 2.25 keV-30 MeV incident energy range with the code EMPIRE-3.2 Malta, combined with selected experimental data. The reaction model includes a dispersive optical model potential (RIPL 2408) that couples seven levels of the ground-state rotational band and a triple-humped fission barrier with absorption in the wells described within the optical model for fission. EGSM nuclear level densities are used in Hauser-Feshbach calculations of the compound-nuclear decay. The starting values for the model parameters are retrieved from the RIPL-3 data-base. Excellent agreement is achieved with available experimental data for neutron emission, neutron capture and fission, which gives confidence that the quantities for which there is no experimental information are also predicted accurately. In the fast neutron region of the evaluated file, the fission cross section is taken from Neutron Standards, and neutron capture includes fluctuations observed in recent experiments. Other channels are taken directly from model calculations. New evaluation is validated against ICSBEP criticality benchmarks with fast neutron spectra with excellent results.

  14. The result of surgical treatment in patients with cerebral aneurysms in Maharaj Nakorn Chiang Mai Hospital: a report of 225 cases.

    Science.gov (United States)

    Watcharasaksilp, Wanarak; Limpastan, Kriengsak; Norasathada, Tanya; Vaniyapong, Tanat

    2013-07-01

    Evaluate the result of intracranial aneurysm surgery in Maharaj Nakorn Chiang Mai Hospital. A retrospective study ofpatients who underwent surgery for intracranial aneurysms between 2003 and 2007. The patients'age, gender, signs and symptoms, CT brain findings, Subarachnoid hemorrhage (SAH), World Federation of Neurosurgical Society grading (WFNS), and aneurysm location were studied and correlated with outcome after surgery. Two hundred twenty five patients ofintracranial aneurysm were operated on between 2003 and 2007. Two hundred nine patients (92%) had anterior circulation aneurysms and 18 (8%) had posterior circulation aneurysms. The outcome, as evaluated by Glasgow Outcome Scale (GOS), showed good recovery and moderate disability patients (142, 62.9%) were classified as favorable outcome group whereas patients with severe disability, vegetative state, and dead (83, 36.9%) were classified as unfavorable outcome. According to WFNS grading, the patients with unruptured aneurysm and WFNS grade 1-2 had favorable outcome in 116 patients (78.37%) and unfavorable outcome in 32 patients (21.62%). Whereas the patients with WFNS grade 3-5 had favorable outcome in 32 patients (33.76%) and unfavorable outcome in 51 patients (66.23%). This study of 225 cases revealed 142 cases with favorable outcome and 83 cases with unfavorable outcome. Factors that affected the outcome were WFNS grading and age.

  15. Fractal and probability analysis of creep crack growth behavior in 2.25Cr–1.6W steel incorporating residual stresses

    International Nuclear Information System (INIS)

    Xu, Mengjia; Xu, Jijin; Lu, Hao; Chen, Jieshi; Chen, Junmei; Wei, Xiao

    2015-01-01

    Graphical abstract: - Highlights: • Statistical and fractal analysis is applied to study the creep fracture surface. • The tensile residual stresses promote the initiation of creep crack. • The fractal dimension of a mixed mode fracture surface shows a wavy variation. • The fractal dimension increases with increasing intergranular fracture percentage. • Height coordinates of intergranular fracture surface fit Gaussian distribution. - Abstract: In order to clarify creep crack growth behavior in 2.25Cr–1.6W steel incorporating residual stresses, creep crack tests were carried out on the tension creep specimens, in which the residual stresses were generated by local remelting and cooling. Residual stresses in the specimens were measured using Synchrotron X-ray diffraction techniques. The fracture surface of the creep specimen was analyzed using statistical methods and fractal analysis. The relation between fractal dimension of the fracture surface and fracture mode of the creep specimen was discussed. Due to different fracture mechanisms, the probability density functions of the height coordinates vary with the intergranular crack percentage. Good fitting was found between Gaussian distribution and the probability function of height coordinates of the high percentage intergranular crack surface.

  16. Effect of tensile deformation on micromagnetic parameters in 0.2% carbon steel and 2.25Cr-1Mo steel

    Energy Technology Data Exchange (ETDEWEB)

    Moorthy, V.; Vaidyanathan, S.; Jayakumar, T.; Raj, B. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Metallurgy and Materials Group; Kashyap, B.P. [Indian Inst. of Tech., Bombay (India). Dept. of Metallurgical Engineering and Materials Science

    1999-04-23

    The influence of prior tensile deformation on the magnetic Barkhausen emission (MBE) and the hysteresis (B-H) curve has been studied in 0.2% carbon steel and 2.25Cr-1Mo steel under different tempered conditions. This study shows that the micromagnetic parameters can be used to identify the four stages of deformation, namely (1) perfectly elastic, (2) microplastic yielding, (3) macroyielding and (4) progressive plastic deformation. However, it is observed that the MBE profile shows more distinct changes at different stages of tensile deformation than the hysteresis curve. It has been established that the beginning of microplastic yielding and macroyielding can be identified from the MBE profile which is not possible from the stress-strain plot. The onset of microplastic yielding can be identified from the decrease in the MBE peak height. The macroyielding can be identified from the merging of the initially present two-peak MBE profile into a single central peak with relatively higher peak height and narrow profile width. The difference between the variation of MBE and hysteresis curve parameters with strain beyond macroyielding indicates the difference in the deformation state of the surface and bulk of the sample.

  17. Evaluation of the neutron induced reactions on 235U from 2.25 keV up to 30 MeV

    Directory of Open Access Journals (Sweden)

    Trkov Andrej

    2017-01-01

    Full Text Available An evaluation of fast neutron induced reactions on 235U is performed in the 2.25 keV–30 MeV incident energy range with the code EMPIRE–3.2 Malta, combined with selected experimental data. The reaction model includes a dispersive optical model potential (RIPL 2408 that couples seven levels of the ground-state rotational band and a triple-humped fission barrier with absorption in the wells described within the optical model for fission. EGSM nuclear level densities are used in Hauser-Feshbach calculations of the compound-nuclear decay. The starting values for the model parameters are retrieved from the RIPL-3 data-base. Excellent agreement is achieved with available experimental data for neutron emission, neutron capture and fission, which gives confidence that the quantities for which there is no experimental information are also predicted accurately. In the fast neutron region of the evaluated file, the fission cross section is taken from Neutron Standards, and neutron capture includes fluctuations observed in recent experiments. Other channels are taken directly from model calculations. New evaluation is validated against ICSBEP criticality benchmarks with fast neutron spectra with excellent results.

  18. Microstructural evolution of a 2.25Cr - 1 Mo steel during austenitization and temper: austenite grain growth, carbide precipitation sequence and effects on mechanical properties

    International Nuclear Information System (INIS)

    Depinoy, Sylvain

    2015-01-01

    This work aims at optimizing tensile and toughness properties of a 2.25Cr - 1Mo steel by controlling its microstructure through heat treatments. To this aim, phase transformations during austenitization, quenching and tempering have to be understood. Quantitative microstructural analyses were performed by means of SEM, TEM and XRD to characterize and model metallurgical evolution of the steel at each step of the heat treatment. The evolution of austenite during the austenitization stage, and its influence on the resulting as-quenched microstructure were thoroughly investigated. Austenite grain growth was modelled in order to understand its mechanisms, including the limited growth phenomenon observed at lower temperatures. The effect of austenitization conditions on further decomposition of austenite and on mechanical properties after quenching + tempering was experimentally determined. An optimal austenitization condition was selected and applied to study the tempering stage. Carbide precipitation was studied for various tempering temperatures and amounts of time. M3C carbides precipitate first, followed by M2C and M7C3; M23C6 are the equilibrium carbides. The influence of carbide precipitation on mechanical properties was studied. Tensile properties are closely linked to the tempering conditions in the range investigated, while impact toughness remains stable. (author) [fr

  19. On the effect of niobium on the properties of welded joints in the 2.25% Cr-1% Mo type steel with nickel and niobium additions

    International Nuclear Information System (INIS)

    Matusek, P.; Gladis, R.; Walder, V.

    The effects were studied of the chemical composition of the base material and of welding parameters on the properties of welded joints of steel 08Cr2.25Mo1NiNb for fast reactor steam generators. Welding was done using Boehler-Fox electrodes and electrodes developed in Czechoslovakia. Testing revealed that the welded joint hardened and embrittled depending on the content of free niobium. The occurrence of eutectic formation of a general composition of Nbsub(m)Xsub(n) and possible of the Fe 2 Nb phase was considered to be one of the possible unfavourable microstructural factor which affects the mechanical properties of the thermally affected zone. The effect of the cooling rate Δtausub(8/5), ie., the effect of welding technologies was also found to be a function of the free niobium content. The results of welded joint creep to the fracture showed that until the 2x10 4 fracture time no negative effect of the welding cycle on the welded joint refractoriness was found. (B.S.)

  20. Ethyl 3-oxo-2-(2,5-dioxopyrrolidin-3-yl)butanoate derivatives: Anthelmintic and cytotoxic potentials, antimicrobial and docking studies

    Science.gov (United States)

    Mahmood, Fawad; Jan, Muhammad S.; Ahmad, Sajjad; Rashid, Umer; Ayaz, Muhammad; Ullah, Farhat; Hussain, Fida; Ahmad, Ashfaq; Khan, Arif-ullah; Aasim, Muhammad; Sadiq, Abdul

    2017-12-01

    The development of novel and more effective drugs is slow asthe resistance produced by pathogens.From the current scenario it can be imagine that this field of research will enter into the pre-antibiotic era. This work aims to study and evaluate the preliminary antibacterial, anthelmintic and cytotoxic potentials of ethyl 3-oxo-2-(2,5-dioxopyrrolidin-3-yl)butanoates.Among all of the four compounds, compound 2 has displayed remarkable potency with MIC values of 0.125, 0.083, 0.073 and 0.109 mg/ml against E. sakazakii, E. coli. S. aureus and K. pneumonia respectively. Compared to etoposide (LC50 9.8 µg/ml), the compounds demonstrated LC50 values from 280 to 765 µg/ml. For anthelmintic assay, three concentrations of each compound and standard drug were studied in determination of time of death of the two species. Excellent anthelmintic activity was observed by all four compounds against P. posthuma and A. gallibetter than standard albendazole. High GOLD fitness score data from docking analysis towards the targets represent better protein–ligand binding affinity and thus indicate a high propensity for all the active compounds to bind to the active site.Thepromisingin-vitro antimicrobial, anthelmintic activity and cytotoxicity data conclusively revealed that these compounds may serve as viable lead compounds for the treatment of bacterial and parasitic infections, and therefore, could help the medicinal chemists to design future chemotherapeutic agents to avoid rapid drug resistance.

  1. Documentation associated with the shipping of Hot-Cell Waste from WESF 225-B to the 200W (218-W-3AE) burial grounds under shipment number RSR-37338

    International Nuclear Information System (INIS)

    PAWLAK, M.W.

    1998-01-01

    The purpose of this report is to compile the records generated during the Packaging and Shipping of WESF Hot-Cell Waste from the 225-B Facility to 200W (218-W-3AE) burial grounds. A total of six 55-gallon drums were packaged and shipped using the Chem-Nuc Cask in accordance with WHC-SD-TP-SARP-025, Rev.0 ''Safety Analysis Report for Packaging (Onsite) for Type B Material in the CNS-14-215H Cask''

  2. WHAT IS CONTROLLING THE FRAGMENTATION IN THE INFRARED DARK CLOUD G14.225–0.506?: DIFFERENT LEVELS OF FRAGMENTATION IN TWIN HUBS

    Energy Technology Data Exchange (ETDEWEB)

    Busquet, Gemma; Girart, Josep Miquel [Institut de Ciències de l’Espai (CSIC-IEEC), Campus UAB, Carrer de Can Magrans, S/N, E-08193, Cerdanyola del Vallès, Catalunya (Spain); Estalella, Robert [Departament d’Astronomia i Meteorologia, Institut de Ciències del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Martí i Franquès, 1, E-08028 Barcelona, Catalunya (Spain); Palau, Aina [Instituto de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México, P.O. Box 3-72, 58090 Morelia, Michoacán, México (Mexico); Liu, Hauyu Baobab; Ho, Paul T. P. [Academia Sinica Institute of Astronomy and Astrophysics, Taipei, Taiwan (China); Zhang, Qizhou [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); De Gregorio-Monsalvo, Itziar [European Southern Observatory (ESO), Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany); Pillai, Thushara [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Anglada, Guillem, E-mail: busquet@ice.cat [Instituto de Astrofísica de Andalucía, CSIC, Glorieta de la Astronomía, s/n, E-18008, Granada (Spain)

    2016-03-20

    We present observations of the 1.3 mm continuum emission toward hub-N and hub-S of the infrared dark cloud G14.225–0.506 carried out with the Submillimeter Array, together with observations of the dust emission at 870 and 350 μm obtained with APEX and CSO telescopes. The large-scale dust emission of both hubs consists of a single peaked clump elongated in the direction of the associated filament. At small scales, the SMA images reveal that both hubs fragment into several dust condensations. The fragmentation level was assessed under the same conditions and we found that hub-N presents 4 fragments while hub-S is more fragmented, with 13 fragments identified. We studied the density structure by means of a simultaneous fit of the radial intensity profile at 870 and 350 μm and the spectral energy distribution adopting a Plummer-like function to describe the density structure. The parameters inferred from the model are remarkably similar in both hubs, suggesting that density structure could not be responsible for determining the fragmentation level. We estimated several physical parameters, such as the level of turbulence and the magnetic field strength, and we found no significant differences between these hubs. The Jeans analysis indicates that the observed fragmentation is more consistent with thermal Jeans fragmentation compared with a scenario in which turbulent support is included. The lower fragmentation level observed in hub-N could be explained in terms of stronger UV radiation effects from a nearby H ii region, evolutionary effects, and/or stronger magnetic fields at small scales, a scenario that should be further investigated.

