
Sample records for actinium 219

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    International Nuclear Information System (INIS)

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Spectroscopic and computational investigation of actinium coordination chemistry. (United States)

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes


    Fry, C; Thoennessen, M


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources. (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R


    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    International Nuclear Information System (INIS)

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  8. Comment: 219 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Japanese medaka Oryzias latipes Oryzias_latipes_L.png 219.png Taxonomy icon (c) Database Center for Life Sci...ence licensed under CC Attribution2.1 Japan アイコン:メダカ HNI-Ⅱ系統バージョン bando 2010/02/15 15:31:07 2010/02/16 09:53:27 ...

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    International Nuclear Information System (INIS)

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    International Nuclear Information System (INIS)

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  12. A new method for the determination of low-level actinium-227 in geological samples

    International Nuclear Information System (INIS)

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  13. 22 CFR 219.160 - Communications. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 219.160 Section 219.160 Foreign... DEVELOPMENT § 219.160 Communications. (a) The agency shall take appropriate steps to ensure effective communication with applicants, participants, personnel of other Federal entities, and members of the public....

  14. 49 CFR 219.104 - Responsive action. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Responsive action. 219.104 Section 219.104..., DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Prohibitions § 219.104 Responsive action. (a... (e) of this section apply. (3)(i) This section does not apply to actions based on breath or...

  15. 33 CFR 117.219 - Pequonnock River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pequonnock River. 117.219 Section 117.219 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.219 Pequonnock River. (a)...

  16. 12 CFR 741.219 - Investment requirements. (United States)


    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Investment requirements. 741.219 Section 741.219 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS... Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.219...

  17. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  18. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  19. 36 CFR 219.30 - Plan documentation. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Plan documentation. 219.30... National Forest System Land and Resource Management Planning Planning Documentation § 219.30 Plan documentation. A plan is a repository of documents that integrates and displays the desired...

  20. 48 CFR 219.808 - Contract negotiations. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract negotiations. 219..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.808 Contract negotiations....

  1. 48 CFR 219.708 - Contract clauses. (United States)


    ... OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 219.708 Contract clauses. (b)(1)(A) Use the clause at 252.219-7003, Small Business Subcontracting Plan... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clauses....

  2. 48 CFR 219.1005 - Applicability. (United States)


    ... Navigation System and Instrument Manufacturing 334511 (10) (i) Cellular and Other Wireless Telecommunications... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability. 219.1005 Section 219.1005 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM,...

  3. 36 CFR 219.19 - Ecological, social, and economic sustainability. (United States)


    ... economic sustainability. 219.19 Section 219.19 Parks, Forests, and Public Property FOREST SERVICE..., Social, and Economic Sustainability § 219.19 Ecological, social, and economic sustainability. Sustainability, composed of interdependent ecological, social, and economic elements, embodies the...

  4. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    International Nuclear Information System (INIS)

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  5. 36 CFR 219.7 - Plan decisions. (United States)


    ...) Limitations on even-aged timber harvest methods; (2) Maximum size openings from timber harvest; (3) Methods... (§ 219.28). (e) Monitoring strategy. A monitoring strategy is required by each plan as described in §...

  6. 36 CFR 219.9 - Revision. (United States)


    ...), and provide for an independent scientific peer review (§ 219.22) of the evaluation; (5) Identify new... conclusions from appropriate broad-scale assessments and local analyses, monitoring and evaluation...

  7. Dicty_cDB: CHR219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR219 (Link to dictyBase) - - - Contig-U16511-1 CHR219P (Link to Original site) CHR...219F 609 CHR219Z 786 CHR219P 1375 - - Show CHR219 Library CH (Link to library) Clone ID CHR...e URL Representative seq. ID CHR...219P (Link to Original site) Representative DNA sequence >CHR219 (CHR219Q) /CSM/CH/CHR2-A/**firs*ywswfkw**srrc*kprfirqircf*tsigsrrn*kprfgrscf*nhf*ir trsyssn*wsts*lyc*srnscss*inr*kcl*cllkhrtnittitt

  8. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL (United States)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  9. Radiological risk of actinon (219Rn)

    International Nuclear Information System (INIS)

    The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the 219Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of 219Rn on determinations of the concentration of the 222Rn decay chain and/or its precursors

  10. 36 CFR 219.18 - Role of advisory committees. (United States)


    .... 219.18 Section 219.18 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... members to the Secretary of Agriculture. Advisory committees used by other agencies may be utilized...)). Ecological, Social, and Economic Sustainability...

  11. 36 CFR 219.20 - Ecological sustainability. (United States)


    ... under 50 CFR part 402. The plan decision documents must provide a rationale for adoption or rejection of... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Ecological sustainability... Sustainability § 219.20 Ecological sustainability. To achieve ecological sustainability, the responsible...

  12. 22 CFR 219.103 - Definitions. (United States)


    ... CFR 1613.702(f), which is made applicable to this part by § 219.140. Section 504 means section 504 of..., emotional or mental illness, and specific learning disabilities. The term “physical or mental impairment..., mental retardation, emotional illness, and drug addition and alcholism. (2) Major life...

  13. 49 CFR 199.219 - Pre-duty use. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Pre-duty use. 199.219 Section 199.219 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.219 Pre-duty use. Each operator shall prohibit a covered employee from using...

  14. 50 CFR 300.219 - Vessel monitoring system. (United States)


    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Vessel monitoring system. 300.219 Section 300.219 Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS Western and Central Pacific Fisheries for Highly Migratory Species § 300.219 Vessel monitoring system. (a) SAC and VMS Helpdesk...

  15. 20 CFR 219.23 - Evidence to prove death. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from...

  16. 36 CFR 219.21 - Social and economic sustainability. (United States)


    ... sustainability. 219.21 Section 219.21 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Economic Sustainability § 219.21 Social and economic sustainability. To contribute to economic and social sustainability, the responsible official involves interested and affected people in planning for National...

  17. 48 CFR 1353.219 - Small business programs. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business programs. 1353.219 Section 1353.219 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS FORMS Prescription of Forms 1353.219 Small business programs. Use Form CD-570, Small Business...

  18. 48 CFR 653.219 - Small business programs. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business programs. 653.219 Section 653.219 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES AND FORMS FORMS Prescription of Forms 653.219 Small business programs....

  19. 48 CFR 219.505 - Rejecting Small Business Administration recommendations. (United States)


    ...-Asides for Small Business 219.505 Rejecting Small Business Administration recommendations. (b) The... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rejecting Small Business Administration recommendations. 219.505 Section 219.505 Federal Acquisition Regulations System...

  20. Dicty_cDB: SHB219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHB219 (Link to dictyBase) - - - - SHB219P (Link to Original site) SHB219F ... sk*nvyryccnynifsinflcy*ntg*kiy*reksqksi*is**sts*ts*etc ... c*nr*tlfiwl*krsktk*klfl*frkeii*tpth*mlfqrty*lntisk ...

  1. 50 CFR 660.219 - Fixed gear identification and marking. (United States)


    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Fixed gear identification and marking. 660.219 Section 660.219 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... Groundfish-Limited Entry Fixed Gear Fisheries § 660.219 Fixed gear identification and marking. (a)...

  2. 48 CFR 219.705-4 - Reviewing the subcontracting plan. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reviewing the subcontracting plan. 219.705-4 Section 219.705-4 Federal Acquisition Regulations System DEFENSE ACQUISITION... Subcontracting Program 219.705-4 Reviewing the subcontracting plan. (d) Challenge any subcontracting plan...

  3. 30 CFR 219.102 - Method of payment. (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102... (EFT). Should a State prefer to receive its payment by EFT, it should request this payment method in... DISTRIBUTION AND DISBURSEMENT OF ROYALTIES, RENTALS, AND BONUSES Oil and Gas, Onshore § 219.102 Method...

  4. 48 CFR 219.811-3 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clauses. 219.811..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.811-3 Contract clauses. (1) Use the clause at 252.219-7009, Section...

  5. Dicty_cDB: AFM219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM219 (Link to dictyBase) - - - - - (Link to Original site) AFM219F 627 - ... v*vvvm lqeivmmvihvqlisvqsqpavfdl--- Frame B: fr**f*csr *kq*w*klsiryysynefr**iklfl**srifpn*wkri*crstip*ll** ... sktis*lsllcqnyq*sfhiqrf*ni*irr***clgih**kvgcrfgwftycsr e ny*sy*twscc**tlcn*flll*ktyfkinnsy*nnn*tsmsmv*flwc ...

  6. 20 CFR 219.24 - Evidence of presumed death. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of presumed death. 219.24 Section... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.24 Evidence of presumed death. When a person cannot be proven dead but evidence of death is needed, the Board may presume he or she died at a...

  7. 14 CFR 21.9 - Replacement and modification articles. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Replacement and modification articles. 21.9... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.9 Replacement and modification articles. (a) If a person knows, or should know, that a replacement or modification article is reasonably likely to...

  8. 48 CFR 1852.219-73 - Small business subcontracting plan. (United States)


    ... Provisions and Clauses 1852.219-73 Small business subcontracting plan. As prescribed in 1819.708-70(a), insert the following provision: Small Business Subcontracting Plan (MAY 1999) (a) This provision is not... contain FAR clause 52.219-9, “Small Business Subcontracting Plan.” The apparent low bidder must submit...

  9. 49 CFR 219.211 - Analysis and follow-up. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Analysis and follow-up. 219.211 Section 219.211 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Analysis and follow-up. (a) The laboratory designated in appendix B to this part undertakes prompt...

  10. Dicty_cDB: CFF219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFF219 (Link to dictyBase) - - - Contig-U14176-1 CFF219Z (Link to Original ... lpi**k qpkkivqfhqs*ikfqvlvlll Frame C: ---rrhck*xt*car **kk*xlcccinycsrl*cwtrrch*stss**rtyxfixt*sws* scqsk ...

  11. 49 CFR 219.105 - Railroad's duty to prevent violations. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Railroad's duty to prevent violations. 219.105 Section 219.105 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... duty to prevent violations. (a) A railroad may not, with actual knowledge, permit an employee to go...

  12. 49 CFR 219.302 - Prompt specimen collection; time limitation. (United States)


    ... or drug testing under this section after the expiration of an eight-hour period from— (1) The time of... period. (f) (g) Section 219.23 prescribes the notice to an employee that is required to provide breath...

  13. Dicty_cDB: SLF219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF219 (Link to dictyBase) - - - Contig-U15420-1 SLF219Z (Link to Original ... ime mold (D.discoideum) transposable element Tdd-1 right ... terminal repeat and flanks. 293 e-158 5 M11340 |M1 ... K03070 |K03070.1 Slime mold (D.discoideum) DIRS-1 right ... inverted terminal repeat, clone CP19-1. 226 e-119 ...

  14. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    International Nuclear Information System (INIS)

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  15. 48 CFR 52.219-10 - Incentive Subcontracting Program. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Incentive Subcontracting....219-10 Incentive Subcontracting Program. As prescribed in 19.708(c)(1), insert the following clause: Incentive Subcontracting Program (OCT 2001) (a) Of the total dollars it plans to spend under...

  16. 36 CFR 219.5 - Information development and interpretation. (United States)


    ... PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.5...) Station Directors and Regional Foresters must have joint responsibility for Forest Service participation... assessments provide information regarding ecological, economic, or social issues that are broad in...

  17. 36 CFR 219.29 - Limitation on timber harvest. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Limitation on timber harvest... Limitation on timber harvest. (a) Estimate of the limitation of timber harvest. The responsible official must... for lands identified in § 219.28(c) cannot be combined. (b) Limitation of timber harvest....

  18. 26 CFR 1.219-1 - Deduction for retirement savings. (United States)


    ..., the cost of current life insurance protection under an endowment contract described in paragraph (b)(3...'s age is $1.61 per thousand dollars of life insurance protection. The cost of current life insurance... current life insurance protection is $16.37 ($1.67 × 9.8). A's maximum deduction under section 219...

  19. 48 CFR 53.219 - Small Business Programs. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Programs... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.219 Small Business Programs. (a) The following form may be used in reporting small disadvantaged business contracting data: OF 312 (10/00),...

  20. 12 CFR 219.21 - Authority, purpose and scope. (United States)


    ... Authority, purpose and scope. This subpart of Regulation S (12 CFR part 219, subpart B) is issued by the... amended by the Annunzio-Wylie Anti-Money Laundering Act of 1992 (Pub. L. 102-550, Title XV; 106 Stat. 3672... promulgated and administered jointly by the Board and the Treasury and are codified in 31 CFR 103.11 and...

  1. Morphological differentiation of Streptomyces viridochromogenes E-219 on solid culture

    International Nuclear Information System (INIS)

    The Streptomyces viridochromogenes E-219 was derived from Streptomyces viridochromogenes CGMCC4.1119 treated with 60Co γ-rays irradiation and protoplast fusion. With the help of fluorescent probes, fluorescence microscope and electron microscopy, the morphology and development of E-219 on solid surface culture were investigated in this study. The effect of agarslant culture time on the production of Avilamycin was also studied to provide theoretical basis for industrial fermentation of selecting the appropriate seed to culture on the agarslant culture medium. The results implied that the development of colonies of Streptomyces viridochromogenes accompanied the intermittent hyhae apoptosis, and the production of spores was from the active mycelium. The colonial morphology of strain E-219 was significantly different from the original strain CGMCC4h1119. There were variegated hyphae formation in the stage of spore germination and initial hyphae development (10 h) with the live and dead segments alternated in a highly regular fashion within the same hypha. After the early single colony formation, the third phase was followed by profuse growth of the live segments derived from the variegated hypha, then the second apoptosis of the mycelia (48 h) was occurred with another quick growth, and sporulation was occurred at 96 h. Strain CGMCC4.1119 had spiral sporotrichial and round conidiophores with spike, whereas strain E-219 had linear sporotrichial, smooth and dylindrical conidiophore. The results of shake flask experiments indicated that the spores of E-219 had that highest activity when cultured on agarslant culture medium and incubated for 106 h with the production of avilamycin up to 1200 mg/L. (authors)

  2. 76 FR 50810 - Seventh Meeting: RTCA Special Committee 219: Attitude and Heading Reference System (United States)


    ... Federal Aviation Administration Seventh Meeting: RTCA Special Committee 219: Attitude and Heading... Committee 219 meeting: Attitude and Heading Reference System. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 219: Attitude and Heading Reference...

  3. 36 CFR 219.12 - Collaboration and cooperatively developed landscape goals. (United States)


    ... cooperatively developed landscape goals. 219.12 Section 219.12 Parks, Forests, and Public Property FOREST... Collaborative Planning for Sustainability § 219.12 Collaboration and cooperatively developed landscape goals. (a... process. (b) Cooperatively developed landscape goals. (1) The responsible official and other...

  4. 48 CFR 1852.219-83 - Limitation of the principal investigator-SBIR program. (United States)


    ... investigator-SBIR program. 1852.219-83 Section 1852.219-83 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.219-83 Limitation of the principal investigator—SBIR program. As prescribed in 1819.7302(d), insert the following clause: Limitation of the Principal Investigator—SBIR Program...

  5. 48 CFR 1852.219-84 - Limitation of the principal investigator-STTR program. (United States)


    ... investigator-STTR program. 1852.219-84 Section 1852.219-84 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.219-84 Limitation of the principal investigator—STTR program. As prescribed in 1819.7302(e), insert the following clause: Limitation of the Principal Investigator—STTR Program...

  6. 26 CFR 2.1-9 - Valuation of securities in fund. (United States)


    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Valuation of securities in fund. 2.1-9 Section 2.1-9 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) MARITIME CONSTRUCTION RESERVE FUND § 2.1-9 Valuation of securities in fund. (a) Equivalent...

  7. 36 CFR 219.28 - Determination of land suitable for timber harvest. (United States)


    ... suitable for timber harvest. 219.28 Section 219.28 Parks, Forests, and Public Property FOREST SERVICE... Considerations § 219.28 Determination of land suitable for timber harvest. (a) Lands where timber may not be... include: (1) Lands where timber harvest would violate statute, Executive Order, or regulation and...

  8. 40 CFR 80.219 - Designation and downstream requirements for GPA gasoline. (United States)


    ... requirements for GPA gasoline. 80.219 Section 80.219 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...-in Program § 80.219 Designation and downstream requirements for GPA gasoline. The requirements and... standards under § 80.216 as “GPA” gasoline. (b) Product transfer documents. (1) On each occasion that...

  9. Mass determination of K2-19b and K2-19c from radial velocities and transit timing variations

    CERN Document Server

    Nespral, D; Deeg, H J; Borsato, L; Fridlund, M C V; Barragan, O; Grziwa, S; Korth, J; Cabrera, J; Csizmadia, Sz; Nowak, G; Kuutma, T; Saario, J; Eigmuller, P; Erikson, A; Guenther, E W; Hatzes, A P; Rodriguez, P Montanes; Palle, E; Patzold, M; Prieto-Arranz, J; Rauer, H; Sebastian, D


    We present FIES@NOT and HARPS-N@TNG radial velocity follow-up observations of K2-19, a compact planetary system hosting three planets, of which the two larger ones, namely K2-19b and K2-19c, are close to the 3:2 mean motion resonance. The masses of these larger planets have previously been derived from transit timing only. An analysis considering only the radial velocity measurements is able to detect only K2-19b, the largest and more massive planet in the system, with a mass of $71.7\\pm6.3$ M${_\\oplus}$. We also used the TRADES code to simultaneously model both our RV measurements and the existing transit-timing measurements. We derived a mass of K2-19b of $59.5^{+7.2}_{-11.4}$ M${_\\oplus}$ and of K2-19c of $9.7^{+3.9}_{-2.0}$ M${_\\oplus}$. A prior K2-19b mass estimated by Barros 2015, based exclusively on transit timing measurements, is only consistent with our combined TTV and RV analysis, but not with our analysis based purely on RV measurements. K2-19b supports the suspicion that planet masses and densit...

  10. Evaluation of Nitrogen Uptake and Growth Performance of Advanced Mutant Lines MR219-4 and MR219-9 Grown Under Aerobic Conditions

    International Nuclear Information System (INIS)

    Developing a good crop production management package; drought resistance variety, effective water and nutrient management in rice production practices is crucial for global climate change adaptation. A research project under IAEA RAS5065 (Supporting Climate-Proofing Rice Production Systems (CRiPS) Based on Nuclear Applications) was conducted from 2012 to 2013, in collaboration with MARDI. Two advanced mutant lines, MR219-4 and MR219-9 were used in this research project to evaluate growth, yield potential and fertilizer uptake under different water input condition (flooded and aerobic). The advanced mutant line MR219-9 showed comparable growth, yield and nitrogen uptake under both flooded and aerobic conditions. The yield and yield components are not significantly different from the parent variety (MR219) but total N uptake was lower than MR219 regardless of water regime. The field trial showed that MR219-9 has a better total N content which is comparable to the aerobic rice variety (MRIA 1) and this indicates that this advance mutant line MR219-9 is a potential aerobic rice variety. (author)

  11. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters (United States)

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration


    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  12. 20 CFR 219.40 - Evidence of relationship by equitable adoption-child. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of relationship by equitable adoption-child. 219.40 Section 219.40 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... relationship by equitable adoption—child. (a) Preferred evidence. If the claimant is a person who claims to...

  13. 20 CFR 219.35 - Evidence that a marriage has ended. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence that a marriage has ended. 219.35... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.35 Evidence that a marriage has ended. (a) Preferred evidence. Preferred evidence that a marriage has ended is— (1) A certified copy of the decree...

  14. 20 CFR 219.32 - Evidence of a common-law marriage. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes...

  15. 20 CFR 219.33 - Evidence of a deemed valid marriage. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a deemed valid marriage. 219.33... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.33 Evidence of a deemed valid marriage. (a) Preferred evidence. Preferred evidence of a deemed valid marriage is— (1) Evidence of a ceremonial...