  3. Ghost microstructure evolution and identification in the coarse grain heat affected zone of 2.25Cr-1Mo-V-Ti steel using tint etching

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyongwoon [Corporate R& D Institute, Doosan Heavy Industries & Construction,Gwigok-dong, Gyeongsangnam-do Seongsan-gu, Changwon-si 642-792 (Korea, Republic of); Lee, Seonghyeong; Na, Hyesung [School of Materials Science and Engineering, Pusan National University, San 30 Jangjeon-dong, Geumjeong-gu, Busan 609-735 (Korea, Republic of); Kang, Chungyun, E-mail: kangcy@pusan.ac.kr [School of Materials Science and Engineering, Pusan National University, San 30 Jangjeon-dong, Geumjeong-gu, Busan 609-735 (Korea, Republic of)

    2016-11-15

    Microstructural characteristics of the CGHAZ (coarse grained heat affected zone) made of the 2.25Cr-1Mo-V-Ti material for the thermal power plant boiler tube were discussed using the technique of tint etching. To conduct the micro structural characterization, the sample on which CGHAZ was produced by using a high temperature thermal cycle simulator, Gleeble 3500 equipment was used for comparative analyses using the existing Nital etching (ASTM E407-74) and the alkaline etching (ASTM E40785). The latter was used to observe a specific phase. For the microstructure on which the alkaline etching was experimented, the shape of a black strip (Ghost microstructure) in a few microns was observed, which was not observed from the Nital etching. It was found from the phase identifications based EPMA, EBSD and TEM experiments that the image of the black strip in a few microns represented the alpha phase in which C, Cr and Mo became segregated. In addition, it was verified that austenite and M{sub 23}C{sub 6} phase were present around the segregated zone. Based on such results, the mechanism by which the image of the black strip in a few microns was formed at the CGHAZ. In this study, we have investigated the mechanism of the appeared black strip in the CGHAZ. - Highlights: •Ghost microstructure was observed which was not observed from the nital etching. •Ghost microstructure has high concentrations of carbon and molybdenum than matrix. •Schematic illustration proposed of why Ghost microstructure was generated. •Ghost microstructure caused by partial dissolution of M{sub 23}C{sub 6} precipitation.

  4. WHAT IS CONTROLLING THE FRAGMENTATION IN THE INFRARED DARK CLOUD G14.225–0.506?: DIFFERENT LEVELS OF FRAGMENTATION IN TWIN HUBS

    International Nuclear Information System (INIS)

    Busquet, Gemma; Girart, Josep Miquel; Estalella, Robert; Palau, Aina; Liu, Hauyu Baobab; Ho, Paul T. P.; Zhang, Qizhou; De Gregorio-Monsalvo, Itziar; Pillai, Thushara; Anglada, Guillem

    2016-01-01

    We present observations of the 1.3 mm continuum emission toward hub-N and hub-S of the infrared dark cloud G14.225–0.506 carried out with the Submillimeter Array, together with observations of the dust emission at 870 and 350 μm obtained with APEX and CSO telescopes. The large-scale dust emission of both hubs consists of a single peaked clump elongated in the direction of the associated filament. At small scales, the SMA images reveal that both hubs fragment into several dust condensations. The fragmentation level was assessed under the same conditions and we found that hub-N presents 4 fragments while hub-S is more fragmented, with 13 fragments identified. We studied the density structure by means of a simultaneous fit of the radial intensity profile at 870 and 350 μm and the spectral energy distribution adopting a Plummer-like function to describe the density structure. The parameters inferred from the model are remarkably similar in both hubs, suggesting that density structure could not be responsible for determining the fragmentation level. We estimated several physical parameters, such as the level of turbulence and the magnetic field strength, and we found no significant differences between these hubs. The Jeans analysis indicates that the observed fragmentation is more consistent with thermal Jeans fragmentation compared with a scenario in which turbulent support is included. The lower fragmentation level observed in hub-N could be explained in terms of stronger UV radiation effects from a nearby H ii region, evolutionary effects, and/or stronger magnetic fields at small scales, a scenario that should be further investigated

  5. Weight gain and the risk of knee replacement due to primary osteoarthritis: a population based, prospective cohort study of 225,908 individuals.

    Science.gov (United States)

    Apold, H; Meyer, H E; Nordsletten, L; Furnes, O; Baste, V; Flugsrud, G B

    2014-05-01

    To study the association between weight gain and the risk of knee replacement (KR) due to primary osteoarthritis (OA), and to evaluate whether the association differs by age. 225,908 individuals from national health screenings with repeated measurements of height and weight were followed prospectively with respect to KR identified by linkage to the Norwegian Arthroplasty Register. Cox proportional hazard regression was used to calculate sex-specific relative risks (RR) of KR according to change in Body Mass Index (BMI) and weight, corresponding analyses were done for age categories at first screening. During 12 years of follow up, 1591 participants received a KR due to primary OA. Men in the highest quarter of yearly change in BMI had a RR of 1.5 (95% confidence interval (CI) 1.1-1.9) of having a KR compared to those in the lowest quarter. For women the corresponding RR was 2.4 (95% CI 2.1-2.7). Men under the age of 20 at the first screening had a 26% increased risk for KR per 5 kg weight gain, for women the corresponding increase was 43%. At older age the association became weaker, and in the oldest it was lost. Weight gain increases the risk for later KR both in men and women. The impact of weight gain is strongest in the young, at older age the association is weak or absent. Our study suggests that future OA may be prevented by weight control and that preventive measures should start at an early age. Copyright © 2014 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  6. Pharmacodynamic and pharmacokinetic neoadjuvant study of hedgehog pathway inhibitor Sonidegib (LDE-225) in men with high-risk localized prostate cancer undergoing prostatectomy.

    Science.gov (United States)

    Ross, Ashley E; Hughes, Robert M; Glavaris, Stephanie; Ghabili, Kamyar; He, Ping; Anders, Nicole M; Harb, Rana; Tosoian, Jeffrey J; Marchionni, Luigi; Schaeffer, Edward M; Partin, Alan W; Allaf, Mohamad E; Bivalacqua, Trinity J; Chapman, Carolyn; O'Neal, Tanya; DeMarzo, Angelo M; Hurley, Paula J; Rudek, Michelle A; Antonarakis, Emmanuel S

    2017-11-28

    To determine the pharmacodynamic effects of Sonidegib (LDE-225) in prostate tumor tissue from men with high-risk localized prostate cancer, by comparing pre-surgical core-biopsy specimens to tumor tissue harvested post-treatment at prostatectomy. We conducted a prospective randomized (Sonidegib vs. observation) open-label translational clinical trial in men with high-risk localized prostate cancer undergoing radical prostatectomy. The primary endpoint was the proportion of patients in each arm who achieved at least a two-fold reduction in GLI1 mRNA expression in post-treatment versus pre-treatment tumor tissue. Secondary endpoints included the effect of pre-surgical treatment with Sonidegib on disease progression following radical prostatectomy, and safety. Fourteen men were equally randomized (7 per arm) to either neoadjuvant Sonidegib or observation for 4 weeks prior to prostatectomy. Six of seven men (86%) in the Sonidegib arm (and none in the control group) achieved a GLI1 suppression of at least two-fold. In the Sonidegib arm, drug was detectable in plasma and in prostatic tissue; and median intra-patient GLI1 expression decreased by 63-fold, indicating potent suppression of Hedgehog signaling. Sonidegib was well tolerated, without any Grade 3-4 adverse events observed. Disease-free survival was comparable among the two arms (HR = 1.50, 95% CI 0.26-8.69, P = 0.65). Hedgehog pathway activity (as measured by GLI1 expression) was detectable at baseline in men with localized high-risk prostate cancer. Sonidegib penetrated into prostatic tissue and induced a >60-fold suppression of the Hedgehog pathway. The oncological benefit of Hedgehog pathway inhibition in prostate cancer remains unclear.

  7. American Gastroenterological Association guidelines are inaccurate in detecting pancreatic cysts with advanced neoplasia: a clinicopathologic study of 225 patients with supporting molecular data.

    Science.gov (United States)

    Singhi, Aatur D; Zeh, Herbert J; Brand, Randall E; Nikiforova, Marina N; Chennat, Jennifer S; Fasanella, Kenneth E; Khalid, Asif; Papachristou, Georgios I; Slivka, Adam; Hogg, Melissa; Lee, Kenneth K; Tsung, Allan; Zureikat, Amer H; McGrath, Kevin

    2016-06-01

    The American Gastroenterological Association (AGA) recently reported evidence-based guidelines for the management of asymptomatic neoplastic pancreatic cysts. These guidelines advocate a higher threshold for surgical resection than prior guidelines and imaging surveillance for a considerable number of patients with pancreatic cysts. The aims of this study were to assess the accuracy of the AGA guidelines in detecting advanced neoplasia and present an alternative approach to pancreatic cysts. The study population consisted of 225 patients who underwent EUS-guided FNA for pancreatic cysts between January 2014 and May 2015. For each patient, clinical findings, EUS features, cytopathology results, carcinoembryonic antigen analysis, and molecular testing of pancreatic cyst fluid were reviewed. Molecular testing included the assessment of hotspot mutations and deletions for KRAS, GNAS, VHL, TP53, PIK3CA, and PTEN. Diagnostic pathology results were available for 41 patients (18%), with 13 (6%) harboring advanced neoplasia. Among these cases, the AGA guidelines identified advanced neoplasia with 62% sensitivity, 79% specificity, 57% positive predictive value, and 82% negative predictive value. Moreover, the AGA guidelines missed 45% of intraductal papillary mucinous neoplasms with adenocarcinoma or high-grade dysplasia. For cases without confirmatory pathology, 27 of 184 patients (15%) with serous cystadenomas (SCAs) based on EUS findings and/or VHL alterations would continue magnetic resonance imaging (MRI) surveillance. In comparison, a novel algorithmic pathway using molecular testing of pancreatic cyst fluid detected advanced neoplasias with 100% sensitivity, 90% specificity, 79% positive predictive value, and 100% negative predictive value. The AGA guidelines were inaccurate in detecting pancreatic cysts with advanced neoplasia. Furthermore, because the AGA guidelines manage all neoplastic cysts similarly, patients with SCAs will continue to undergo unnecessary MRI

  8. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. I. Overall retardation from the stage irradiated to nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Carlson, J.G.

    1976-01-01

    Neuroblasts of Chortophaga viridifasciata (DeGeer) in culture were exposed to different doses of 225, 265, or 280 nm ultraviolet radiations at 11 different stages and substages of the mitotic cycle and individually selected cells were timed to breakdown of the nuclear membrane. Comparisons of the effectiveness of different wavelengths on the different stages were based on the dose that reduced the cell progression rate to 67 percent of normal (D 67 ) and the slope of the regression line, i.e., the control to treated time (C/T) ratio change/erg/mm 2 at the D 67 level. Cells of the prereplication period (metaphase + anaphase + early telophase) and the S phase (middle and late telophase + interphase + very early prophase) are equally sensitive to uv and contrast sharply with the much lower sensitivity of those in the postreplication period (early and middle prophase). This can best be interpreted if chromosomal DNA is the chromophore for uv-induced mitotic retardation. Cells in the prereplication period at exposure show no wavelength effect. In the S phase all stages except middle telophase and all stages combined are significantly more sensitive to 265 and 280 nm than to 225 nm. Of the postreplication stages, early prophase is retarded significantly more by 280 than by 225 or 265 nm. The C/T ratio/erg/mm 2 is greater after exposure to 265 nm at all prereplication and replication stages, but exhibits no consistent wavelength pattern during the postreplication period. Evidence based on the orientation of the neuroblast with respect to the uv-source suggests that the chromophore for mitotic retardation does not reside within the centrosome and related structures, but may be present, at least partly, in the nucleolus

  9. Structural relaxation and crystallisation of bulk metallic glasses Zr41Ti14Cu12.5Ni10-xBe22.5Fex (x = 0 or 2) studied by mechanical spectroscopy

    International Nuclear Information System (INIS)

    Wang, Q.; Pelletier, J.M.; Dong, Y.D.; Ji, Y.F.

    2004-01-01

    The measurements of the internal friction and dynamic shear modulus as well as differential scanning calorimetry have been performed in order to investigate the structural relaxation and crystallization of Zr 41 Ti 14 Cu 12.5 Ni 10-x Be 22.5 Fe x (x=0 or 2) bulk metallic glasses. It is found that the glass transition is retarded and the thermal stability of supercooled liquid is increased by the Fe addition. The experimental results are well analyzed using a physical model, which can characterize atomic mobility and mechanical response of disordered condensed materials

  10. Pressure-controlled nucleation and growth in Zr41Ti14Cu12.5Ni10Be22.5 bulk metallic glass close to and beyond glass transition temperature

    International Nuclear Information System (INIS)

    Pan Mingxiang; Yao Yushu; Zhao Deqian; Zhuang Yanxin; Wang Weihua

    2002-01-01

    By high-pressure annealing close to and beyond glass transition temperature, the behavior of nucleation and growth of crystals in Zr 41 Ti 14 Cu 12.5 Ni 10 Be 22.5 bulk metallic glass (BMG) is investigated. The experimental results indicate that exerting a high pressure during annealing can markedly decrease the nucleation temperature of the BMG. The growth rate of crystals first increases and then decreases with increase of annealing pressure. The effect of pressure on nucleation and growth of crystals is phenomenologically explained

  11. Microstructural evolution in decomposition of amorphous Zr41Ti14Cu12.5Ni10Be22.5 alloy, as investigated by small-angle neutron scattering

    International Nuclear Information System (INIS)

    Liu Junming; Hahn-Meitner-Inst. Berlin, Bereich, NM; Nanjing Univ.