  16. 20 CFR 219.30 - When evidence of marriage is required. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of marriage is required. 219.30... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.30 When evidence of marriage is required. (a) When an application is filed for benefits. Documentary evidence of marriage is required when...

  17. 49 CFR 234.219 - Gate arm lights and light cable. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm lights and light cable. 234.219 Section... Maintenance, Inspection, and Testing Maintenance Standards § 234.219 Gate arm lights and light cable. Each gate arm light shall be maintained in such condition to be properly visible to approaching...

  18. 48 CFR 52.219-4 - Notice of price evaluation preference for HUBZone small business concerns. (United States)


    ... successful offers from small business concerns. (2) The factor of 10 percent shall be applied on a line item... preference for HUBZone small business concerns. 52.219-4 Section 52.219-4 Federal Acquisition Regulations... business concerns. As prescribed in 19.1308(b), insert the following clause: Notice of Price...

  19. 48 CFR 52.219-7 - Notice of Partial Small Business Set-Aside. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Notice of Partial Small Business Set-Aside. 52.219-7 Section 52.219-7 Federal Acquisition Regulations System FEDERAL ACQUISITION... Federal Prison Industries, Inc., will be solicited and considered for both the set-aside and...

  20. 48 CFR 2452.219-70 - Small business subcontracting plan compliance. (United States)


    ... of Provisions and Clauses 2452.219-70 Small business subcontracting plan compliance. As prescribed in 2419.708(d), insert the following provision: Small Business Subcontracting Plan Compliance (FEB 2006... the clause at FAR 52.219-9, Small Business Subcontracting Plan. (c) The government will...

  1. 14 CFR 91.219 - Altitude alerting system or device: Turbojet-powered civil airplanes. (United States)


    ...: Turbojet-powered civil airplanes. 91.219 Section 91.219 Aeronautics and Space FEDERAL AVIATION... system or device: Turbojet-powered civil airplanes. (a) Except as provided in paragraph (d) of this section, no person may operate a turbojet-powered U.S.-registered civil airplane unless that airplane...

  2. 49 CFR Appendix C to Part 219 - Post-Accident Testing Specimen Collection (United States)


    ... of specimen or dissipation of volatiles (ethyl alcohol). Note: If only cavity fluid is available... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Pt. 219, App. C... Toxicological Testing (49 CFR part 219), describing the testing event and identifying the employees...

  3. Evaluation and characterization of advanced rice mutant line of rice (Oryza sativa), MR219-4 and MR219-9 under drought condition

    International Nuclear Information System (INIS)

    Two advance rice mutant lines, MR219-4 and MR219-9 derived from mutagenesis of Oryza sativa cv. MR219 with gamma radiation at 300 Gy were evaluated in simulated drought condition in the greenhouse at Malaysian Nuclear Agency. The mutants were evaluated simultaneously with ARN1, a drought resistant variety and MR211 a susceptible cultivar as a check. Randomized complete block design with three replicates was used in the experiment. The evaluation and selection were done based on leaf rolling and leaf drying as well as other agronomic traits, such as, number of tillers per plant, plant height, flag leaf area, grain weight per plant, grain yield per plant, 100-grain weight, harvest index, panicle length and plant biomass. The mutants MR219-4 showed moderate tolerance and MR219-9 showed tolerance to drought respectively as compare to the check variety (ARN1, MR211) and control MR219. Leaf rolling, leaf drying, days to flowering and days to maturity are valuable secondary traits that may provide additional information for selection because of associating with the plant survival under water stress. Further research on expression of drought-tolerant lines under different drought conditions is essential in order to identify particular traits that are associated with drought tolerance and high yield potential. Similarly the importance of secondary traits, relative to other putative traits for drought tolerance, needs to be tested in various environments. (author)

  4. 47 CFR 80.219 - Special requirements for narrow-band direct-printing (NB-DP) equipment. (United States)


    ... reference in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of these standards can be inspected...-printing (NB-DP) equipment. 80.219 Section 80.219 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... § 80.219 Special requirements for narrow-band direct-printing (NB-DP) equipment. NB-DP and...

  5. 18 CFR 367.2190 - Account 219, Accumulated other comprehensive income. (United States)


    ... POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2190 Account 219... COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR...

  6. A Novel Zinc Finger Protein 219-like (ZNF219L) is Involved in the Regulation of Collagen Type 2 Alpha 1a (col2a1a) Gene Expression in Zebrafish Notochord


    Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Hung, Chin-Chun; Liao, Wei-Hao; Hwang, Pung-Pung; Han, Yu-San; Huang, Chang-Jen


    The notochord is required for body plan patterning in vertebrates, and defects in notochord development during embryogenesis can lead to diseases affecting the adult. It is therefore important to elucidate the gene regulatory mechanism underlying notochord formation. In this study, we cloned the zebrafish zinc finger 219-like (ZNF219L) based on mammalian ZNF219, which contains nine C2H2-type zinc finger domains. Through whole-mount in situ hybridization, we found that znf219L mRNA is mainly e...

  7. MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction

    DEFF Research Database (Denmark)

    Kocerha, Jannet; Faghihi, Mohammad Ali; Lopez-Toledano, Miguel A;


    significantly modulated behavioral responses associated with disrupted NMDA receptor transmission. Furthermore, pretreatment with the antipsychotic drugs haloperidol and clozapine prevented dizocilpine-induced effects on miR-219. Taken together, these data support an integral role for miR-219 in the expression......N-methyl-D-aspartate (NMDA) glutamate receptors are regulators of fast neurotransmission and synaptic plasticity in the brain. Disruption of NMDA-mediated glutamate signaling has been linked to behavioral deficits displayed in psychiatric disorders such as schizophrenia. Recently, noncoding RNA...... of behavioral aberrations associated with NMDA receptor hypofunction....

  8. 75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside (United States)


    ... of the Secretary Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside AGENCY... class deviation to the Federal Acquisition Regulation (FAR) regarding partial small business set-asides... Clause 52.219-7, Notice of Partial Small Business Set-Aside. DESC intends to use the clause in...

  9. 7 CFR 1726.405 - Inventory of work orders (RUS Form 219). (United States)


    ... SERVICE, DEPARTMENT OF AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES Contract Closeout § 1726.405 Inventory of work orders (RUS Form 219). Upon completion of the contract closeout, the... Policies and Procedures Common to Insured and Guaranteed Electric Loans, of this chapter....

  10. 36 CFR 223.219 - Sustainable harvest of special forest products. (United States)


    ....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total... forest officers may consult with other appropriate parties to determine sustainable harvest levels...

  11. 48 CFR 52.219-8 - Utilization of small business concerns. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Utilization of small... Clauses 52.219-8 Utilization of small business concerns. As prescribed in 19.708(a), insert the following clause: Utilization of Small Business Concerns (MAY 2004) (a) It is the policy of the United States...

  12. 48 CFR 752.219-8 - Utilization of small business concerns and small disadvantaged business concerns. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Utilization of small... AND CONTRACT CLAUSES Texts of Provisions and Clauses 752.219-8 Utilization of small business concerns..., provide the following information to the Office of Small and Disadvantaged Business Utilization...

  13. 20 CFR 219.31 - Evidence of a valid ceremonial marriage. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a valid ceremonial marriage. 219... marriage. (a) Preferred evidence. Preferred evidence of a ceremonial marriage is— (1) A copy of the public record of the marriage, certified by the custodian of the record or by a Board employee; (2) A copy of...

  14. 27 CFR 28.219 - Return of wine withdrawn for export with benefit of drawback. (United States)


    ... zone, may for good cause be returned under the applicable provisions of this part and 27 CFR part 24... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Return of wine withdrawn... Exportation of Wine With Benefit of Drawback § 28.219 Return of wine withdrawn for export with benefit...

  15. Evaluation of 3 Inch SN-219 Failure and S and SX Tank Farm Saltwell Piping

    International Nuclear Information System (INIS)

    Evaluation of direct buried piping currently in use or designated for future Saltwell pumping in S and SX Farms. Documented evaluation of failed S-103 saltwell pumping transfer line 3 inch SN-219. This evaluation is intended to reflect current status of Saltwell piping, when taken in context with referenced documents

  16. Sfragís and its metaphorical testimonial presence in 2 Timothy 2:19

    Directory of Open Access Journals (Sweden)

    Carlos Molina


    Full Text Available This article presented a metaphorical testimonial approach in the interpretation of 2 Timothy 2:19 and the use of sealing. As starting point, attention was given to the concept of ‘seal’ through the Old Testament and Ancient Near East. These periods attest the fact that sealing was also utilised in a figurative way as a sign of ownership, property and authenticity. Sfragís in 2 Timothy 2:19 describes the intimate relationship between Christ and his followers through the terms [foreign font omitted (personal and vital relationship that transcends in practice and [foreign font omitted (mainly an exterior knowledge]. These two vocables are in opposition to [foreign font omitted (to apostate from]. The message expressed in 2:19 exemplifies the principles that Christ lived by and he empowered his followers to stand by. Sfragís in 2 Timothy 2:19 is an imitatio Christi response against the [foreign font omitted] of moral standards and entertainment in the ancient Roman world. It includes a rapid contemporary reflection on practical faithfulness for today’s life. 

  17. 48 CFR 852.219-9 - VA Small business subcontracting plan minimum requirements. (United States)


    ... Provisions and Clauses 852.219-9 VA Small business subcontracting plan minimum requirements. As prescribed in subpart 819.709, insert the following clause: VA Small Business Subcontracting Plan Minimum Requirements... plan, the minimum goals for award of subcontracts to service-disabled veteran-owned small...

  18. 25 CFR 2.19 - Action by Area Directors and Education Programs officials on appeal. (United States)


    ...—Indian Affairs/Director (Indian Education Programs) shall render written decisions in all cases appealed... 25 Indians 1 2010-04-01 2010-04-01 false Action by Area Directors and Education Programs officials... AND PRACTICE APPEALS FROM ADMINISTRATIVE ACTIONS § 2.19 Action by Area Directors and...