    1997-01-01

    Small angle neutron scattering (SANS) has been applied to investigate decomposition kinetics and microstructural evolution in amorphous Zr 41 Ti 14 Cu 12.5 Ni 10 Be 22.5 . It is detected that immediately after the alloy is submitted into the supercooled liquid range, phase separation develops rapidly in the early stage, leaving a sluggish coarsening stage. The decomposed alloy finally achieves a roughly regular microstructure which consists of one particle-like supercooled liquid phase embedded in the similarly disordered matrix. The morphology of the particles as a function of time is evaluated, predicting a bar-like pattern. Strong temperature dependence of the phase separation is observed. (orig.)

  12. Estudio del comportamiento del acero 2.25Cr-1Mo frente a los fenómenos de oxidación cíclica e isoterma

    OpenAIRE

    Proy, Manuel; Victoria Utrilla, M; Otero, Enrique

    2014-01-01

    Cyclic and isothermal oxidation of chromium-molybdenum steel 2.25Cr-1Mo were analyzed at 550 °C and 650 °C during 360 hours in air atmospheres. The cycles were performed with two stages; one of heating in furnace during 90 minutes and then the sample were cooled to 50 °C by air flow. Thermogravimetric analyses were performed to obtain high temperature corrosion kinetics. Several characterization techniques have been used to identify the corrosion mechanism, as X-Ray Diffraction (XRD), Optical...

  13. Simultaneous gettering of oxygen and chlorine and homogenization of the β phase by rare earth hydride additions to a powder metallurgy Ti–2.25Mo–1.5Fe alloy

    International Nuclear Information System (INIS)

    Yan, M.; Liu, Y.; Liu, Y.B.; Kong, C.; Schaffer, G.B.; Qian, M.

    2012-01-01

    A detailed transmission electron microscopy analysis has revealed that small additions of yttrium hydride to a powder metallurgy Ti–2.25Mo–1.5Fe alloy resulted in the formation of both chlorine-free yttrium oxides and essentially oxygen-free yttrium chlorides. The oxides and chlorides showed distinctly different morphologies and spatial distribution. Yttrium acted as a potent getter for both oxygen and chlorine. Additionally, the β-Ti phase was free of nanoscaled α-Ti in the presence of yttrium. These microstructural changes contribute to the substantially increased ductility (∼90%).

  14. Stosowanie wenlafaksyny w dawkach większych niż 225 mg na dobę. Bilans ryzyka i korzyści

    Directory of Open Access Journals (Sweden)

    Łukasz Święcicki

    2014-09-01

    Full Text Available W pracy omówiono wyniki badań dotyczących stosowania wenlafaksyny w dawkach przewyższających 225 mg/dobę. Wydaje się, że stosowanie takich dawek może być celowe zwłaszcza u pacjentów z depresją lekooporną. W dawkach do 225 mg/dobę wenlafaksyna jest lekiem o działaniu głównie serotoninergicznym (hamującym wychwyt zwrotny serotoniny. W dawce przewyższającej 225 mg/dobę lek wywiera istotne działanie na hamowanie wychwytu zwrotnego noradrenaliny. Nie bez znaczenia jest również fakt, że w przypadku dawek w zakresie 225–300 mg/dobę zwiększa się hamowanie wychwytu zwrotnego serotoniny. Choć efekt ten jest stosunkowo niewielki (oceniany na około 5%, to zdaniem części autorów może być klinicznie znaczący. Cechy te sprawiają, że wenlafaksyna w dużych dawkach jest lekiem skuteczniejszym niż leki z grupy selektywnych inhibitorów wychwytu zwrotnego serotoniny (SSRI oceniane jako cała grupa, a także skuteczniejszym niż fluoksetyna. Pod względem skuteczności wenlafaksyna jest także lekiem najmniej porównywalnym z lekami z grupy trójpierścieniowych leków przeciwdepresyjnych. Tolerancja wenlafaksyny nawet w dużych dawkach jest zazwyczaj zadowalająca. Problem mogą stanowić przykre objawy występujące podczas odstawiania wenlafaksyny (zawroty głowy, nudności, wymioty, ogólne złe samopoczucie, nie ma jednak dostatecznych dowodów wskazujących na to, że częstość występowania oraz stopień nasilenia tych objawów mogłyby zależeć od stosowanej dawki leku – jest to raczej reakcja indywidualna.

  15. Creep Rupture Analysis and Life Estimation of 1.25Cr-0.5Mo, 2.25Cr-1Mo and Modified 9Cr-1Mo Steel: A Comparative Study

    Science.gov (United States)

    Roy, Prabir Kumar

    2018-04-01

    This paper highlights a comparative assessment of creep life of 1.25Cr-0.5Mo, 2.25Cr-1Mo and modified 9Cr-1Mo steels based on accelerated creep rupture tests. Creep rupture test data have been analysed and creep life of the above mentioned materials have been assessed using Larson Miller parameter at the stress levels of 60 and 42 MPa for different temperatures. Limiting steam temperatures for minimum design life of 105 h at 42 and 60 MPa for the above mentioned steels have also been calculated. Microstructural studies for the three above mentioned steels are also done.

  16. Embracing a vision of the New Jerusalem (Rv 21:1−22:5 to impact on life and society

    Directory of Open Access Journals (Sweden)

    Martin H. Pohlmann

    2015-04-01

    Full Text Available Apocalyptic biblical literature has played a significant role in motivating and mobilising Christians. As part of this genre, the Apocalypse of John has played this mobilising role within the church throughout its history. Jerusalem is often incorporated into this genre to conjure up different emotions and images to impact many different people. For example, the Jew annually recites the words to fellow Jews at every Passover meal: ‘Next year in Jerusalem’. Most Christians know the hymn ‘The holy city’, originally penned by Frederic Weatherly in 1892. It lifts many a spirit as it conjures up the idea of a beautiful, perfect, heavenly city of God. However, there is more to this apocalyptic vision, which will be explored in this article. The city upholds the hope of decent godly living today. Whilst Jerusalem is a city with an extremely chequered history, it remains to be the launching pad of a dream that believers can embrace in order to impact society for the better. The vision in Revelation 21–22 is the launch of the ‘idea’ of God’s intention for society today, and the ‘implementation impetus’ is the primary role of the church. In the greater scheme of things, the world community is the target group for a better society for everyone. Aanneming van ’n visioen van die Nuwe Jerusalem (Op 21:1–22:5 ten einde ’n invloed op lewe en die samelewing uit te oefen. Apokaliptiese Bybelliteratuur het ’n beduidende rol in die motivering en aansporing van Christengemeenskappe gespeel. Die Openbaring van Johannes het hierdie motiveringsrol deurgaans in die geskiedenis van die kerkas deel van dié genre vertolk. Jerusalem is dikwels hierby ingesluit om ’n verskeidenheid van emosies en beelde op te roep ten einde ’n impak op ’n verskeidenheid mense te maak. Die Jood, byvoorbeeld, haal jaarliks die volgende woorde teenoor mede-Jode tydens die Paasmaaltyd aan: ‘Volgende jaar in Jerusalem’. Die meeste

  17. Characterization of a 2 × 2 array of large square bars of LaBr3:Ce detectors with γ-rays up to 22.5 MeV

    Science.gov (United States)

    Dhibar, M.; Mazumdar, I.; Chavan, P. B.; Patel, S. M.; Anil Kumar, G.

    2018-03-01

    LaBr3:Ce scintillators have recently become commercially available in sizes large enough for measurements of high energy gamma-rays. In this communication, we report our studies on properties and response of large volume square bars (2‧‧ ×2‧‧ ×8‧‧) of LaBr3:Ce detectors, individually, and in a compact array of four square bars, with gamma-rays up to 22.5 MeV. The properties studied are, uniformity of the crystal, internal radioactivity, energy resolution, timing resolution, linearity of the response and detection efficiencies. The response of the detectors for 22.5 MeV γ-rays produced from 11B(p , γ)12C capture reaction and for 15.1 MeV γ-rays produced from 12C(p ,p‧ γ)12C inelastic scattering reaction are studied in detail. The measured absolute efficiencies (both total detection and photo-peak) for 662 keV gamma-rays from 137Cs are compared to those obtained using realistic GEANT4 simulations. The primary aim of the array is to measure high energy gamma-rays (5-50 MeV) produced from the de-excitation of excited Giant Dipole Resonance (GDR) states, radiative capture reactions, nuclear Bremsstrahlung process and inelastic scattering process. The highly satisfactory performance of the array provides the impetus for future efforts toward building a bigger array.

  18. Measurement of Inclusive ep Cross Sections at High Q2 at sqrt(s) = 225 and 252 GeV and of the Longitudinal Proton Structure Function FL at HERA

    CERN Document Server

    Andreev, V.; Baghdasaryan, S.; Begzsuren, K.; Belousov, A.; Belov, P.; Boudry, V.; Brandt, G.; Brinkmann, M.; Brisson, V.; Britzger, D.; Buniatyan, A.; Bylinkin, A.; Bystritskaya, L.; Campbell, A.J.; Cantun Avila, K.B.; Ceccopieri, F.; Cerny, K.; Chekelian, V.; Contreras, J.G.; Dainton, J.B.; Daum, K.; De Wolf, E.A.; Diaconu, C.; Dobre, M.; Dodonov, V.; Dossanov, A.; Dubak, A.; Eckerlin, G.; Egli, S.; Elsen, E.; Favart, L.; Fedotov, A.; Feltesse, J.; Ferencei, J.; Fleischer, M.; Fomenko, A.; Gabathuler, E.; Gayler, J.; Ghazaryan, S.; Glazov, A.; Goerlich, L.; Gogitidze, N.; Gouzevitch, M.; Grab, C.; Grebenyuk, A.; Greenshaw, T.; Grindhammer, G.; Habib, S.; Haidt, D.; Henderson, R.C.W.; Herbst, M.; Hildebrandt, M.; Hladky, J.; Hoffmann, D.; Horisberger, R.; Hreus, T.; Huber, F.; Jacquet, M.; Janssen, X.; Jung, A.W.; Jung, H.; Kapichine, M.; Kiesling, C.; Klein, M.; Kleinwort, C.; Kogler, R.; Kostka, P.; Kretzschmar, J.; Kruger, K.; Landon, M.P.J.; Lange, W.; Laycock, P.; Lebedev, A.; Levonian, S.; Lipka, K.; List, B.; List, J.; Lobodzinski, B.; Lubimov, V.; Malinovski, E.; Martyn, H.U.; Maxfield, S.J.; Mehta, A.; Meyer, A.B.; Meyer, H.; Meyer, J.; Mikocki, S.; Morozov, A.; Muller, K.; Naumann, Th.; Newman, P.R.; Niebuhr, C.; Nowak, G.; Nowak, K.; Olivier, B.; Olsson, J.E.; Ozerov, D.; Pahl, P.; Pascaud, C.; Patel, G.D.; Perez, E.; Petrukhin, A.; Picuric, I.; Pirumov, H.; Pitzl, D.; Placakyte, R.; Pokorny, B.; Polifka, R.; Radescu, V.; Raicevic, N.; Raspereza, A.; Ravdandorj, T.; Reimer, P.; Rizvi, E.; Robmann, P.; Roosen, R.; Rostovtsev, A.; Rotaru, M.; Rusakov, S.; Salek, D.; Sankey, D.P.C.; Sauter, M.; Sauvan, E.; Schmitt, S.; Schoeffel, L.; Schoning, A.; Schultz-Coulon, H.C.; Sefkow, F.; Shushkevich, S.; Soloviev, Y.; Sopicki, P.; South, D.; Spaskov, V.; Specka, A.; Steder, M.; Stella, B.; Straumann, U.; Sykora, T.; Thompson, P.D.; Traynor, D.; Truol, P.; Tsakov, I.; Tseepeldorj, B.; Turnau, J.; Valkarova, A.; Vallee, C.; Van Mechelen, P.; Vazdik, Y.; Wegener, D.; Wunsch, E.; Zacek, J.; Zhang, Z.; Zlebcik, R.; Zohrabyan, H.; Zomer, F.

    2014-04-08

    Inclusive ep double differential cross sections for neutral current deep inelastic scattering are measured with the H1 detector at HERA. The data were taken with a lepton beam energy of 27.6 GeV and two proton beam energies of Ep = 460 and 575 GeV corresponding to centre-of-mass energies of 225 and 252 GeV, respectively. The measurements cover the region of 6.5 *10^{-4}<=x<= 0.65 for 35<=Q^2<=800 GeV^2 up to y = 0.85. The measurements are used together with previously published H1 data at Ep = 920 GeV and lower Q2 data at Ep = 460, 575 and 920 GeV to extract the longitudinal proton structure function FL in the region 1.5<=Q^2 <=800 GeV^2.

  19. Measurement and calculation of polarization transfer coefficients in the reaction {sup 2}H(p,p){sup 2}H at E{sub p}=22.5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Clajus, M.; Albert, J.; Bruno, M.; Egun, P.M.; Glockle, W.; Glombik, A.; Gruebler, W.; Hautle, P.; Kretschmer, W.; Rauscher, A.; Schmelzbach, P.A.; Slaus, I.; Weidmann, R.; Witala, H. [Inst. fuer Mittelenergiephys., Eidgenoessische Tech. Hochschule, Zurich (Switzerland)

    1995-10-01

    The polarization transfer coefficients K{sub x}{sup x}', K{sub y}{sup y}' and K{sub z}{sup x}' in the reaction {sup 2}H(p,p){sup 2}H have been measured at an incident proton energy of 22.5 MeV. The results are compared to predictions from Faddeev calculations using various nucleon-nucleon potential models. The overall agreement is rather good. The comparison in more detail shows a pronounced sensitivity of the results, especially for K{sub y}{sup y}', to the {sup 3}S{sub 1}-{sup 3}D{sub 1} and {sup 1}P{sub 1} NN force components. As in nucleon-nucleon scattering, however, these two parameters are correlated, thus hampering definite conclusions. (author)

  20. Estudio del comportamiento del acero 2.25Cr-1Mo frente a los fenómenos de oxidación cíclica e isoterma

    Directory of Open Access Journals (Sweden)

    Proy, Manuel

    2014-03-01

    Full Text Available Cyclic and isothermal oxidation of chromium-molybdenum steel 2.25Cr-1Mo were analyzed at 550 °C and 650 °C during 360 hours in air atmospheres. The cycles were performed with two stages; one of heating in furnace during 90 minutes and then the sample were cooled to 50 °C by air flow. Thermogravimetric analyses were performed to obtain high temperature corrosion kinetics. Several characterization techniques have been used to identify the corrosion mechanism, as X-Ray Diffraction (XRD, Optical Microscopy (OM and Scanning Electron Microscopy (SEM. Thermal cycling tests can changes the corrosion mechanism, due cracks propagation in oxide scale, that witch can favors the access of oxidant agent to the substrate.La resistencia del acero aleado con cromo y molibdeno 2.25Cr-1Mo frente a la oxidación isotérmica y cíclica, fue evaluada a 550 °C y 650 °C durante 360 horas en aire. Los ciclos consistieron en el mantenimiento durante 90 minutos dentro del horno a la temperatura de ensayo y un periodo de enfriamiento forzado hasta 50 °C mediante la aplicación de un flujo de aire. Se realizó un estudio termogravimétrico para calcular las cinéticas de oxidación. Para conocer el mecanismo de degradación, se emplearon diversas técnicas de caracterización microestructural, como Difracción de Rayos (DRX, Microscopía Óptica (MO y Electrónica de Barrido (MEB. El ciclado térmico cambia el mecanismo de degradación, debido a la propagación de grietas en la película de óxido formada, que favorece el acceso del agente agresivo al sustrato.

  1. Synthesis, physical-chemical properties, antimicrobial and antifungal activity of some 2-(2-((5-(adamantane-1-yl-4-R-1,2,4-triazole-3-ylthioacetyl-N-R1–hydrazine-carbothioamides

    Directory of Open Access Journals (Sweden)

    V. M. Odyntsova

    2017-12-01

    Full Text Available Special attention of pharmaceutical scientists is attracted to the creation of new potential substances. They select natural heterocyclic molecules that exhibit various types of pharmacological activity as basic structures. Adamantane derivatives, as well as a number of other framework compounds, in the vast majority are biologically active substances. This fact causes interest to the given classes of organic compounds as potential sources for the development of new drugs. Due to the high pharmacological action of 1,2,4-triazole derivatives, the combination of adamantane and 1,2,4-triazole in one molecule can lead to the formation of high-level pharmacological substances. The aim of this work is the synthesis of some 2- (2 - ((5- (adamantane-1-yl -4-R-1,2,4-triasole-3-yl thio acetyl -N-R1-hydrazine-carbothioamides, study of their physical and chemical properties, antimicrobial and antifungal activity. Materials and methods. The chemical names of the compounds are given in accordance with the requirements of the IUPAC nomenclature (1979 and the recommendations of the IUPAC (1993. Study of the physical and chemical properties of 2-(2-((5-(adamantane-1-yl-4-R-1,2,4-triazole-3-ylthioacetyl-N-R1-hydrazine-carbothioamides have been carried out on the certified and licensed equipment in the ZSMU physical-chemical laboratories. The melting temperature was determined by an open capillary method on the Opti Melt MPA 100. The elemental composition of the synthesized compounds was determined on the universal analyzer Elementar Vario L cube (CHNS (standard – sulfanilamide. 1H NMR spectra were recorded on a spectrometer Varian Mercury VX-200 (1H, 200 MHz in dimethylsulfoxide-d6solvent (tetramethylsilane - internal standard and are decoded using ADVASP(tmAnalyzer program (Umatek International Inc.. Chromatographic mass spectral studies were performed on a gas-liquid chromatograph Agilent 1260 Infinity HPLC equipped with an Agilent 6120 mass spectrometer

  2. Process for radioisotope recovery and system for implementing same

    Science.gov (United States)

    Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

    2009-10-06

    A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

  3. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  4. Atomic structure of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass alloy

    Energy Technology Data Exchange (ETDEWEB)

    Hui, X. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China)], E-mail: huixd01@hotmail.com; Fang, H.Z.; Chen, G.L. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Shang, S.L.; Wang, Y. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Qin, J.Y. [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University - Southern Campus, Jinan 250061 (China); Liu, Z.K. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States)

    2009-01-15

    Ab initio molecular dynamics (AIMD) calculations were performed on the atomic configuration of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass. The local structures were characterized in terms of structure factors (SF), pair correlation functions (PCF), coordinate numbers, bond pairs and Voronoi polyhedra. The glass transition temperature, generalized PCF and SF predicated by AIMD are in good agreement with the experimental data. Icosahedral short-range orders (ISRO) are found to be the most dominant, in view of the presence of the majority of bond pairs with 1551, 1541 and 1431, and Voronoi polyhedra with <0,3,6,1>, <0,2,8,1>, <0,0,12,0> and <0,2,8,4>. Icosahedral medium range orders (IMROs) are formed from icosahedra via the linkage of vertex-, edge-, face- and intercross-shared atoms. The glass structure on the nanometer scale is accumulated by polyhedra through an efficient packing mode. It is suggested that the extraordinary glass-forming ability of this alloy is essentially attributable to the formation of ISRO and IMRO, and the dense packing of atoms.

  5. In Silico Molecular Modeling and Docking Studies on Novel Mutants (E229V, H225P and D230C) of the Nucleotide-Binding Domain of Homo sapiens Hsp70.

    Science.gov (United States)

    Elengoe, Asita; Hamdan, Salehhuddin

    2017-12-01

    In this study, we explored the possibility of determining the synergistic interactions between nucleotide-binding domain (NBD) of Homo sapiens heat-shock 70 kDa protein (Hsp70) and E1A 32 kDa of adenovirus serotype 5 motif (PNLVP) in the efficiency of killing of tumor cells in cancer treatment. At present, the protein interaction between NBD and PNLVP motif is still unknown, but believed to enhance the rate of virus replication in tumor cells. Three mutant models (E229V, H225P and D230C) were built and simulated, and their interactions with PNLVP motif were studied. The PNLVP motif showed the binding energy and intermolecular energy values with the novel E229V mutant at -7.32 and -11.2 kcal/mol. The E229V mutant had the highest number of hydrogen bonds (7). Based on the root mean square deviation, root mean square fluctuation, hydrogen bonds, salt bridge, secondary structure, surface-accessible solvent area, potential energy and distance matrices analyses, it was proved that the E229V had the strongest and most stable interaction with the PNLVP motif among all the four protein-ligand complex structures. The knowledge of this protein-ligand complex model would help in designing Hsp70 structure-based drug for cancer therapy.

  6. Demonstration of 575-Mb/s downlink and 225-Mb/s uplink bi-directional SCM-WDM visible light communication using RGB LED and phosphor-based LED.

    Science.gov (United States)

    Wang, Yuanquan; Wang, Yiguang; Chi, Nan; Yu, Jianjun; Shang, Huiliang

    2013-01-14

    We propose and experimentally demonstrate a novel full-duplex bi-directional subcarrier multiplexing (SCM)-wavelength division multiplexing (WDM) visible light communication (VLC) system based on commercially available red-green-blue (RGB) light emitting diode (LED) and phosphor-based LED (P-LED) with 575-Mb/s downstream and 225-Mb/s upstream transmission, employing various modulation orders of quadrature amplitude modulation (QAM) orthogonal frequency division multiplexing (OFDM). For the downlink, red and green colors/wavelengths are assigned to carry useful information, while blue chip is just kept lighting to maintain the white color illumination, and for the uplink, the low-cost P-LED is implemented. In this demonstration, pre-equalization and post-equalization are also adopted to compensate the severe frequency response of LEDs. Using this scheme, 4-user downlink and 1-user uplink transmission can be achieved. Furthermore, it can support more users by adjusting the bandwidth of each sub-channel. Bit error rates (BERs) of all links are below pre-forward-error-correction (pre-FEC) threshold of 3.8x 10(-3) after 66-cm free-space delivery. The results show that this scheme has great potential in the practical VLC system.

  7. Effect of temper and hydrogen embrittlement on mechanical properties of 2,25Cr–1Mo steel grades – Application to Minimum Pressurizing Temperature (MPT) issues. Part II: Vintage reactors and MPT determination

    International Nuclear Information System (INIS)

    Pillot, Sylvain; Chauvy, Cédric; Corre, Stéphanie; Coudreuse, Lionel; Gingell, Andrew; Héritier, Déborah; Toussaint, Patrick

    2013-01-01

    Standard and Vanadium-alloyed 2,25Cr–1Mo steel grades (EN 10028-2 12CrMo9-10/ASTM A387 gr. 22 and 13CrMoV9-10/ASTM A542 tp. D) are commonly used for the fabrication of heavy pressure vessels for applications in petroleum refining plants. These reactors are made of heavy plates, forged shells, forged nozzles and fittings. They are subjected to thermal cycles (stop and go) and to severe service conditions (high temperatures and high hydrogen partial pressures). A primary concern for end-users is the definition of the Minimum Pressurizing Temperature (MPT) of the equipment. This temperature is the lowest temperature at which the vessel can be repressurized after shutdown and insures no risk of brittle failure of the containment body. The MPT is defined by fracture mechanics and/or CVN approaches and calculations. This second part of the paper presents the methodology of MPT determination and the particular case of vintage reactors. MPT determination methodology is explained by using a virtual pressure vessel representative of vessels found in petroleum refineries. A special focus is also set on the evolution of embedded defects

  8. Effect of temper and hydrogen embrittlement on mechanical properties of 2,25Cr–1Mo steel grades – Application to Minimum Pressurizing Temperature (MPT) issues. Part I: General considerations and materials' properties

    International Nuclear Information System (INIS)

    Pillot, Sylvain; Chauvy, Cédric; Corre, Stéphanie; Coudreuse, Lionel; Gingell, Andrew; Héritier, Déborah; Toussaint, Patrick

    2013-01-01

    Standard and Vanadium-alloyed 2,25Cr–1Mo steel grades (EN 10028-2 12CrMo9-10/ASTM A387 gr. 22 and 13CrMoV9-10/ASTM A542 tp. D) are commonly used for the fabrication of heavy pressure vessels for applications in petroleum refining plants. These reactors are made of heavy plates, forged shells, forged nozzles and fittings. They are subjected to thermal cycles (stop and go) and to severe service conditions (high temperatures and high hydrogen partial pressures). A primary concern for end-users is the definition of the Minimum Pressurizing Temperature (MPT) of the equipment. This temperature is the lowest temperature at which the vessel can be repressurized after shutdown and insures no risk of brittle failure of the containment body. The MPT is defined by fracture mechanics and/or CVN approaches and calculations. This first part of the paper presents the impact of thermal aging and exposure to hydrogen on materials' mechanical properties and consequently on the value of MPT