  19. 48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts). (United States)


    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan...-9, Small Business Subcontracting Plan, clause of this contract. (a) Definitions. Historically black... Education to meet the requirements of 34 CFR 608.2. The term also means any nonprofit research...

  20. 49 CFR 219.608 - FRA Administrator's determination of random alcohol testing rate. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false FRA Administrator's determination of random... Random Alcohol and Drug Testing Programs § 219.608 FRA Administrator's determination of random alcohol... percentage rate for random alcohol testing must be 25 percent of covered employees. (b) The...

  1. 49 CFR 219.602 - FRA Administrator's determination of random drug testing rate. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false FRA Administrator's determination of random drug... Random Alcohol and Drug Testing Programs § 219.602 FRA Administrator's determination of random drug... percentage rate for random drug testing must be 50 percent of covered employees. (b) The FRA...

  2. MicroRNA-219-5p Inhibits Morphine-Induced Apoptosis by Targeting Key Cell Cycle Regulator WEE1. (United States)

    Lou, Wei; Zhang, Xingwang; Hu, Xiao-Ying; Hu, Ai-Rong


    BACKGROUND To identify the effects of microRNA (miR)-219-5p on morphine-induced apoptosis by targeting WEE1. MATERIAL AND METHODS Forty Balb/C mice (Toll-like receptor 9, TLR9 knockout) were randomly allocated to the experimental and control groups (20 in each group). The baseline miR-219-5p expression was detected using quantitative real-time PCR (qRT-PCR). After morphine was injected at 6 h on the 2nd and 6th days, experimental and control groups received miR-219-5p mimics or miRNA-negative control (NC), respectively, compound injection. Tissues and cells were later obtained from subjects in each group separately after mice were killed. TUNEL assay was used to investigate apoptosis in both groups. RAW264.7 cells were treated with miR-219-5p mimics and controls, respectively. After 24 h, 10 μM of morphine was added at 24 h. Cell apoptosis was assessed by flow cytometer. The WEE1 and Phospho-cdc2 (Tyr15) expressions were examined by Western blotting. RESULTS MiR-219-5p expression in the experimental group was significantly lower than that in the control group (P<0.05). Mice injected with miR-219-5p mimic experienced an evident increase in apoptosis rate compared with the control group (P<0.05). The miR-219-5p NC group and the morphine group both presented an elevated apoptosis rate compared with the blank control group (both, P<0.05). The apoptosis rate in the miR-219-5p mimic group was 10.06%, remarkably lower than in the miR-219-5p NC group and blank control group (both P<0.05). WEE1 and Tyr15 protein expressions in the miR-219-5p NC group and morphine group were obviously stronger than those in the blank control group (all P<0.05). In the miR-219-5p mimic group, WEE1 and Tyr15 protein expressions were significantly lower compared with those in the miR-219-5p NC group and morphine group (all P<0.05). CONCLUSIONS Morphine significantly downregulated the expression of miRNA-219-5p, which targets WEE1 to suppress Tyr15 expressions and activate Cdc2, thus inhibiting

  3. 41 CFR 302-3.219 - Is there a limit on how many times I may receive reimbursement for tour renewal travel? (United States)


    ... many times I may receive reimbursement for tour renewal travel? 302-3.219 Section 302-3.219 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RELOCATION....219 Is there a limit on how many times I may receive reimbursement for tour renewal travel? (a) If...

  4. Field Trial of 40 Gbit/s ETDM Prototype System over 219 km of Installed Single Mode Fiber

    Institute of Scientific and Technical Information of China (English)

    Sang Soo Lee; Hyun Woo Cho; Sang Kyu Lim; Ki Ho Han; Jin Soo Han; Moo Jung Chu; Je Soo Ko; Kyeong-Mo Yoon; Yong-Gi Lee


    Transmission of 40Gbit/s NRZ signal was successfully demonstrated over 219km of installed SMF in KT's Daejeon area network. After transmission, the measured power penalty was 0.5dB for all the tributary channels.

  5. The TLX-miR-219 cascade regulates neural stem cell proliferation in neurodevelopment and schizophrenia iPSC model. (United States)

    Murai, Kiyohito; Sun, Guoqiang; Ye, Peng; Tian, E; Yang, Su; Cui, Qi; Sun, Guihua; Trinh, Daniel; Sun, Olivia; Hong, Teresa; Wen, Zhexing; Kalkum, Markus; Riggs, Arthur D; Song, Hongjun; Ming, Guo-Li; Shi, Yanhong


    Dysregulated expression of miR-219, a brain-specific microRNA, has been observed in neurodevelopmental disorders, such as schizophrenia (SCZ). However, its role in normal mammalian neural stem cells (NSCs) and in SCZ pathogenesis remains unknown. We show here that the nuclear receptor TLX, an essential regulator of NSC proliferation and self-renewal, inhibits miR-219 processing. miR-219 suppresses mouse NSC proliferation downstream of TLX. Moreover, we demonstrate upregulation of miR-219 and downregulation of TLX expression in NSCs derived from SCZ patient iPSCs and DISC1-mutant isogenic iPSCs. SCZ NSCs exhibit reduced cell proliferation. Overexpression of TLX or inhibition of miR-219 action rescues the proliferative defect in SCZ NSCs. Therefore, this study uncovers an important role for TLX and miR-219 in both normal neurodevelopment and in SCZ patient iPSC-derived NSCs. Moreover, this study reveals an unexpected role for TLX in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation. PMID:26965827

  6. Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 101

    Energy Technology Data Exchange (ETDEWEB)

    Diaz, L.A.


    One waste sample that was obtained with solids from tank 101 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprene tubing (Phthalate free) was obtained in a glass jar with teflon lid was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Results are presented.

  7. Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 101

    International Nuclear Information System (INIS)

    One waste sample that was obtained with solids from tank 101 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprene tubing (Phthalate free) was obtained in a glass jar with teflon lid was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Results are presented

  8. 219.3 W CW diode-side-pumped 1123 nm Nd:YAG laser (United States)

    Li, C. Y.; Bo, Y.; Xu, Y. T.; Yang, F.; Wang, Z. C.; Wang, B. S.; Xu, J. L.; Gao, H. W.; Peng, Q. J.; Cui, D. F.; Xu, Z. Y.


    We demonstrate a high power continuous wave (CW) diode-side-pumped Nd:YAG laser operating at 1123 nm with a plano-plano configuration. By means of precise coating, a single 1123 nm wavelength is achieved. Under the pump power of 1080 W, an output power of 219.3 W is obtained, which corresponds to an optical-optical conversion efficiency of 20.3%. To the best of our knowledge, this is the highest output power for CW 1123 nm laser based on Nd:YAG crystal.

  9. Equation modifying program, L219 (EQMOD). Volume 2: Supplemental system design and maintenance document (United States)

    Hirayama, M. Y.; Clemmons, R. E.; Miller, R. D.


    A digital computer program, L219 (EQMOD), available for execution on the CDC 6600 is described. The program modifies matrices according to card input instructions and prepares magnetic files of matrices suitable for use in the linear systems analysis program (QR) and the random harmonic analysis program L221 (TEV156). The particular field of application of the program is the modification of the theoretical equations of motion and load equations generated in DYLOFLEX by the equation of motion program (L217) and the load equation program (L218), respectively.

  10. ECNJEFI. A JEFI based 219-group neutron cross-section library: User's manual

    International Nuclear Information System (INIS)

    This manual describes the contents of the ECNJEF1 library. The ECNJEF1 library is a JEF1.1 based 219-group AMPX-Master library for reactor calculations with the AMPX/SCALE-system, e.g. the PASC-3 system as implemented at the Netherlands Energy Research Foundation in Petten, Netherlands. The group cross-section data were generated with NJOY and NPTXS/XLACS-2 from the AMPX system. The data on the ECNJEF1 library allows resolved-resonance treatment by NITAWL and/or unresolved resonance self-shielding by BONAMI. These codes are based upon the Nordheim and Bondarenko methods, respectively. (author). 10 refs., 7 tabs

  11. EJ1: a JEF1 based 219-group neutron cross-section library

    International Nuclear Information System (INIS)

    This manual describes the contents of the EJ1 library. The EJ1 library is a JEF1.1 based 219-group AMPX-Master library for reactor calculations with the AMPX/SCALE-3 system, e.g. the PASC-3 system, as implemented at ECN-Petten. The group cross-section data were generated with NJOY. The data on the EJ1 library allow resolved-resonance treatment by NITAWL and unresolved resonance self-shielding by BONAMI. These codes are based upon the Nordheim and Bondarenko methods, respectively. (author). 24 refs., 8 tabs

  12. Purification, crystallization and preliminary X-ray analysis of cytochrome P450 219A1 from Novosphingobium aromaticivorans DSM 12444

    International Nuclear Information System (INIS)

    A 2.4 Å resolution data set was collected from a crystal of CYP219A1. This is the first protein of a new P450 family from the oligotrophic organism N. aromaticivorans which can oxidize steroids and bind sesquiterpenoids. Cytochrome P450 enzymes catalyze a variety of reactions and are widely distributed in living organisms. In recent studies, the first members of five new families of cytochrome P450 enzymes have been identified, including cytochrome P450 219A1 (CYP219A1) from Novosphingobium aromaticivorans DSM 12444. It has also been reported that isolongifolen-9-one (C15H22O), a sesquiterpenoid ketone derivative, is a potential substrate for CYP219A1, inducing a ≥95% shift of the haem spin state to high spin upon binding. The CYP219A1 protein has been crystallized and single crystals have been studied by X-ray crystallography. Diffraction data were collected to 2.4 Å resolution. The crystals belonged to space group P6, with unit-cell parameters a = 93.1, b = 93.1, c = 98.0 Å. Preliminary X-ray diffraction data analysis revealed that the asymmetric unit contained one protein molecule

  13. Synthesis, radiochemistry and biological evaluation of a new somatostatin analogue (SDZ 219-387) labelled with technetium-99m

    International Nuclear Information System (INIS)

    A new derivative of octreotide SDZ 219-387 [PnAO-(D)Phe1-octreotide] was synthesized, which binds specifically and with high affinity to somatostatin receptors in vitro (pKi=9.79±0.16). This new somatostatin analogue chelates technetium-99m under mild labelling conditions in good yields. The resulting [99mTc]SDZ 219-387 was stable up to 6 h after labelling and could be isolated in a pure radiochemical and chemical form by high-perfomance liquid chromatographic purification. The intravenous administration of purified [99mTc]SDZ 219-387 revealed that the radioligand was rapidly cleared from circulation, and tumour uptake of 0.38% ID/g was observed at 1.5 h post injection. [99mTc]SDZ 219-387 specifically interacted with somatostatin binding sites on the tumour. However, the radioligand is highly lipophilic and excreted mainly through the hepatobiliary system. As a consequence, [99mTc]SDZ 219-387 exhibits increased background activity and therefore is not appropriate for the in vivo visualization of somatostatin receptor-positive tumours and/or their metastases in the abdomen. (orig.)