  9. Measurement of inclusive ep cross sections at high Q{sup 2} at √(s) = 225 and 252 GeV and of the longitudinal proton structure function F{sub L} at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Andreev, V.; Belousov, A.; Fomenko, A.; Gogitidze, N.; Lebedev, A.; Malinovski, E.; Rusakov, S.; Vazdik, Y. [Lebedev Physical Institute, Moscow (Russian Federation); Baghdasaryan, A.; Baghdasaryan, S.; Zohrabyan, H. [Yerevan Physics Institute, Yerevan (Armenia); Begzsuren, K.; Ravdandorj, T.; Tseepeldorj, B. [Institute of Physics and Technology of the Mongolian Academy of Sciences, Ulaanbaatar (Mongolia); Belov, P.; Brinkmann, M.; Britzger, D.; Campbell, A.J.; Dodonov, V.; Eckerlin, G.; Elsen, E.; Fleischer, M.; Gayler, J.; Ghazaryan, S.; Glazov, A.; Gouzevitch, M.; Grebenyuk, A.; Habib, S.; Haidt, D.; Kleinwort, C.; Krueger, K.; Levonian, S.; Lipka, K.; List, B.; List, J.; Lobodzinski, B.; Meyer, A.B.; Meyer, J.; Niebuhr, C.; Olsson, J.E.; Ozerov, D.; Pahl, P.; Petrukhin, A.; Pirumov, H.; Pitzl, D.; Placakyte, R.; Radescu, V.; Raspereza, A.; Schmitt, S.; Sefkow, F.; Shushkevich, S.; South, D.; Steder, M.; Wuensch, E. [DESY, Hamburg (Germany); Boudry, V.; Specka, A. [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Bradt, G. [Oxford University, Department of Physics, Oxford (United Kingdom); Brisson, V.; Jacquet, M.; Pascaud, C.; Zhang, Z.; Zomer, F. [LAL, Universite Paris-Sud, CNRS/IN2P3, Orsay (France); Buniatyan, A.; Huber, F.; Sauter, M.; Schoening, A. [Universitaet Heidelberg, Physikalisches Institut, Heidelberg (Germany); Bylinkin, A.; Bystritskaya, L.; Fedotov, A.; Rostovtsev, A. [Institute for Theoretical and Experimental Physics, Moscow (Russian Federation); Cantun Avila, K.B.; Contreras, J.G. [CINVESTAV, Departamento de Fisica Aplicada, Merida, Yucatan (Mexico); Ceccopieri, F.; Wolf, E.A. de; Favart, L.; Hreus, T.; Janssen, X.; Roosen, R.; Mechelen, P. van [Brussels and Universiteit Antwerpen, Inter-University Institute for High Energies ULB-VUB, Antwerp (Belgium); Cerny, K.; Pokorny, B.; Polifka, R.; Salek, D.; Valkarova, A.; Zacek, J.; Zlebcik, R. [Charles University, Faculty of Mathematics and Physics, Prague (Czech Republic); Chekelian, V.; Grindhammer, G.; Kiesling, C.; Olivier, B. [Max-Planck-Institut fuer Physik, Munich (Germany); Dainton, J.B.; Gabathuler, E.; Greenshaw, T.; Klein, M.; Kretzschmar, J.; Laycock, P.; Maxfield, S.J.; Mehta, A.; Patel, G.D. [University of Liverpool, Department of Physics, Liverpool (United Kingdom); Daum, K.; Meyer, H. [Universitaet Wuppertal, Fachbereich C, Wuppertal (Germany); Diaconu, C.; Hoffmann, D.; Sauvan, E.; Vallee, C. [CPPM, Aix-Marseille Univ, CNRS/IN2P3, Marseille (France); Dobre, M.; Rotaru, M. [National Institute for Physics and Nuclear Engineering (NIPNE), Bucharest (Romania); Dossanov, A. [Universitaet Hamburg, Institut fuer Experimentalphysik, Hamburg (Germany); Max-Planck-Institut fuer Physik, Munich (Germany); Dubak, A. [Max-Planck-Institut fuer Physik, Munich (Germany); University of Montenegro, Faculty of Science, Podgorica (Montenegro); Egli, S.; Hildebrandt, M.; Horisberger, R. [Paul Scherrer Institut, Villigen (Switzerland); Feltesse, J.; Perez, E.; Schoeffel, L. [CEA, DSM/Irfu, CE-Saclay, Gif-sur-Yvette (France); Ferencei, J. [Slovak Academy of Sciences, Institute of Experimental Physics, Kosice (Slovakia); Goerlich, L.; Mikocki, S.; Nowak, G.; Sopicki, P.; Turnau, J. [Institute for Nuclear Physics, Cracow (Poland); Grab, C. [ETH, Institut fuer Teilchenphysik, Zurich (Switzerland); Henderson, R.C.W. [University of Lancaster, Department of Physics, Lancaster (United Kingdom); Herbst, M.; Jung, A.W.; Schultz-Coulon, H.C. [Universitaet Heidelberg, Kirchhoff-Institut fuer Physik, Heidelberg (Germany); Hladka, J.; Reimer, P. [Academy of Sciences of the Czech Republic, Institute of Physics, Prague (Czech Republic); Jung, H. [Brussels and Universiteit Antwerpen, Inter-University Institute for High Energies ULB-VUB, Antwerp (Belgium); DESY, Hamburg (Germany); Kapichine, M.; Morozov, A.; Spaskov, V. [Joint Institute for Nuclear Research, Dubna (RU); Kogler, R.; Nowak, K. [Universitaet Hamburg, Institut fuer Experimentalphysik, Hamburg (DE); Kostka, P.; Lange, W.; Naumann, T. [DESY, Zeuthen (DE); Landon, M.P.J.; Rizvi, E.; Traynor, D. [University of London, School of Physics and Astronomy, Queen Mary, London (GB); Lubimov, V. [Institute for Theoretical and Experimental Physics, Moscow (RU); Martyn, H.U. [I. Physikalisches Institut der RWTH, Aachen (DE); Mueller, K.; Robmann, P.; Straumann, U.; Truoel, P. [Physik-Institut der Universitaet Zuerich, Zurich (CH); Newman, P.R.; Thompson, P.D. [School of Physics and Astronomy, University of Birmingham, Birmingham (GB); Picuric, I.; Raicevic, N. [University of Montenegro, Faculty of Science, Podgorica (ME); Sankey, D.P.C. [STFC, Rutherford Appleton Laboratory, Oxfordshire (GB); Soloviev, Y. [DESY, Hamburg (DE); Lebedev Physical Institute, Moscow (RU); Stella, B. [Universita di Roma Tre (IT); INFN Roma 3, Dipartimento di Fisica, Rome (IT); Sykora, T. [Brussels and Universiteit Antwerpen, Inter-University Institute for High Energies ULB-VUB, Antwerp (BE); Charles University, Faculty of Mathematics and Physics, Prague (CZ); Tsakov, I. [Institute for Nuclear Research and Nuclear Energy, Sofia (BG); Wegener, D. [Institut fuer Physik, TU Dortmund, Dortmund (DE); Collaboration: H1 Collaboration

    2014-04-15

    Inclusive ep double differential cross sections for neutral current deep inelastic scattering are measured with the H1 detector at HERA.The data were taken with a lepton beam energy of 27.6 GeV and two proton beam energies of E{sub p} = 460 and 575 GeV corresponding to centre-of-mass energies of 225 and 252 GeV, respectively. The measurements cover the region of 6.5 x 10{sup -4} ≤ x ≤ 0.65 for 35 ≤ Q{sup 2} ≤ 800 GeV{sup 2} up to y = 0.85. The measurements are used together with previously published H1 data at E{sub p} = 920 GeV and lower Q{sup 2} data at E{sub p} = 460, 575 and 920 GeV to extract the longitudinal proton structure function F{sub L} in the region 1.5 ≤ Q{sup 2} ≤ 800 GeV{sup 2}. (orig.)

  10. THE FIRST Hi-GAL OBSERVATIONS OF THE OUTER GALAXY: A LOOK AT STAR FORMATION IN THE THIRD GALACTIC QUADRANT IN THE LONGITUDE RANGE 216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5

    Energy Technology Data Exchange (ETDEWEB)

    Elia, D.; Molinari, S.; Schisano, E.; Pestalozzi, M.; Benedettini, M.; Di Giorgio, A. M.; Pezzuto, S.; Rygl, K. L. J. [Istituto di Astrofisica e Planetologia Spaziali-INAF, Via Fosso del Cavaliere 100, I-00133 Roma (Italy); Fukui, Y.; Hayakawa, T.; Yamamoto, H. [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Olmi, L. [Osservatorio Astrofisico di Arcetri-INAF, Largo E. Fermi 5, I-50125 Firenze (Italy); Veneziani, M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Schneider, N.; Piazzo, L. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universit Paris Diderot, F-91191 Gif-sur-Yvette (France); Ikhenaode, D. [DIET-Dipartimento di Ingegneria dell' Informazione, Elettronica e Telecomunicazioni, Universita di Roma La Sapienza, via Eudossina 18, I-00184 Roma (Italy); Mizuno, A. [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Onishi, T. [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Polychroni, D. [Department of Astrophysics, Astronomy and Mechanics, Faculty of Physics, University of Athens, Panepistimiopolis, 15784 Zografos, Athens (Greece); Maruccia, Y., E-mail: davide.elia@iaps.inaf.it [Dipartimento di Matematica e Fisica, Universita del Salento, CP 193, I-73100 Lecce (Italy)

    2013-07-20

    We present the first Herschel PACS and SPIRE photometric observations in a portion of the outer Galaxy (216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5 and -2 Degree-Sign {approx}< b {approx}< 0 Degree-Sign ) as a part of the Hi-GAL survey. The maps between 70 and 500 {mu}m, the derived column density and temperature maps, and the compact source catalog are presented. NANTEN CO(1-0) line observations are used to derive cloud kinematics and distances so that we can estimate distance-dependent physical parameters of the compact sources (cores and clumps) having a reliable spectral energy distribution that we separate into 255 proto-stellar and 688 starless sources. Both typologies are found in association with all the distance components observed in the field, up to {approx}5.8 kpc, testifying to the presence of star formation beyond the Perseus arm at these longitudes. Selecting the starless gravitationally bound sources, we identify 590 pre-stellar candidates. Several sources of both proto- and pre-stellar nature are found to exceed the minimum requirement for being compatible with massive star formation based on the mass-radius relation. For the pre-stellar sources belonging to the Local arm (d {approx}< 1.5 kpc) we study the mass function whose high-mass end shows a power law N(log M){proportional_to}M {sup -1.0{+-}0.2}. Finally, we use a luminosity versus mass diagram to infer the evolutionary status of the sources, finding that most of the proto-stellar sources are in the early accretion phase (with some cases compatible with a Class I stage), while for pre-stellar sources, in general, accretion has not yet started.

  11. Continuous gradient temperature Raman spectroscopy of the long chain polyunsaturated fatty acids docosapentaenoic (DPA, 22:5n-6) and docosahexaenoic (DHA; 22:6n-3) from -100 to 20° C

    Science.gov (United States)

    Broadhurst, C. Leigh; Schmidt, Walter F.; Kim, Moon S.; Nguyen, Julie K.; Qin, Jianwei; Chao, Kuanglin; Bauchan, Gary L.; Shelton, Daniel R.

    2016-05-01

    The structural, cognitive and visual development of the human brain and retina strictly require long-chain polyunsaturated fatty acids (LC-PUFA). Excluding water, the mammalian brain is about 60% lipid. One of the great unanswered questions with respect to biological science in general is the absolute necessity of the LC-PUFA docosahexaenoic acid (DHA; 22:6n-3) in these fast signal processing tissues. A lipid of the same chain length with just one less diene group, docosapentaenoic acid (DPA; 22:5n-6) is fairly abundant in terrestrial food chains yet cannot substitute for DHA. Gradient Temperature Raman spectroscopy (GTRS) applies the temperature gradients utilized in differential scanning calorimetry to Raman spectroscopy, providing a straightforward technique to identify molecular rearrangements that occur near and at phase transitions. Herein we apply GTRS to DPA, and DHA from -100 to 20°C. 20 Mb three-dimensional data arrays with 1°C increments and first/second derivatives allows complete assignment of solid, liquid and transition state vibrational modes, including low intensity/frequency vibrations that cannot be readily analyzed with conventional Raman. DPA and DHA show significant spectral changes with premelting (-33 and -60°C, respectively) and melting (-27 and -44°C, respectively). The CH2-(HC=CH)-CH2 moieties are not identical in the second half of the DHA and DPA structures. The DHA molecule contains major CH2 twisting (1265 cm-1) with no noticeable CH2 bending, consistent with a flat helical structure with small pitch. Further modeling of neuronal membrane phospholipids must take into account this structure for DHA, which would be configured parallel to the hydrophilic head group line.

  12. 9 CFR 354.225 - Lavatory accommodations.

    Science.gov (United States)

    2010-01-01

    ... AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY... facilities serving areas where dressed rabbits and edible products are prepared shall be operated by other...

  13. 48 CFR 225.103 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... covered by the World Trade Organization Government Procurement Agreement, the Under Secretary of Defense...) In order not to impair integration of the military and commercial industrial base. (B) Except as...

  14. 12 CFR 225.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... institution or a trust company, as provided in sections 2(a)(5)(E) and (F) of the BHC Act. (2) Except for the... maintain a specific capital level for any capital measure. (2) Insured and uninsured depository institution... capitalized” means that the institution has and maintains at least the capital levels required to be well...

  15. 25 CFR 225.21 - Negotiation procedures.

    Science.gov (United States)

    2010-04-01

    ... setting forth the duration of the minerals agreement; (3) A statement providing indemnification to the... accounting and mineral valuation procedures; (8) Provisions establishing operating and management procedures... refusal by the Indian mineral owner in the event of a proposed assignment; (10) Bond requirements; (11...

  16. 24 CFR 266.225 - Labor standards.

    Science.gov (United States)

    2010-04-01

    ... FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Program Requirements... contractors or subcontractors on a project insured under this part shall be paid not less than the wages... accordance with the Davis-Bacon Act, as amended (40 U.S.C. 276a-276a-5), where the project meets all of the...

  17. 31 CFR 225.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... agency official having authority under Federal law or regulation to approve a bond with surety or... maintenance of a Government obligation is represented by an accounting entry or electronic record and not by a... Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE...

  18. Vana praavusk Roth 225 / Milvi Hirvlaane

    Index Scriptorium Estoniae

    Hirvlaane, Milvi, 1936-

    2008-01-01

    Baltisaksa päritolu eesti vaimulikust, koolitegelasest ja luuletajast Johann Philipp von Rothist, tema osast Eesti kultuuriloos, võru keele arendamises, talurahvaseaduse ettevalmistamises ja paljus muus

  19. 48 CFR 225.003 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... unincorporated concern having its principal place of business in the United States. (4) Domestic end product has... are qualifying countries: Australia Austria Belgium Canada Denmark Egypt Finland France Germany Greece...

  20. 48 CFR 225.7002-2 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... when needed in a satisfactory quality and sufficient quantity at U.S. market prices. (See the... byproducts of cotton or wool fiber for use in the production of propellants and explosives. (l) Acquisitions... fabric itself), if— (1) The fabric is to be used as a component of an end product that is not a textile...

  1. 225-IJBCS-Article-Dr A Toguyeni

    African Journals Online (AJOL)

    RHUMSIKI

    Mots clés: Diversité ichtyologique, dynamique des populations, bassin de la Comoé, Burkina Faso. INTRODUCTION ... projet Gestion de la Pêche dans le Sud-Ouest. (GPSO) a .... contrôle des ressources piscicoles au regard de la législation ...

  2. Publications | Page 225 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chronic Pesticide Poisoning from Persistent Low-dose Exposures in Ecuadorean Floriculture Workers: Toward Validating a Low-cost Test Battery (restricted access). Chronic pesticide poisoning is difficult to detect. We sought to develop a low-cost test battery for settings such as Ecuador''s floriculture industry. First we had to ...

  3. 21 CFR 225.142 - Components.

    Science.gov (United States)

    2010-04-01

    .... Adequate procedures shall be established and maintained for the identification, storage, and inventory control (receipt and use) of all Type A medicated articles and Type B medicated feeds intended for use in... these drug sources. Packaged Type A medicated articles and Type B medicated feeds shall be stored in...

  4. 48 CFR 225.7603 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ..., technology, data, or services for intelligence or classified purposes, or to the acquisition or lease thereof, in the interest of national security. ... threshold; (b) Contracts for consumable supplies, provisions, or services for the support of United States...

  5. 19 CFR 351.225 - Scope rulings.

    Science.gov (United States)

    2010-04-01

    ... review, the Secretary, where practicable, will include sales of that product for purposes of the review... of the initiation of the review, the Secretary may consider sales of the product for purposes of the... any bonds relating to this product. (4) If, within 90 days of the initiation of a review of an order...

  6. 49 CFR 225.3 - Applicability.

    Science.gov (United States)

    2010-10-01

    ...) Rail mass transit operations in an urban area that are not connected with the general railroad system... its line: (i) A public highway-rail grade crossing that is in use; (ii) An at-grade rail crossing that... common corridor with a railroad, i.e., its operations are within 30 feet of those of any railroad. (b...

  7. 2 CFR 225.10 - Authority.

    Science.gov (United States)

    2010-01-01

    ... Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR STATE, LOCAL... authority of the Budget and Accounting Act of 1921, as amended; the Budget and Accounting Procedures Act of 1950, as amended; the Chief Financial Officers Act of 1990; Reorganization Plan No. 2 of 1970; and...

  8. Gender | Page 225 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... theory, introduces competing theoretical frameworks, and examines new and emerging debates. ... de jeunes chercheurs par l'entremise de son Programme de formation et de bourses (PFB). ... En quoi est-ce que cela aidera Veronica ?

  9. 225-B ion exchange piping design documentation

    International Nuclear Information System (INIS)

    Prather, M.C.

    1996-02-01

    This document describes the interface between the planned permanent ion exchange piping system and the planned portable ion exchange system. This is part of the Waste Encapsulation and Storage Facility (WESF). In order to decouple this WESF from B-Plant and to improve recovery from a capsule leak, contaminated pool cell water will be recirculated through a portable ion exchange resin system

  10. 24 CFR 91.225 - Certifications.

    Science.gov (United States)

    2010-04-01

    ... provided family violence prevention or treatment services under any project assisted under the ESG program, including protection against the release of the address or location of any family violence shelter project... be included in the annual submission to HUD. (See definition of “certification” in § 91.5.) (1...

  11. 18 CFR 225.2 - General instructions.

    Science.gov (United States)

    2010-04-01

    ..., all removal and restoration activities are completed, and all costs are retired from the accounting records unless accounting adjustments resulting from reclassification and original costs studies have been...” constitutes authorization for destruction of records at managements' discretion if it does not conflict with...

  12. 25 CFR 225.30 - Bonds.

    Science.gov (United States)

    2010-04-01

    ... letter of credit shall be payable to the Bureau of Indian Affairs on demand, in part or in full, upon... insured, explicitly granting the Secretary full authority to demand immediate payment in case of default... (5) Letter of credit issued by a financial institution authorized to do business in the United States...

  13. 12 CFR 225.71 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Board or Reserve Bank as a person who performs the functions of a director for purposes of this subpart... Bank that it is in troubled condition for purposes of the requirements of this subpart on the basis of... Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM BANK HOLDING...

  14. 49 CFR 225.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... means any abnormal condition or disorder, as diagnosed by a physician or other licensed health care... employee; (D) Occupational tuberculosis of a railroad employee; or (E) Musculoskeletal disorder of a railroad employee if this disorder is independently reportable under one or more of the general reporting...

  15. 49 CFR 225.25 - Recordkeeping.

    Science.gov (United States)

    2010-10-01

    ...; (18) Date and time when employee notified company personnel of condition; military time or AM/PM; (19... organizational level establishment, such as one of the following: an operating division headquarters; a major classification yard or terminal headquarters; a major equipment maintenance or repair installation, e.g., a...

  16. BOOK REVIEWS : BOEKRESENSIES 225 3 Maart 1956

    African Journals Online (AJOL)

    25. The Lympathic System. 26. The Cranium and its Contents. 27. The Spine. Spinal Cord and .... In the editors words: 'This ca e and the one ... Acknowledgements. Glossary. This book, by a distinguished biochemist, provides a readable.

  17. 12 CFR 225.4 - Corporate practices.

    Science.gov (United States)

    2010-01-01

    ... bank holding company's financial condition, after giving effect to the proposed purchase or redemption... and agencies not advertise or suggest that they are responsible for the obligations of a securities... customer information and consumer information. A bank holding company shall comply with the Interagency...

  18. 25 CFR 225.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... against alienation imposed by the United States. Indian mineral owner means any individual Indian or... in trust by the United States or is subject to a restriction against alienation imposed by the United... which is held in trust by the United States or is subject to a restriction against alienation imposed by...

  19. 12 CFR 225.62 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Subcommittee of the Federal Financial Institutions Examination Council. (d) Business loan means a loan or... prepared by a qualified appraiser setting forth an opinion as to the market value of an adequately described property as of a specific date(s), supported by the presentation and analysis of relevant market...

  20. Publications | Page 225 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explore outputs from more than four decades of IDRC-supported research. ... and access to electricity are the three (out of six) key variables that played a critical positive ... Qualitative data for the study was collected through gender disaggregated group discussions (GDs) in two districts, Mvomero and Kongwa in Tanzania.

  1. 49 CFR 571.225 - Standard No. 225; Child restraint anchorage systems.

    Science.gov (United States)

    2010-10-01

    .... A steel cable is connected to the X point through which the test force is applied. S8.1Apply the... tightened to a tension of not less than 53.5 N and not more than 67 N on the webbing portion of the belt.... While maintaining the force, tighten the vehicle seat belt to a tension of not less than 53.5 N and not...

  2. Vapor pressure and specific electrical conductivity in the solid and molten H2O-CsH2PO4-CsPO3 system—a novel electrolyte for water electrolysis at ~ 225–400 °C

    DEFF Research Database (Denmark)

    Nikiforov, Aleksey Valerievich; Berg, Rolf W.; Bjerrum, Niels J.

    2018-01-01

    Cesium dihydrogen phosphate, CsH2PO4 (CDP) was studied for water electrolysis at ~ 225–400 °C. In the presence of sufficient humidity, CDP is structurally disordered and super-protonic conducting with conductivities reaching 0.2–0.25 S cm−1, when determined in suitable H-shaped sealed conductivity...... on internal reference gases. Pressures up to ~ 49 bar were estimated, much higher than previously expected. Conductivities were given as polynomials and plotted in solid and liquid states. Water splitting electrolysis 2H2O → 2H2 + O2 was demonstrated by Raman at ~ 355 °C under a water pressure of ~ 23 bar...... in a quartz cell with platinum electrodes, showing molten CDP to have significant potential for water electrolysis....

  3. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. II. Changes in progression rate and cell sequence between the stage irradiated and nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Carlson, J.G.

    1976-01-01

    Portions of embryos of the grasshopper, Chortophaga viridifasciata (DeGeer), were cultured in hanging drops under quartz cover slips. Immediately after exposure to 225, 265, or 280 nm radiation, microscope observations at 38 0 C were begun. The morphologically identified stage and the time after treatment of selected neuroblasts were recorded at short-time intervals until prometaphase was reached. Mitotic retardation induced by irradiation of prereplication stages (metaphase, anaphase, or early telophase) or S phase (middle or late telophase, interphase, or very early prophase) is greatest in postreplication stages (early, middle, and late prophase) and absent or minimal in stages morphologically identified as parts of S phase. Ultraviolet irradiation superimposes on the normal diversity of progression rates an additional variation factor, so that cells do not necessarily reach prometaphase in the order of their sequence at the time of treatment. This suggests the need for caution in ascribing particular radiosensitivities to substages of limited duration on the basis of the order in which they attain a subsequent stage

  4. 45 CFR 225.2 - State plan requirements.

    Science.gov (United States)

    2010-10-01

    ... under titles I, X, XIV, or XVI (AABD) of the Social Security Act for Guam, Puerto Rico and the Virgin... to enter employment at the subprofessional level and, according to their abilities, through work... increasing responsibility and reward; (4) An organized training program, supervision, and supportive services...

  5. 7 CFR 225.8 - Records and reports.

    Science.gov (United States)

    2010-01-01

    .... (a) Each State agency shall maintain complete and accurate current accounting records of its Program... must also notify the appropriate FNSRO within 5 working days after they approve each private nonprofit... estimated daily attendance that was previously provided; (ii) The hours and type(s) of approved meal service...

  6. Dicty_cDB: SSC225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MSFMEVSAKTRSNIEEVFNETVRCVKRKYDLHN KDKSKDGKDIKKKNSIIKKLNQKVNNTKNSICKMX*iiwn*niyvxitnck*fartdie* xsxxc...wn*niyvxitnck*fartdie* xsxxcv*lni*i*k Translated Amino Acid sequence (All Frames)...DSDDVXIM MIGNKSDLDDERQVTYQEGKDLARCFGMSFMEVSAKTRSNIEEVFNETVRCVKRKYDLHN KDKSKDGKDIKKKNSIIKKLNQKVNNTKNSICKMX*ii

  7. 50 CFR 600.225 - Rules of conduct.

    Science.gov (United States)

    2010-10-01

    ..., and Council employees are subject to most Federal criminal statutes covering bribery, conflict-of... are responsible for maintaining high standards of ethical conduct among themselves, their staffs, and...

  8. All projects related to | Page 225 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-03-01

    CIFSRF). Project. Ethiopia has one of the highest rates of malnutrition in the world. Start Date: March 1, 2012. End Date: September 1, 2014. Topic: AGRICULTURAL INNOVATIONS, PLANT BREEDING, NUTRITION, Farming Systems, RURAL ...

  9. 48 CFR 225.7703-2 - Determination requirements.

    Science.gov (United States)

    2010-10-01

    ... or services to be used only by the military forces, police, or other security personnel of Iraq or... only by the military forces, police, or other security personnel of Iraq or Afghanistan; and (2... the military forces, police, or other security personnel of Iraq or Afghanistan, the following...

  10. 12 CFR 225.125 - Investment adviser activities.

    Science.gov (United States)

    2010-01-01

    ... SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding...” to the list of activities it has determined to be so closely related to banking or managing or... organization except at infrequent intervals and does not stand ready to redeem its shares. (d) The Board...

  11. 4 CFR 22.5 - Pleadings [Rule 5].

    Science.gov (United States)

    2010-01-01

    ... complaint and answer, are determined by express or implied consent of the parties as having been raised... ACCOUNTABILITY OFFICE GENERAL PROCEDURES RULES OF PROCEDURE OF THE GOVERNMENT ACCOUNTABILITY OFFICE CONTRACT...; identifying the contract provision or provisions under which relief is claimed; and stating the amount in...

  12. 7 CFR 225.6 - State agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ... the school's free and reduced price policy, a revised policy statement must be provided at the State... enrolled and the projected number of children eligible for free and reduced price meals for each of these... number of children eligible for free and reduced price school meals for each of these sites; and (D) For...

  13. 5 CFR 532.225 - Nonappropriated fund survey jobs.

    Science.gov (United States)

    2010-01-01

    ... agency shall survey the following required jobs: Job title Job grade Janitor (Light) 1 Food Service Worker 1 Food Service Worker 2 Fast Food Worker 2 Janitor 2 Laborer (Light) 2 Laborer (Heavy) 3 Service... Warehouseman 5 Service Station Attendant 5 Truck Driver (Light) 5 Truck Driver (Medium) 6 Truck Driver (Heavy...

  14. 22 CFR 513.225 - Failure to adhere to restrictions.

    Science.gov (United States)

    2010-04-01

    ... shall not knowingly do business under a covered transaction with a person who is— (1) Debarred or... excluded from the covered transaction. (b) Violation of the restriction under paragraph (a) of this section may result in disallowance of costs, annulment or termination of award, issuance of a stop work order...

  15. PODAAC-ASOP2-25X01

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains operational near-real-time Level 2 ocean surface wind vector retrievals from the Advanced Scatterometer (ASCAT) on MetOp-A at 25 km sampling...

  16. PODAAC-ASOP2-25B01

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains operational near-real-time Level 2 ocean surface wind vector retrievals from the Advanced Scatterometer (ASCAT) on MetOp-B at 25 km sampling...

  17. 7 CFR 2.25 - Assistant Secretary for Civil Rights.

    Science.gov (United States)

    2010-01-01

    ...). (24) Related to conflict management. (i) Designate the senior official to serve as the Department... seq., and provide leadership, direction and coordination for the Department's conflict prevention and... Alternative Dispute Resolution (ADR) to resolve employment complaints and grievances, workplace disputes...

  18. 21 CFR 225.135 - Work and storage areas.

    Science.gov (United States)

    2010-04-01

    ... used for the manufacture and storage of fertilizers, herbicides, insecticides, fungicides, rodenticides, and other pesticides unless such articles are approved or index listed for use in the manufacture of...

  19. 12 CFR 225.24 - Procedures for other nonbanking proposals.

    Science.gov (United States)

    2010-01-01

    ... FEDERAL RESERVE SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations... listed activities. A bank holding company seeking to acquire or control voting securities or assets of a..., internal controls and risk management systems that will be utilized in the conduct of the proposed...

  20. 48 CFR 252.225-7021 - Trade agreements.

    Science.gov (United States)

    2010-10-01

    ..., Hong Kong, Hungary, Iceland, Ireland, Israel, Italy, Japan, Korea (Republic of), Latvia, Liechtenstein... (Australia, Bahrain, Canada, Chile, Costa Rica, Dominican Republic, El Salvador, Guatemala, Honduras, Mexico..., Chapter 98, Subchapter II, Articles Exported and Returned, Advanced or Improved Abroad, U.S. Note 7(b). (4...

  1. 48 CFR 52.225-5 - Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... Basin Trade Partnership Act of 2000. (3) Section XXII, Chapter 98, Subchapter II, Articles Exported and..., Finland, France, Germany, Greece, Hong Kong, Hungary, Iceland, Ireland, Israel, Italy, Japan, Korea..., Costa Rica, Dominican Republic, El Salvador, Guatemala, Honduras, Mexico, Morocco, Nicaragua, Oman, Peru...