  14. Photo-dynamical mass determination of the multi-planetary system K2-19

    CERN Document Server

    Barros, S C C; Demangeon, O; Tsantaki, M; Santerne, A; Armstrong, D J; Barrado, D; Brown, D; Deleuil, M; Lillo-Box, J; Osborn, H; Pollacco, D; Abe, L; Andre, P; Bendjoya, P; Boisse, I; Bonomo, A S; Bouchy, F; Bruno, G; Cerda, J Rey; Courcol, B; Díaz, R F; Hébrard, G; Kirk, J; Lachurié, J C; Lam, K W F; Martinez, P; McCormac, J; Moutou, C; Rajpurohit, A; Rivet, J -P; Spake, J; Suarez, O; Toublanc, D; Walker, S R


    K2-19 is the second multi-planetary system discovered with K2 observations. The system is composed of two Neptune size planets close to the 3:2 mean-motion resonance. To better characterise the system we obtained two additional transit observations of K2-19b and five additional radial velocity observations. These were combined with K2 data and fitted simultaneously with the system dynamics (photo-dynamical model) which increases the precision of the transit time measurements. The higher transit time precision allows us to detect the chopping signal of the dynamic interaction of the planets that in turn permits to uniquely characterise the system. Although the reflex motion of the star was not detected, dynamic modelling of the system allowed us to derive planetary masses of $M_b= 44 \\pm 12\\, M_{\\oplus}$ and $M_c = 15.9 \\pm 7.0\\, M_{\\oplus}$ for the inner and the outer planets respectively, leading to densities close to Uranus. We also show that our method allows the derivation of mass ratios using only the 80...

  15. Photodynamical mass determination of the multiplanetary system K2-19 (United States)

    Barros, S. C. C.; Almenara, J. M.; Demangeon, O.; Tsantaki, M.; Santerne, A.; Armstrong, D. J.; Barrado, D.; Brown, D.; Deleuil, M.; Lillo-Box, J.; Osborn, H.; Pollacco, D.; Abe, L.; Andre, P.; Bendjoya, P.; Boisse, I.; Bonomo, A. S.; Bouchy, F.; Bruno, G.; Cerda, J. Rey; Courcol, B.; Díaz, R. F.; Hébrard, G.; Kirk, J.; Lachurié, J. C.; Lam, K. W. F.; Martinez, P.; McCormac, J.; Moutou, C.; Rajpurohit, A.; Rivet, J.-P.; Spake, J.; Suarez, O.; Toublanc, D.; Walker, S. R.


    K2-19 is the second multiplanetary system discovered with K2 observations. The system is composed of two Neptune size planets close to the 3:2 mean-motion resonance. To better characterize the system we obtained two additional transit observations of K2-19b and five additional radial velocity observations. These were combined with K2 data and fitted simultaneously with the system dynamics (photodynamical model) which increases the precision of the transit time measurements. The higher transit time precision allows us to detect the chopping signal of the dynamic interaction of the planets that in turn permits to uniquely characterize the system. Although the reflex motion of the star was not detected, dynamic modelling of the system allowed us to derive planetary masses of Mb = 44 ± 12 M⊕ and Mc = 15.9 ± 7.0 M⊕ for the inner and the outer planets, respectively, leading to densities close to Uranus. We also show that our method allows the derivation of mass ratios using only the 80 d of observations during the first campaign of K2.

  16. A Novel Functional Missense Mutation p.T219A in Type 1 Gaucher's Disease

    Institute of Scientific and Technical Information of China (English)

    Lin-YuLiu; Fei Liu; Si-Chen Du; Sha-Yi Jiang; Hui-Jun Wang; Jin Zhang; Wei Wang


    Background:Gaucher's disease (GD) is an autosomal recessive disorder caused by a deficiency of acid β-glucosidase (glucocerebrosidase [GBA])that results in the accumulation of glucocerebroside within macrophages.Many mutations have been reported to be associated with this disorder.This study aimed to discover more mutations and provide data for the genetic pattern of the gene,which will help the development of quick and accurate genetic diagnostic tools for this disease.Methods:Genomic DNA was obtained from peripheral blood leukocytes of the patient and Sanger sequencing is used to sequence GBA gene.Sequence alignments of mammalian β-GBA (GCase) and three-dimensional protein structure prediction of the mutation were made.A construct of this mutant and its compound heterozygous counterpart were used to measure GCase in vitro.Results:GCase is relatively conserved at p.T219A.This novel mutation differs from its wild-type in structure.Moreover,it also causes a reduction in GCase enzyme activity.Conclusion:This novel mutation (c.655A>G,p.T219A) is a pathogenic missense mutation,which contributes to GD.

  17. 222-S radioactive liquid waste line replacement and 219-S secondary containment upgrade, Hanford Site, Richland, Washington

    International Nuclear Information System (INIS)

    The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission

  18. Project specific quality assurance plan for Project W-178, 219-S secondary containment

    International Nuclear Information System (INIS)

    The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation

  19. Measurement of the (211)Pb half-life using recoil atoms from (219)Rn decay. (United States)

    Aitken-Smith, P M; Collins, S M


    The radioactive half-life of (211)Pb was measured, by α-particle counting of samples of radiochemically pure (211)Pb in equilibrium with its α-emitting progeny, (211)Bi and (211)Po. The samples were prepared by the collection of (215)Po recoil atoms from the decay of the (219)Rn decay progeny produced from a (223)Ra sample onto stainless steel discs. The radioactive decay of the (211)Pb was measured utilising a 2π proportional counter operating on the α plateau. A half-life of 36.164 (13)min was determined, which is in agreement with currently available literature. A full uncertainty budget is presented. A recommended half-life of T1/2((211)Pb)=36.161 (17)min has been evaluated from the current literature values. PMID:26773817

  20. MicroRNA-219-2-3p functions as a tumor suppressor in gastric cancer and is regulated by DNA methylation.

    Directory of Open Access Journals (Sweden)

    Huizi Lei

    Full Text Available BACKGROUND AIMS: Gastric cancer is the most frequent gastrointestinal tumor in adults and is the most lethal form of human cancer. Despite of the improvements in treatments, the underlying mechanism of gastric carcinogenesis is not well known. To define novel modulators that regulate susceptibility to tumorgenesis, we focused on miR-219-2-3p. METHODS: Quantitative RT-PCR was employed to investigate the level of miR-219-2-3p in gastric cancer (GC tissues (n = 113 and their matched adjacent normal tissues (n = 113. In vitro cell proliferation, apoptosis assays, cell migration, and invasion assays were performed to elucidate biological effects of miR-219-2-3p. Since silencing of miRNA by promoter CpG island methylation may be an important mechanism in tumorgenesis, GC cells were treated with 5-aza-2'-deoxycytidine and trichostatin A, and expression changes of miR-219-2-3p were subsequently examined by quantitative RT-PCR. Finally, the methylation status of CpG island upstream of miR-219-2-3p was analyzed by methylation-specific PCR in GC tissues (n = 22. RESULTS: miR-219-2-3p was down-regulated in GC and cell lines. In addition, the experiments documented the lower expression of miR-219-2-3p in GC specimens with higher grade and later stage tumors. Meanwhile, miR-219-2-3p exerted antiproliferative, proapoptotic, and antimetastatic roles and reduced levels of p-ERK1/2 in GC cells. Furthermore, 5-aza-2'-deoxycytidine and trichostatin A increased the expression (~2 fold of miR-219-2-3p in GC cells. By methylation-specific PCR, DNA methylation in the upstream region of miR-219-2-3p was detected in both adjacent normal tissues and cancer tissues. As expected, the methylation level was considerably higher in the miR-219-2-3p down-regulated group than up-regulated group. CONCLUSIONS: miR-219-2-3p is potentially involved in gastric cancer progression and metastasis by regulating ERK1/2-related signal pathways, which may provide a novel therapeutic strategy

  1. Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

    International Nuclear Information System (INIS)

    Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215Fr and propose a decay scheme up to Iπ = (47/2+) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model

  2. Germination Response of MR 219 Rice Variety to Different Exposure Times and Periods of 2450 MHz Microwave Frequency


    Daryush Talei; Alireza Valdiani; Mahmood Maziah; Mohammad Mohsenkhah


    Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR), germination percentage (GP), and mean germination time (MGT) were analyzed by exposing its seeds to 2450 MHz of microwave frequenc...

  3. {sup 18}F-labeling and biodistribution of the novel fluoro-quinolone antimicrobial agent, trovafloxacin (CP 99,219)

    Energy Technology Data Exchange (ETDEWEB)

    Babich, John W.; Rubin, Robert H.; Graham, Wendy A.; Wilkinson, Robert A.; Vincent, John; Fischman, Alan J


    [{sup 18}F]CP 99,219 [(1{alpha},5{alpha},6{alpha})-7-(6-amino-3-azabicyclo [3.1.0]hex-3-yl)-1-(2,4-difluorophenyl)-6-fluoro-1,4-dihydro-4-oxo-1, 8-naphthyridine-3-carboxylic acid] was prepared by {sup 18}F for {sup 19} exchange followed by reverse-phase HPLC purification. Studies of the effects of reaction time and temperature on {sup 18}F incorporation demonstrated that heating 1.0 mg of CP 99,219 in 0.5 cc of DMSO with 4.5 mg of K{sub 2}CO{sub 3} and 24 mg of Kryptofix for 15 min at 160 deg. C results in the optimal compromise between radiochemical yield and purity. This method routinely provides radiochemical yields of 15-30% [EOS] with radiochemical purities of >97%. Varying the concentration of CP 99,219 in the reaction mixture had no effect on yield. Biodistribution studies in rats demonstrated that significant concentrations of drug accumulate in most tissues. The tissues with the highest concentrations of drug were intestine, liver, kidney, and stomach.

  4. Clinical analysis for 219 cases of moderate and severe ovarian hyperstimulation syndrome%中、重度卵巢过度刺激综合征219例临床分析

    Institute of Scientific and Technical Information of China (English)

    胡晶晶; 魏兆莲; 周平; 邹薇薇; 曹云霞


    Objective To investigate the clinical characteristics, treatment and prevention of ovarian hypers-timulation syndrome (OHSS) in assisted reproduction techniques (ART). Methods Clinical data of 219 moderate and severe OHSS cases who were received in vitro fertilization- embryo transfer (IVF- ET) or intracytoplasmic sperm injection (ICSI) in the First Affiliated Hospital of Anhui Medical University from March 2007 to December 2010, were analyzed retrospectively. Results OHSS occurred after controlled ovarian hyperstimulation treatment, the incidence was about 4. 2% (219/5 176). 177 (80. 8%) were moderate OHSS and 42 (19. 2%) were severe OHSS. The distribution of severe OHSS patients between early group (18 cases, 8.2%) and late group (24 cases, 11.0%) was signifiant different (P0. 05).Conclusions The clinical features of early and late onset group were quite different. Multiple pregnance was the risk factor of OHSS. Cryopreserving all embryos on the day of transfer or choose single embryo transfer can reduce the duration of OHSS symptoms effectively .%目的 研究辅助生殖技术中卵巢过度刺激综合征(ovarian hyperstimulation syndrome,OHSS)的临床特点、治疗和预防.方法 对安徽医科大学第一附属医院生殖中心2007年3月至2010年12月行体外受精-胚胎移植(in vitro fertilization- embryo transfer,IVF- ET)和卵细胞浆内单精子注射(intracytoplasmic sperm injection,ICSI)中发生中、重度OHSS的219例患者的临床资料进行回顾性分析.结果 在219例患者中,OHSS发生率的为4.2% (219/5 176),其中重度OHSS 42例(19.2%),中度OHSS 177例(80.8%).早发组重度OHSS发生率(18例,8.2%)与晚发组(24例,11.0%)比较,差异有统计学意义(P<0.001);取卵后发生OHSS的时间为l~19d,早发组平均发生时间为(2.2±1.8)d,晚发组为(12.4±3.4)d(P<0.001).主要表现为腹胀、恶心、呕吐和少量腹水患者占80.8% (177/219);合并胸水、少尿、血液浓缩、水电解

  5. Early prodromal symptoms and diagnoses before first psychotic episode in 219 inpatients with schizophrenia. (United States)

    Shioiri, Toshiki; Shinada, Keita; Kuwabara, Hideki; Someya, Toshiyuki


    The authors examined the diagnosis before the onset of schizophrenia and retrospectively evaluated the presence/absence of early prodromal symptoms (EPS) and their types (such as depressive symptoms, anxiety symptoms, and obsessive-compulsive [OC] symptoms) and the period from the onset of these symptoms to that of schizophrenia in 219 inpatients with schizophrenia diagnosed according to the DSM-IV(-TR). A diagnosis was made before the onset of schizophrenia in 53 patients (24.2%). The diagnoses were mood disorder in 39 patients, anxiety disorder in seven, obsessive-compulsive disorder (OCD) in three, adjustment disorder in two, and eating disorder in two. EPS were present in 65 (29.7%) of all patients, slightly more frequent in female patients (male:female = 1:1.41). In the group with EPS, depressive symptoms (61.5%) were most frequently observed, followed by anxiety symptoms (23.1%) and OC symptoms (9.2%). The age at onset for each type of symptom was significantly lower for OC symptoms (14.5 +/- 2.4 years) than for the other symptoms (approx. 20 years). The mean period from the onset of each symptom to that of schizophrenia was the shortest for depressive symptoms (2.7 +/- 3.1 years) and the longest (>4 years) for OC symptoms. These results as well as previous studies in Western countries showed that more non-specific and general symptoms are frequently present for some years before the onset of schizophrenia. With consideration of this point, efforts toward early detection of schizophrenia are important. PMID:17610658

  6. ZZ AMPX-2/123, 123-Group Neutron Cross-Section Library from ENDF/B-4 by AMPX-2. ZZ AMPX-2/219, 219-Group Neutron Cross-Section Library from ENDF/B-4 by AMPX-2

    International Nuclear Information System (INIS)

    1 - Description of problem or function: Format: 'data base' for subsequent collapsing into both fine and broad group data in various formats (working and/or weighted ANISN, CCCC, etc.). Number of groups: AMPX-2/123 → 123 group structure; AMPX-2/219219 group structure. Nuclides: H, He, Li, Be, B, C, N, O, F, Na, Mg, Al, Si, Cl, K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, Kr, Zirc, Mo, Tc, Rh, Ag, Cd, Xe, Sm, Eu, Gd, Dy, Cu, Ta, W, Re, Pb, Th, Pa, U, Np, Pu, Am, Cm. Origin: ENDF/B-IV. Weighting spectrum: Most data were generated using a standard flux over three energy ranges (fission - 1/E - Maxwellian) as point-to-fine-group cross sections weighing function. The AMPX-2 P3 123- and 219- Group Neutron Cross-Section Master Interface Libraries may be considered as 'data bases' for subsequent collapsing into both fine and broad group data in various formats (working and/or weighted ANISN, CCCC, etc.). The built-in 123 and 219 group structures have been used to process all available data of ENDF/B-IV. 2 - Method of solution: The program AMPX-2 has been used to generate the data. By various executions of the module XLACS-2 (XLACS for bound H-1 in some materials) a number of independent libraries were generated which then were combined using the AMPX-2 module AJAX. Most data were generated using a standard flux over three energy ranges (fission - 1/E - Maxwellian) as point-to-fine-group cross sections weighing function. For some structural materials (e.g. Fe, Cr,...) different master data sets were produced using a weighting function fission - 1/E sigma T(SS-304) - Maxwellian, and the three parts of the spectrum were joined at properly selected energies. For some nuclides (e.g. 238U and 240Pu) various master data sets have been produced which contain problem-dependent unresolved cross sections characterized by the associated potential scattering cross sections. Some data sets contain P3 thermal scattering matrices, for which ENDF/B File 7 S(alpha, beta) data were used, e

  7. High frequency plant regeneration from mature seed of elite, recalcitrant Malaysian indica rice ( Oryza sativa L.) CV. MR 219. (United States)

    Sivakumar, P; Law, Y S; Ho, C-L; Harikrishna, Jennifer Ann


    An efficient in vitro plant regeneration system was established for elite, recalcitrant Malaysian indica rice, Oryza sativa L. CV. MR 219 using mature seeds as explant on Murashige and Skoog and Chu N6 media containing 2,4-dichlorophenoxy acetic acid and kinetin either alone or in different combinations. L-proline, casein hydrolysate and L-glutamine were added to callus induction media for enhancement of embryogenic callus induction. The highest frequency of friable callus induction (84%) was observed in N6 medium containing 2.5 mg l(-1) 2,4-dichlorophenoxy acetic acid, 0.2 mg l(-1) kinetin, 2.5 mg l(-1) L-proline, 300 mg l(-1) casein hydrolysate, 20 mg l(-1) L-glutamine and 30 g l(-1) sucrose under culture in continuous lighting conditions. The maximum regeneration frequency (71%) was observed, when 30-day-old N6 friable calli were cultured on MS medium supplemented with 3 mg l(-1) 6-benzyl aminopurine, 1 mg l(-1) naphthalene acetic acid, 2.5 mg l(-1) L-proline, 300 mg l(-1) casein hydrolysate and 3% maltose. Developed shoots were rooted in half strength MS medium supplemented with 2% sucrose and were successfully transplanted to soil with 95% survival. This protocol may be used for other recalcitrant indica rice genotypes and to transfer desirable genes in to Malaysian indica rice cultivar MR219 for crop improvement. PMID:20724277

  8. Amylose Content and Grain Length of New Rice Transgressive Variants Derived from a Cross Between O. rufipogon and Malaysian Rice Cultivar MR219

    Directory of Open Access Journals (Sweden)

    Parviz Fasahat


    Full Text Available Amylose content is one of the important grain quality properties of rice. A total of 10 new rice genotypes (BC2F7 generation derived from a cross between O. rufipogon Griff. accession IRGC105491 and O. sativa subspecies indica cv. MR219 with high yield were evaluated for amylose content in three environments in Peninsular Malaysia. One of the parents, a popular high yielding Malaysian rice cultivar MR219 was used as a check. Based on the average amylose content across the environments, the genotype G13 showed significantly (p < 0.05 different amylose content (23.88 % in comparison to other genotypes. Two genotypes G13 (25.7% and G15 (25.6% were higher than MR219 (25.1% in terms of amylose content in Sungai Besar environment. There was a positive (r2=0.018 but no significant correlation between amylose content and grain length.