  2. 12 CFR 225.28 - List of permissible nonbanking activities.

    Science.gov (United States)

    2010-01-01

    ... management official of the client institution, except where such interlocking relationship is permitted... conducting management consulting activities may provide management consulting services to customers not... customers in payment for goods and services, and purchasing from the merchant validly authorized checks that...

  3. 48 CFR 1852.225-70 - Export Licenses.

    Science.gov (United States)

    2010-10-01

    ... writing, that the Contracting Officer authorizes it to export ITAR-controlled technical data (including... licenses or other approvals, if required, for exports of hardware, technical data, and software, or for the provision of technical assistance. (b) The Contractor shall be responsible for obtaining export licenses, if...

  4. 7 CFR 225.15 - Management responsibilities of sponsors.

    Science.gov (United States)

    2010-01-01

    ... Adult Care Food Program, and the Special Supplemental Nutrition Program for Women, Infants and Children... respond to a request for approval of such bids within 5 working days of receipt. (5) Each food service... performance bond in an amount not less than ten (10) percent nor more than twenty-five (25) percent of the...

  5. 24 CFR 964.225 - Resident management requirements.

    Science.gov (United States)

    2010-04-01

    ... circumstances and providing copies of relevant materials evidencing the corporation's efforts to negotiate a...: (i) The RMC petitions HUD for the release of funds; (ii) The contract provides for the RMC to assume... this section will apply as well to the HA to the extent the waiver affects the HA's remaining...

  6. 40 CFR 98.225 - Procedures for estimating missing data.

    Science.gov (United States)

    2010-07-01

    ... accounting purposes (such as sales records). (b) For missing values related to the performance test, including emission factors, production rate, and N2O concentration, you must conduct a new performance test...

  7. 48 CFR 752.225-71 - Local procurement.

    Science.gov (United States)

    2010-10-01

    ... 1997) (a) Local procurement involves the use of appropriated funds to finance the procurement of goods... currency of the cooperating country. (b) All locally-financed procurements must be covered by source/origin...

  8. 49 CFR 225.33 - Internal Control Plans.

    Science.gov (United States)

    2010-10-01

    ... official business. Each railroad shall amend its Internal Control Plan, as necessary, to reflect any..., incident, injury or illness will not be permitted or tolerated and will result in some stated disciplinary... paragraph (a)(1). Each railroad shall have procedures to process complaints from any person about the policy...

  9. 7 CFR 225.18 - Miscellaneous administrative provisions.

    Science.gov (United States)

    2010-01-01

    ... sources for the maintenance of food programs for children shall not be diminished as a result of funds... Federal, State or local laws, including, but not limited to, laws relating to taxation, welfare, and... institution, non-profit organization/secular, non-profit organization/faith-based, and “other.” (2) On or...

  10. 12 CFR 225.66 - Professional association membership; competency.

    Science.gov (United States)

    2010-01-01

    ... appraiser may not be excluded from consideration for an assignment for a federally related transaction...) Competency. All staff and fee appraisers performing appraisals in connection with federally related... relate to the particular appraisal assignment for which he or she is being considered. ...

  11. 7 CFR 225.16 - Meal service requirements.

    Science.gov (United States)

    2010-01-01

    ... 12 and up may be served larger portions based on the greater food needs of older boys and girls. (1... necessary to meet ethnic, religious, economic, or physical needs. (6) Temporary unavailability of milk. If... served to children participating in activities which make the service of fluid milk impracticable, and in...

  12. Dicty_cDB: VSD225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yt*imskaqavgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgd mvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnp...nsadnsgaknlyviavkgikgrlnrlpsag vgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgni lgpvakecsdlwpkva

  13. 40 CFR 180.225 - Phosphine; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... Lettuce 0.01 Lime 0.01 Mango 0.01 Millet, grain 0.1 Mushroom 0.01 Nut, brazil 0.1 Oat, grain 0.1 Okra 0.01...: Commodity Parts per million Animal feed 0.1 (5) To assure safe use of this pesticide, it must be used in..., except processed brewer's rice, malt, and corn grits stored in breweries for use in the manufacture of...

  14. 31 CFR 225.6 - Payment of interest.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE ACCEPTANCE OF BONDS SECURED BY GOVERNMENT OBLIGATIONS.... Unless otherwise provided by law, such interest will be available to satisfy any costs incurred by the...

  15. 31 CFR 225.10 - Other agency practices and authorities.

    Science.gov (United States)

    2010-07-01

    ... (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE ACCEPTANCE OF BONDS... part by reason of the acceptance of bonds secured by Government obligations. (b) Agency authorities... for security in cases authorized by other provisions of law. ...

  16. 22 CFR 225.116 - General requirements for informed consent.

    Science.gov (United States)

    2010-04-01

    ... is voluntary, refusal to participate will involve no penalty or loss of benefits to which the subject... authority of a physician to provide emergency medical care, to the extent the physician is permitted to do...

  17. 48 CFR 225.7300 - Scope of subpart.

    Science.gov (United States)

    2010-10-01

    ... military sales (FMS) under the Arms Export Control Act (22 U.S.C. Chapter 39). Section 22 of the Arms Export Control Act (22 U.S.C. 2762) authorizes DoD to enter into contracts for resale to foreign countries or international organizations. (b) This subpart does not apply to— (1) FMS made from inventories...

  18. Publications | Page 225 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Projet de recherche "intégration des technologies de l'information et de la communication dans les apprentissages de base à l'école élémentaire au Sénégal" : rapport technique final (restricted access) ...

  19. 12 CFR 225.12 - Transactions not requiring Board approval.

    Science.gov (United States)

    2010-01-01

    ... Merger Act. The merger or consolidation of a subsidiary bank of a bank holding company with another bank... application under this subpart if it determines that the merger or consolidation would have a significant adverse impact on the financial condition of the bank holding company, or otherwise requires approval...

  20. 7 CFR 225.19 - Regional office addresses.

    Science.gov (United States)

    2010-01-01

    ..., District of Columbia, Maryland, New Jersey, Pennsylvania, Puerto Rico, Virginia, Virgin Islands, and West Virginia: Mid-Atlantic Regional Office, FNS, U.S. Department of Agriculture, Mercer Corporate Park, 300...

  1. 47 CFR 80.225 - Requirements for selective calling equipment.

    Science.gov (United States)

    2010-10-01

    ... Commission will not accept new applications (but will continue to process then-pending applications) for certification of non-portable DSC equipment that does not meet the requirements of ITU-R Recommendation M.493-11... Commission will not accept new applications (but will continue to process then-pending applications) for...

  2. 12 CFR 225.22 - Exempt nonbanking activities and acquisitions.

    Science.gov (United States)

    2010-01-01

    ... holding company or its subsidiaries include, but are not limited to: (i) Accounting, auditing, and... company demonstrates that each extension would not be detrimental to the public interest and either the... FEDERAL RESERVE SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations...

  3. 12 CFR 225.6 - Penalties for violations.

    Science.gov (United States)

    2010-01-01

    ... Act or any regulation or order issued under it, or for making a false entry in any book, report, or... be made in accordance with subpart C of the Board's Rules of Practice for Hearings (12 CFR part 263...

  4. 25 CFR 225.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... environmental or cultural impact resulting from such development. Pursuant to section 4 of the IMDA (25 U.S.C... duration of the minerals agreement, the rate of royalty or financial consideration, rental, or acreage... tribes from exercising their lawful governmental authority to regulate the conduct of persons, businesses...

  5. 7 CFR 225.7 - Program monitoring and assistance.

    Science.gov (United States)

    2010-01-01

    ..., food service management company representatives, auditors, and health inspectors who will participate... school closures during the period from October through April (or at any time of the year in an area with a continuous school calendar). (b) Program materials. Each State agency shall develop and make...

  6. 12 CFR 225.44 - Reporting of stock loans.

    Science.gov (United States)

    2010-01-01

    ..., including an endorsement or standby letter of credit; and any other type of transaction that extends credit... that has credit outstanding to any person or group of persons, in the aggregate, which is secured... section 1(b) of the International Banking Act of 1978 (12 U.S.C. 3101). (2) Credit outstanding includes...

  7. Can Deterrence Be Tailored? Strategic Forum, Number 225, January 2007

    National Research Council Canada - National Science Library

    Bunn, M. E

    2007-01-01

    .... The Bush administration has outlined a concept for tailored deterrence to address the distinctive challenges posed by advanced military competitors, regional powers armed with weapons of mass destruction (WMD...

  8. 48 CFR 225.872-3 - Solicitation procedures.

    Science.gov (United States)

    2010-10-01

    ... business concerns under FAR Part 19 without regard to whether there are potential qualifying country... solicitation is identified for the exclusive participation of small business concerns. (b) Send solicitations... (Acquisition, Technology, and Logistics), before excluding the qualifying country source from consideration. (f...

  9. 49 CFR 384.225 - CDLIS driver recordkeeping.

    Science.gov (United States)

    2010-10-01

    ... of any State or local law relating to motor vehicle traffic control (other than a parking violation) committed in any type of vehicle. (2) Medical certification status information. (i) Driver self-certification for the type of driving operations provided in accordance with § 383.71(a)(1)(ii) of this chapter...

  10. 29 CFR 1952.225 - Level of Federal enforcement.

    Science.gov (United States)

    2010-07-01

    ... OSHA authority to issue citations for violations of such standards under sections 5(a)(2) and 9 of the... proceedings in contested cases under section 10; to institute proceedings to correct imminent dangers under... accordance with section 18(e), final approval relinquishes Federal OSHA authority only with regard to...

  11. 12 CFR 225.52 - Limitation on overdrafts.

    Science.gov (United States)

    2010-01-01

    ... balance of the accounts of the nonbank bank, industrial bank, or affiliate, as determined by the posting... settlement day. (e) Posting by nonbank banks and industrial banks. For purposes of determining the balance of... Bank to a nonbank bank or industrial bank pursuant to the provisions of the Board's Regulation A (12...

  12. Multiple Nonconformities in Ice-Walled Lake Successions Indicate Periods with Cold Summers (24.4 - 22.5 ka, 21.1 - 19.2 ka, 18.5 - 18.1 ka) during the Last Deglaciation in Northeastern Illinois, USA

    Science.gov (United States)

    Curry, B. B.

    2014-12-01

    Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents

  13. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    International Nuclear Information System (INIS)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-01-01

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  14. Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys

    International Nuclear Information System (INIS)

    Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.

    2006-01-01

    Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation

  15. Optimizing labelling conditions of 213Bi-DOTATATE for preclinical applications of peptide receptor targeted alpha therapy.

    Science.gov (United States)

    Chan, Ho Sze; de Blois, Erik; Konijnenberg, Mark W; Morgenstern, Alfred; Bruchertseifer, Frank; Norenberg, Jeffrey P; Verzijlbergen, Fred J; de Jong, Marion; Breeman, Wouter A P

    2017-01-01

    213 Bismuth ( 213 Bi, T 1/2 = 45.6 min) is one of the most frequently used α-emitters in cancer research. High specific activity radioligands are required for peptide receptor radionuclide therapy. The use of generators containing less than 222 MBq 225 Ac (actinium), due to limited availability and the high cost to produce large-scale 225 Ac/ 213 Bi generators, might complicate in vitro and in vivo applications though.Here we present optimized labelling conditions of a DOTA-peptide with an 225 Ac/ 213 Bi generator (< 222 MBq) for preclinical applications using DOTA-Tyr 3 -octreotate (DOTATATE), a somatostatin analogue. The following labelling conditions of DOTATATE with 213 Bi were investigated; peptide mass was varied from 1.7 to 7.0 nmol, concentration of TRIS buffer from 0.15 mol.L -1 to 0.34 mol.L -1 , and ascorbic acid from 0 to 71 mmol.L -1 in 800 μL. All reactions were performed at 95 °C for 5 min. After incubation, DTPA (50 nmol) was added to stop the labelling reaction. Besides optimizing the labelling conditions, incorporation yield was determined by ITLC-SG and radiochemical purity (RCP) was monitored by RP-HPLC up to 120 min after labelling. Dosimetry studies in the reaction vial were performed using Monte Carlo and in vitro clonogenic assay was performed with a rat pancreatic tumour cell line, CA20948. At least 3.5 nmol DOTATATE was required to obtain incorporation ≥ 99 % with 100 MBq 213 Bi (at optimized pH conditions, pH 8.3 with 0.15 mol.L -1 TRIS) in a reaction volume of 800 μL. The cumulative absorbed dose in the reaction vial was 230 Gy/100 MBq in 30 min. A minimal final concentration of 0.9 mmol.L -1 ascorbic acid was required for ~100 MBq (t = 0) to minimize radiation damage of DOTATATE. The osmolarity was decreased to 0.45 Osmol/L.Under optimized labelling conditions, 213 Bi-DOTATATE remained stable up to 2 h after labelling, RCP was ≥ 85 %. In vitro showed a negative correlation between ascorbic acid

  16. 48 CFR 225.872-8 - Subcontracting with qualifying country sources.

    Science.gov (United States)

    2010-10-01

    ... security interest reasons, mobilization base considerations, or applicable U.S. laws or regulations (see... contractor subcontracting procedures, the contracting officer shall ensure that the contract does not...

  17. 2 CFR Appendix A to Part 225 - General Principles for Determining Allowable Costs

    Science.gov (United States)

    2010-01-01

    ... based on the fundamental premises that: (1) Governmental units are responsible for the efficient and... reduce the burden associated with maintaining systems for charging administrative costs to Federal... reasonable and necessary for operating these programs, and funds are not used for general expenses required...