  9. Association between apolipoprotein E promoter-219G/T polymorphism and total cholesterol level in patients with Alzheimer disease

    Institute of Scientific and Technical Information of China (English)

    Fang Liu; Xiao Sun; Jing Wang; Yan Kong; Li Cui; Xiangdang Shi


    BACKGROUND: Many researches have suggested that apolipoprotein E (APOE) and total cholesterol metabolism are closely related with dementia. In the supposed theory, 219 site of APOE promoter region is near gene coding region, so its polymorphism may result in the abnormality of APOE gene and protein expression,and finally lead to dementia.OBJECTIVE: To observe the association between APOE promoter-219G/T polymorphisms with serum total cholesterol in patients with Alzheimer disease, and compare it with non-dementia people.DESIGN: Case-control, comparative observation.SETTING: Department of Neurology, Fengtian Hospital of Shenyang Medical College.PARTICIPANTS: Fifty-five dementia patients including 27 males and 28 females aged (66±3) years and treated in the Department of Neurology, Fengtian Hospital were selected from January 2002 to December 2005 as the Alzheimer disease group. They all diagnosed according to the DSM- Ⅳ diagnostic criteria of Alzheimer disease instituted by American Psychiatry Association in 1994. Meanwhile, 44 none-dementia patients including 21 males and 23 females aged (66±3) years were selected from other clinical departments of Fengtian Hospital as control group. All the participants were informed the detection and agreed.METHODS: Genomic DNA was extracted from the peripheral blood of all subjects, then "NEST"PCR, DNA sequence and enzyme digestion were adopted to detect the expression of APOE promoter-219 polymorphism,following by biomedical statistics analysis based on the clinical total cholesterol level.MAIN OUTCOME MEASURES: Polymorphism of APOEpromoter-219 G/T and total cholesterol level.RESULTS: All 55 dementia patients and 44 non-dementia ones were involved in the result analysis. ①Allele and genotype frequency: The T allele frequency of the Alzheimer disease group was significantly higher than that in the control group [88.2% (97/110), 54.5% (48/88)], while G allele frequency was remarkably lower than that in the control group [11

  10. Amylose Content and Grain Length of New Rice Transgressive Variants Derived from a Cross Between O. rufipogon and Malaysian Rice Cultivar MR219


    Parviz Fasahat; Kharidah Muhammad; Aminah Abdullah; Wickneswari Ratnam


    Amylose content is one of the important grain quality properties of rice. A total of 10 new rice genotypes (BC2F7 generation) derived from a cross between O. rufipogon Griff. accession IRGC105491 and O. sativa subspecies indica cv. MR219 with high yield were evaluated for amylose content in three environments in Peninsular Malaysia. One of the parents, a popular high yielding Malaysian rice cultivar MR219 was used as a check. Based on the average amylose content across the environments, the g...

  11. 冠心病患者ABCA1基因R219K多态性分析%Polymorphism of R219K of ABCA1 gene in patients with coronary artery disease

    Institute of Scientific and Technical Information of China (English)

    王旭东; 傅研; 姜惠杰


    目的:探讨三磷酸腺苷(ATP)结合盒子转运体1(ATP-binding cassette transporter 1;ABC1,ABCAI)基因多态性与冠心病(CHD)发病和病情程度的相关性.方法:使用多聚合酶链式反应(PCR)和错配酶促切割法检测了222例CHD患者和278例健康对照者的DNA,分析了该基因编码区R219K多态性位点的不同基因型频率,其分布特点以及与血脂、CHD疾病程度的相关性.结果:R219K的变异等位基因频率CHD组和对照组分别为43.9%、50.2%,P <0.05,变异基因型(KK)携带者频率在急性冠状动脉综合征(ACS)组:稳定型心绞痛(SAP)组:对照组为20.0%:26.9%:27.7%,其ACS组与对照组差异有统计学意义(P<0.05),而SAP组与对照组差异无统计学意义(P>0.05).CHD组中KK基因型携带者的三酰甘油(TG)水平低于RR基因型携带者[(1.31±0.62):(1.56±0.63)mmol/L,P<0.05],而高密度脂蛋白水平高于后者[(1.01±0.12):(0.96±0.14)mmol/L,P<0.05].结论:ABCA1基因R219K多态性不仅与血脂水平并与CHD发病及病情严重程度明显相关.由于总体对象中K等位基因具有较高的频率(47%),计算的人群归因危险度结果提示,使本研究对象中CHD的患者减少了12%.

  12. Implementation in the reaction code system EMPIRE-2.19 of an advanced formalism for fission cross-section calculation

    International Nuclear Information System (INIS)

    Full text: The implementation in the reaction code system EMPIRE-2.19 of an advanced formalism for fission cross-section calculation has been completed. The formalism is based on the optical model for fission and can be applied for nuclei exhibiting double- or triple-humped barrier starting from sub-barrier excitation energies. The optical model for fission, initially developed to describe the resonant structure of the fission cross section at sub-barrier excitation energies due to the vibrational states in the second well of a double-humped fission barrier, was extended to light actinides by including the relations for the transmission coefficients through a complex triple-humped fission barrier. The real part of the fission barrier is parameterised as a function of the nucleus deformation by five smoothly joined parabolas. The imaginary potential is introduced only in the deformation range corresponding to the second well because the tertiary well is supposed to be shallow enough to neglect the damping of class III vibrational states. The transition states are assumed to be rotational states built on vibrational or non-collective band-heads. As the excitation energy increases, the shell effect, which causes the splitting of the outer barrier, diminishes and the outer humps lump into a single one. Therefore, in the present formalism, triple-humped barriers are associated only to the discrete transition states; the contribution of continuum to the fission coefficients is calculated considering a double-humped barrier. The parameters of the second single barrier equivalent with the outer humps are being determined from the condition of equal transmission coefficients. The saddle-point transition states in continuum are described by level densities (BCS below the critical energy and a modified version of Fermi Gas above) accounting for collective enhancements specific to the nuclear shape asymmetry at each saddle point . The neutron cross sections of 232Th in the

  13. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7... (United States)


    ... and impede the deployment of service to the public, and an additional default payment of more than... COMMISSION Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7... overnight U.S. Postal Service mail. All filings must be addressed to the Commission's Secretary, Attn:...

  14. 17 CFR 274.219 - Form N-17f-1, cover page for each certificate of accounting of securities and similar investments... (United States)


    ... each certificate of accounting of securities and similar investments of a management investment company.... Editorial Note: For Federal Register citations affecting Form N-17f-1, see the List of CFR Sections Affected... PRESCRIBED UNDER THE INVESTMENT COMPANY ACT OF 1940 Forms for Other Statements § 274.219 Form N-17f-1,...

  15. Germination Response of MR 219 Rice Variety to Different Exposure Times and Periods of 2450 MHz Microwave Frequency

    Directory of Open Access Journals (Sweden)

    Daryush Talei


    Full Text Available Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR, germination percentage (GP, and mean germination time (MGT were analyzed by exposing its seeds to 2450 MHz of microwave frequency for one, four, seven, and ten hours. It was revealed that exposing the seeds to the microwave frequency for 10 hours resulted in the highest GP. This treatment led to 100% of germination after three days with a mean germination time of 2.1 days. Although the other exposure times of microwave frequency caused the moderate effects on germination with a GPa3 ranged from 93% to 98%, they failed to reduce the MGTa3. The results showed that ten-hour exposure times of microwave frequency for six days significantly facilitated and improved the germination indices (primary shoot and root length. Therefore, the technique is expected to benefit the improvement of rice seed germination considering its simplicity and efficacy in increasing the germination percentage and rate as well as the primary shoot and root length without causing any environmental toxicity.

  16. Introgression of Blast Resistance Genes (Putative Pi-b and Pi-kh) into Elite Rice Cultivar MR219 through Marker-Assisted Selection


    Tanweer, Fatah A.; Rafii, Mohd Y.; Sijam, Kamaruzaman; Rahim, Harun A.; Ahmed, Fahim; ASHKANI, SADEGH; Latif, Mohammad A.


    Blast is the most common biotic stress leading to the reduction of rice yield in many rice-growing areas of the world, including Malaysia. Improvement of blast resistance of rice varieties cultivated in blast endemic areas is one of the most important objectives of rice breeding programs. In this study, the marker-assisted backcrossing strategy was applied to improve the blast resistance of the most popular Malaysian rice variety MR219 by introgressing blast resistance genes from the Pongsu S...

  17. Influence of ATP-Binding Cassette Transporter 1 R219K and M883I Polymorphisms on Development of Atherosclerosis: A Meta-Analysis of 58 Studies


    Yin, Yan-Wei; Li, Jing-Cheng; Gao, Dong; Chen, Yan-Xiu; Li, Bing-Hu; Wang, Jing-Zhou; Liu, Yun; Liao, Shao-Qiong; Zhang, Ming-Jie; Chang-yue GAO; Zhang, Li-li


    Background Numerous epidemiological studies have evaluated the associations between ATP-binding cassette transporter 1 (ABCA1) R219K (rs2230806) and M883I (rs4149313) polymorphisms and atherosclerosis (AS), but results remain controversial. The purpose of the present study is to investigate whether these two polymorphisms facilitate the susceptibility to AS using a meta-analysis. Methods PubMed, Embase, Web of Science, Medline, Cochrane database,, Current Controlled Trials,...

  18. 76 FR 70336 - Airworthiness Directives; Rolls-Royce plc RB211-524G2-19; -524G2-T-19; -524G3-19; -524G3-T-19... (United States)


    ... April 11, 2000 (65 FR 19477-78). Authority for This Rulemaking Title 49 of the United States Code... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... plc RB211-524G2-19; -524G2- T-19; -524G3-19; -524G3-T-19; 524H2-19; -524H2-T-19; -524H-36; and -...

  19. Corrective Action Investigation Plan for Corrective Action Unit 219: Septic Systems and Injection Wells, Nevada Test Site, Nevada, Rev. No.: 0

    Energy Technology Data Exchange (ETDEWEB)

    David A. Strand


    The Corrective Action Investigation Plan for Corrective Action Unit 219, Septic Systems and Injection Wells, has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy, and the U.S. Department of Defense. The purpose of the investigation is to ensure that adequate data are collected to provide sufficient and reliable information to identify, evaluate, and select technically viable corrective actions. Corrective Action Unit 219 is located in Areas 3, 16, and 23 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 219 is comprised of the six Corrective Action Sites (CASs) listed below: (1) 03-11-01, Steam Pipes and Asbestos Tiles; (2) 16-04-01, Septic Tanks (3); (3) 16-04-02, Distribution Box; (4) 16-04-03, Sewer Pipes; (5) 23-20-01, DNA Motor Pool Sewage and Waste System; and (6) 23-20-02, Injection Well. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives. Additional information will be obtained by conducting a corrective action investigation prior to evaluating corrective action alternatives and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document.