  18. 22.5% efficient silicon heterojunction solar cell with molybdenum oxide hole collector

    OpenAIRE

    Geissbühler Jonas; Werner Jérémie; Martin de Nicolas Silvia; Barraud Loris; Hessler-Wyser Aïcha; Despeisse Matthieu; Nicolay Sylvain; Tomasi Andrea; Niesen Bjoern; De Wolf Stefaan; Ballif Christophe

    2015-01-01

    Substituting the doped amorphous silicon films at the front of silicon heterojunction solar cells with wide bandgap transition metal oxides can mitigate parasitic light absorption losses. This was recently proven by replacing p type amorphous silicon with molybdenum oxide films. In this article we evidence that annealing above 130?°C—often needed for the curing of printed metal contacts—detrimentally impacts hole collection of such devices. We circumvent this issue by using electrodeposited c...

  19. 12 CFR 225.113 - Services under section 4(a) of Bank Holding Company Act.

    Science.gov (United States)

    2010-01-01

    ... banks: (1) Establishment and supervision of loaning policies; (2) direction of the purchase and sale of... of section 4(a)(2), is essentially the exercise of a broad governing influence of the sort usually...

  20. 48 CFR 52.225-9 - Buy American Act-Construction Materials.

    Science.gov (United States)

    2010-10-01

    ... lighting, fire alarm, and audio evacuation systems, that are discrete systems incorporated into a public... origin of the same class or kind for which nonavailability determinations have been made are treated as...) Quantity; (D) Price; (E) Time of delivery or availability; (F) Location of the construction project; (G...

  1. 48 CFR 52.225-11 - Buy American Act-Construction Materials under Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... safety systems, such as emergency lighting, fire alarm, and audio evacuation systems, that are discrete... 50 percent of the cost of all its components. Components of foreign origin of the same class or kind... description of the foreign and domestic construction materials; (B) Unit of measure; (C) Quantity; (D) Price...

  2. 48 CFR 252.225-7012 - Preference for certain domestic commodities.

    Science.gov (United States)

    2010-10-01

    ..., office, or other use); and (D) Parachutes (Federal Supply Class 1670); or (ii) The fibers and yarns are..., materials, or manufactured articles). (10) Any item of individual equipment (Federal Supply Class 8465... end product; and (ii) Does not exceed the simplified acquisition threshold in FAR part 2; (3) To waste...

  3. 12 CFR 225.141 - Operations subsidiaries of a bank holding company.

    Science.gov (United States)

    2010-01-01

    ... OF THE FEDERAL RESERVE SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y... may engage directly in the business of managing and controlling banks and permissible nonbank... generally prohibits the acquisition of shares of nonbanking organizations, the Board does not believe that...

  4. 12 CFR 225.86 - What activities are permissible for any financial holding company?

    Science.gov (United States)

    2010-01-01

    ... authority for digital signatures and authenticating the identity of persons conducting financial and... such products or services; or (2) A government or government agency that provides information concerning the services or benefits made available by the government or government agency, assists persons in...

  5. 40 CFR 745.225 - Accreditation of training programs: target housing and child-occupied facilities.

    Science.gov (United States)

    2010-07-01

    ... equipment to be used for lecture and hands-on training. (B) A copy of the course test blueprint for each.... (iii) The course test shall be developed in accordance with the test blueprint submitted with the....S. Postal Service, fax, commercial delivery service, or hand delivery (persons submitting...

  6. 12 CFR 225.200 - Conditions to Board's section 20 orders.

    Science.gov (United States)

    2010-01-01

    ...) Introduction. Under section 20 of the Glass-Steagall Act (12 U.S.C. 377) and section 4(c)(8) of the Bank... financial reporting, anti-fraud and financial responsibility rules applicable to broker-dealers. In addition... records), and instituting appropriate risk management, including independent trading and exposure limits...

  7. 12 CFR 225.17 - Notice procedure for one-bank holding company formations.

    Science.gov (United States)

    2010-01-01

    ... substantially the same proportion, except for changes in shareholders' interests resulting from the exercise of... will be considered to have the same proportional interest in the holding company if the shareholder... shareholder or shareholders who control at least 67 percent of the shares of the bank will control...

  8. 2 CFR Appendix E to Part 225 - State and Local Indirect Cost Rate Proposals

    Science.gov (United States)

    2010-01-01

    ... organizational structure of the agency during the period for which the proposal applies, along with a functional... grantee department or agency, depreciation or use allowances on buildings and equipment, the costs of... period, usually the governmental unit's fiscal year. This rate is based on an estimate of the costs to be...

  9. Ethyl 2-(2,5-dioxo-4,4-diphenylimidazolidin-1-ylacetate

    Directory of Open Access Journals (Sweden)

    Youssef Ramli

    2017-01-01

    Full Text Available The five-membered ring of the title compound, C19H18N2O4, adopts an envelope conformation. In the crystal, pairwise N—H...O hydrogen bonds form centrosymmetric dimers which are connected into chains parallel to the c-axis direction by pairwise C—H...O hydrogen bonds. A second set of C—H...O hydrogen bonds links these chains into sheets oriented parallel to (100. A combination of additional C—H...O hydrogen bonds and C—H...π(ring interactions combine the sheets into a three-dimensional network.

  10. N-{2-[2-(5-Methyl-1H-pyrazol-3-ylacetamido]phenyl}benzamide monohydrate

    Directory of Open Access Journals (Sweden)

    Karim Chkirate

    2017-02-01

    Full Text Available The asymmetric unit of the title compound, C19H18N4O2·H2O, comprises the U-shaped pyrazole derivative and a solvent water molecule. The molecular conformation is partly determined by an intramolecular N—H...O hydrogen bond. The crystal packing is directed by an extensive network of O—H...O, N—H...O, N—H...N and C—H...O hydrogen bonds together with C—H...π(ring contacts that generate a three-dimensional network.

  11. 12 CFR 225.26 - Factors considered in acting on nonbanking proposals.

    Science.gov (United States)

    2010-01-01

    ... acquired, the effect of the proposed transaction on those resources, and the management expertise, internal control and risk-management systems, and capital of the entity conducting the activity. (c) Competitive... THE FEDERAL RESERVE SYSTEM BANK HOLDING COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y...

  12. Novel Dissimilar Joints Between Alloy 800H and 2.25%Cr and 1%Mo Steel

    Energy Technology Data Exchange (ETDEWEB)

    DebRoy, Tarasankar

    2017-12-31

    Dissimilar metal joints between ferritic steels and nickel base alloys are currently fabricated using conventional arc welding processes with selected filler metal combinations. The dissimilar metal joints contain abrupt changes in composition over a relatively small distance. Many years of service at elevated temperatures has shown that these welds are susceptible to creep and creep fatigue failures. The primary mechanism for these creep failures involves carbon diffusion from the ferritic steel to the nickel base alloy. As a result, a carbon depleted zone is created that contains very few stable carbides. This work used additive manufacturing (AM) technologies as a highly controllable means for reducing carbon migration through theoretically designed, compositionally graded transition joints guided by appropriate thermodynamic, kinetic and heat transfer and fluid flow modeling. The contents of the report include the objectives and tasks set forth by the PI and collaborators, major technical accomplishments throughout the research and additional details in the form of technical publications resulting from the NEUP grant and reports from the collaborating university and national laboratory.

  13. Spatial dispersion and performance evaluation of indoor MIMO channels at 2.25 GHz

    NARCIS (Netherlands)

    Yang, Haibing; Herben, M.H.A.J.

    2004-01-01

    Channel capacity of a MIMO system is dependent not only on the signal-to-noise ratio (SNR) but also on spatial correlation among antenna elements. Therefore, the system design must rely on good propagation predictions. By using a ray tracing simulator, which considers reflections, penetrations and

  14. 12 CFR Appendix F to Part 225 - Interagency Guidelines Establishing Information Security Standards

    Science.gov (United States)

    2010-01-01

    ... Relationships Risk Management Principles,” Nov. 1, 2001; FDIC FIL 68-99, Risk Assessment Tools and Practices for.... Standards for Safeguarding Customer Information A. Information Security Program B. Objectives III. Development and Implementation of Customer Information Security Program A. Involve the Board of Directors B...

  15. Elastic scattering of 28Si + 40Ca system at Elab = 225 MeV

    International Nuclear Information System (INIS)

    Ashok Kumar; Srivastava, Amita; Kumar, Sarita; Seth, Madhup; Srivastava, B.B.; Mishra, R.C.

    1996-01-01

    The real part of nucleus-nucleus interaction for 28 Si + 40 Ca system was microscopically calculated in terms of antisymmetrised shell model wave functions using equivalence relation between RGM and GCM

  16. 40 CFR 795.225 - Dermal pharmacokinetics of DGBE and DGBA.

    Science.gov (United States)

    2010-07-01

    ... animals shall be provided with conventional laboratory diets and water ad libitum. (2) Administration of... and diethylene glycol butyl ether acetate (DGBA). (b) Test procedures—(1) Animal selection—(i) Species... in percutaneous absorption studies. (ii) Animals. Adult female Sprague Dawley rats shall be used. The...

  17. A redshift survey of very faint (B <= 22.5) field galaxies, radio sources, and quasars

    International Nuclear Information System (INIS)

    Koo, D.C.

    1983-01-01

    As part of a three year program to study the evolution of quasars, radio sources and galaxies, a 10 night redshift survey has been carried out. A few preliminary results are presented (a magnitude-redshift plot of 54 galaxies). (Auth.)

  18. SU-E-J-225: CEST Imaging in Head and Neck Cancer Patients

    International Nuclear Information System (INIS)

    Wang, J; Hwang, K; Fuller, C; Mohamed, A; Ding, Y; Frank, S; Hazle, J; Zhou, J

    2015-01-01

    Purpose: Chemical Exchange Saturation Transfer (CEST) imaging is an MRI technique enables the detection and imaging of metabolically active compounds in vivo. It has been used to differentiate tumor types and metabolic characteristics. Unlike PET/CT,CEST imaging does not use isotopes so it can be used on patient repeatedly. This study is to report the preliminary results of CEST imaging in Head and Neck cancer (HNC) patients. Methods: A CEST imaging sequence and the post-processing software was developed on a 3T clinical MRI scanner. Ten patients with Human papilloma virus positive oropharyngeal cancer were imaged in their immobilized treatment position. A 5 mm slice CEST image was acquired (128×128, FOV=20∼24cm) to encompass the maximum dimension of tumor. Twenty-nine off-set frequencies (from −7.8ppm to +7.8 ppm) were acquired to obtain the Z-spectrum. Asymmetry analysis was used to extract the CEST contrasts. ROI at the tumor, node and surrounding tissues were measured. Results: CEST images were successfully acquired and Zspectrum asymmetry analysis demonstrated clear CEST contrasts in tumor as well as the surrounding tissues. 3∼5% CEST contrast in the range of 1 to 4 ppm was noted in tumor as well as grossly involved nodes. Injection of glucose produced a marked increase of CEST contrast in tumor region (∼10%). Motion and pulsation artifacts tend to smear the CEST contrast, making the interpretation of the image contrast difficult. Field nonuniformity, pulsation in blood vesicle and susceptibility artifacts caused by air cavities were also problematic for CEST imaging. Conclusion: We have demonstrated successful CEST acquisition and Z-spectrum reconstruction on HNC patients with a clinical scanner. MRI acquisition in immobilized treatment position is critical for image quality as well as the success of CEST image acquisition. CEST images provide novel contrast of metabolites in HNC and present great potential in the pre- and post-treatment assessment of patients undergoing radiation therapy

  19. SU-E-J-225: CEST Imaging in Head and Neck Cancer Patients

    Energy Technology Data Exchange (ETDEWEB)

    Wang, J; Hwang, K; Fuller, C; Mohamed, A; Ding, Y; Frank, S; Hazle, J; Zhou, J [UT MD Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: Chemical Exchange Saturation Transfer (CEST) imaging is an MRI technique enables the detection and imaging of metabolically active compounds in vivo. It has been used to differentiate tumor types and metabolic characteristics. Unlike PET/CT,CEST imaging does not use isotopes so it can be used on patient repeatedly. This study is to report the preliminary results of CEST imaging in Head and Neck cancer (HNC) patients. Methods: A CEST imaging sequence and the post-processing software was developed on a 3T clinical MRI scanner. Ten patients with Human papilloma virus positive oropharyngeal cancer were imaged in their immobilized treatment position. A 5 mm slice CEST image was acquired (128×128, FOV=20∼24cm) to encompass the maximum dimension of tumor. Twenty-nine off-set frequencies (from −7.8ppm to +7.8 ppm) were acquired to obtain the Z-spectrum. Asymmetry analysis was used to extract the CEST contrasts. ROI at the tumor, node and surrounding tissues were measured. Results: CEST images were successfully acquired and Zspectrum asymmetry analysis demonstrated clear CEST contrasts in tumor as well as the surrounding tissues. 3∼5% CEST contrast in the range of 1 to 4 ppm was noted in tumor as well as grossly involved nodes. Injection of glucose produced a marked increase of CEST contrast in tumor region (∼10%). Motion and pulsation artifacts tend to smear the CEST contrast, making the interpretation of the image contrast difficult. Field nonuniformity, pulsation in blood vesicle and susceptibility artifacts caused by air cavities were also problematic for CEST imaging. Conclusion: We have demonstrated successful CEST acquisition and Z-spectrum reconstruction on HNC patients with a clinical scanner. MRI acquisition in immobilized treatment position is critical for image quality as well as the success of CEST image acquisition. CEST images provide novel contrast of metabolites in HNC and present great potential in the pre- and post-treatment assessment of patients undergoing radiation therapy.

  20. 12 CFR 225.172 - What are the holding periods permitted for merchant banking investments?

    Science.gov (United States)

    2010-01-01

    ... institution controlled by the financial holding company and any subsidiary of such a depository institution... company to the company and the risks that disposing of the investment may pose to the financial holding... history of involvement by the financial holding company in the management and operations of the company...