  20. Characterization of the K2-19 Multiple-Transiting Planetary System via High-Dispersion Spectroscopy, AO Imaging, and Transit Timing Variations

    CERN Document Server

    Narita, Norio; Fukui, Akihiko; Hori, Yasunori; Sanchis-Ojeda, Roberto; Winn, Joshua N; Ryu, Tsuguru; Kusakabe, Nobuhiko; Kudo, Tomoyuki; Onitsuka, Masahiro; Delrez, Laetitia; Gillon, Michael; Jehin, Emmanuel; McCormac, James; Holman, Matthew; Izumiura, Hideyuki; Takeda, Yoichi; Tamura, Motohide; Yanagisawa, Kenshi


    K2-19 (EPIC201505350) is a unique planetary system in which two transiting planets with radii ~ 7 $R_{Earth}$ (inner planet b) and ~ 4 $R_{Earth}$ (outer planet c) have orbits that are nearly in a 3:2 mean-motion resonance. Here, we present results of ground-based follow-up observations for the K2-19 planetary system. We have performed high-dispersion spectroscopy and high-contrast adaptive-optics imaging of the host star with the HDS and HiCIAO on the Subaru 8.2m telescope. We find that the host star is relatively old (>8 Gyr) late G-type star ($T_{eff}$ ~ 5350 K, $M_s$ ~ 0.9 $M_{Sun}$, and $R_{s}$ ~ 0.9 $R_{Sun}$). We do not find any contaminating faint objects near the host star which could be responsible for (or dilute) the transit signals. We have also conducted transit follow-up photometry for the inner planet with KeplerCam on the FLWO 1.2m telescope, TRAPPISTCAM on the TRAPPIST 0.6m telescope, and MuSCAT on the OAO 1.88m telescope. We confirm the presence of transit-timing variations, as previously re...

  1. Yield Traits, Physico-chemical Characteristics and Nutritional Composition of MR219 M3 Generation and its Effect on Glycemic Index and Responses in Animal Model

    International Nuclear Information System (INIS)

    Mutation technique is a conventional breeding technique and it is very effective in improving of main crop characteristics such as yield traits, resistance to diseases and pests and nutritional qualities. In this study, MR219 seeds were treated with Carbon ion radiation (60 Gy) by AVF-Cyclotron at the Japan Atomic Energy Research Institute (JAERI), Takasaki, Japan and were planted at the Malaysian Nuclear Agency up to third mutant generation (M3). Thirty one M3 mutant lines (ML1 to ML31) were evaluated on morphological, yield and yield components, and were compared to the parental variety, MR219. Analysis of variance revealed that there was a significant difference among mutant lines in culm height, days to flowering, number of tillers, number of panicles, 1000 grain weight, total grain weight, total of dry matter, alkaline spreading value, gel consistency, amylose content, ash, crude protein, fat, dietary fibre, carbohydrate and energy. Mutant line ML21 had the best performance in majority of yield components and vegetative traits as compared to others mutant lines and parental variety. For nutritional composition, mutant lines namely ML31, ML21, ML10, ML19 were improved in crude protein content, dietary fibre and carbohydrate content. The estimation of glycemic index revealed that two mutant lines namely ML3 and ML30 can be consumed by diabetics. (author)

  2. Corrective Action Decision Document/Closure Report for Corrective Action Unit 219: Septic Systems and Injection Wells, Nevada Test Site, Nevada, Rev. No.: 0

    Energy Technology Data Exchange (ETDEWEB)

    David Strand


    This Corrective Action Decision Document/Closure Report has been prepared for Corrective Action Unit (CAU) 219, Septic Systems and Injection Wells, in Areas 3, 16, and 23 of the Nevada Test Site, Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 219 is comprised of the following corrective action sites (CASs): (1) 03-11-01, Steam Pipes and Asbestos Tiles; (2) 16-04-01, Septic Tanks (3); (3) 16-04-02, Distribution Box; (4) 16-04-03, Sewer Pipes; (5) 23-20-01, DNA Motor Pool Sewage and Waste System; and (6) 23-20-02, Injection Well. The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation for closure of CAU 219 with no further corrective action beyond the application of a use restriction at CASs 16-04-01, 16-04-02, and 16-04-03. To achieve this, corrective action investigation (CAI) activities were performed from June 20 through October 12, 2005, as set forth in the CAU 219 Corrective Action Investigation Plan and Record of Technical Change No. 1. A best management practice was implemented at CASs 16-04-01, 16-04-02, and 16-04-03, and corrective action was performed at CAS 23-20-01 between January and April 2006. In addition, a use restriction will be applied to CASs 16-04-01, 16-04-02, and 16-04-03 to provide additional protection to Nevada Test Site personnel. The purpose of the CAI was to fulfill the following data needs as defined during the data quality objective (DQO) process: (1) Determine whether contaminants of concern (COCs) are present. (2) If COCs are present, determine their nature and extent. (3) Provide sufficient information and data to complete appropriate corrective actions. The CAU 219 dataset from the investigation results was evaluated based on the data quality indicator parameters. This evaluation demonstrated the quality and acceptability of the dataset for use in fulfilling

  3. HDM2 antagonist MI-219 (spiro-oxindole, but not Nutlin-3 (cis-imidazoline, regulates p53 through enhanced HDM2 autoubiquitination and degradation in human malignant B-cell lymphomas

    Directory of Open Access Journals (Sweden)

    Sosin Angela M


    Full Text Available Abstract Background Lymphomas frequently retain wild-type (wt p53 function but overexpress HDM2, thereby compromising p53 activity. Therefore, lymphoma is a suitable model for studying the therapeutic value of disrupting the HDM2-p53 interaction by small-molecule inhibitors (SMIs. HDM2 have been developed and are under various stages of preclinical and clinical investigation. Previously, we examined the anti-lymphoma activity of MI-319, the laboratory grade of a new class of HDM2 SMI, the spiro-oxindole, in follicular lymphoma. Since then, MI-219, the clinical grade has become readily available. This study further examines the preclinical effects and mechanisms of MI-219 in a panel of human lymphoma cell lines as well as a cohort of patient-derived B-lymphcytes for its potential clinical use. Results Preclinical assessment of MI-219 was evaluated by means of an in vitro and ex vivo approach and compared to Nutlin-3, the gold standard. Characterization of p53 activity and stability were assessed by quantitative PCR, Western blot, and immunoprecipitation. Biological outcome was measured using Trypan blue exclusion assay, Annexin V/PI, PARP and caspase-3 cleavage. Surprisingly, the overall biological effects of Nutlin-3 were more delayed (48 h while MI-219 triggered an earlier response (12-24 h, predominantly in the form of apoptotic cell death. Using a cell free autoubiquitination assay, neither agent interfered with HDM2 E3 ligase function. MI-219 was more effective in upregulating wt-p53 stabilization compared to Nutlin-3. MI-219, but not Nutlin-3, enhanced the autoubiquitination and degradation of HDM2. Conclusions Our data reveals unexpected differences between MI-219 and the well-studied Nutlin-3 in lymphoma cell lines and patient samples. We suggest a novel mechanism for MI-219 that alters the functional activity of HDM2 through enhanced autoubiquitination and degradation. Additionally, this mechanism appears to correspond to biological

  4. Folding model analysis of 58Ni + 64Ni elastic and inelastic scattering at Elab=203.8 and 219.2 MeV

    International Nuclear Information System (INIS)

    Angular distributions of elastic scattering of 58Ni by 64Ni and inelastic scattering leading to the first 2+ state in 58Ni or in 64Ni were measured at Elab=203.8 and 219.2 MeV. The data were analyzed in the frame of the folding model. A renormalization N of the folding potential consistently lower than unity (N∼0.65) is needed to reproduce the elastic scattering data. Coupled-channel calculations including the main inelastic channels explain partly this discrepancy. They reproduce the elastic and inelastic scattering data with a renormalization of N∼0.8 at both energies. Interference between Coulomb and nuclear excitation is shown to play an important role in the repulsive character of the polarization potential. (author) 38 refs.; 6 figs.; 1 tab

  5. Determination of optimum welding parameters in connecting high alloyed X53CrMnNiN219 and X45CrSi93 steels by friction welding

    Indian Academy of Sciences (India)

    Mehmet Uzkut; Bekir Sadik Ünlü; Mustafa Akdağ


    In this study, different welding parameters were applied to two different steels with high alloys and mechanical and metallographical investigations are performed. Thus, the optimum welding parameters were determined for these materials and working conditions. 12.30 diameter steel bars made up of 1.4871 (X53CrMnNiN219) and 1.4718 (X45CrSi93) steel were used as experimental material. The material loss increased with increase in friction and rotating pressure. No fracture at the welding region was observed and the highest fracture energy was identified in B5 group. Based on micro hardness investigation; the hardness profile reached its minimum value at the welding region.

  6. Transient climate simulations of the deglaciation 21-9 thousand years before present; PMIP4 Core experiment design and boundary conditions (United States)

    Ivanovic, Ruza; Gregoire, Lauren; Kageyama, Masa; Roche, Didier; Valdes, Paul; Burke, Andrea; Drummond, Rosemarie; Peltier, W. Richard; Tarasov, Lev


    The last deglaciation, which marked the transition between the last glacial and present interglacial periods, was punctuated by a series of rapid (centennial and decadal) climate changes. Numerical climate models are useful for investigating mechanisms that underpin the events, especially now that some of the complex models can be run for multiple millennia. We have set up a Paleoclimate Modelling Intercomparison Project (PMIP) working group to coordinate efforts to run transient simulations of the last deglaciation, and to facilitate the dissemination of expertise between modellers and those engaged with reconstructing the climate of the last 21 thousand years. Here, we present the design of a coordinated Core simulation over the period 21-9 thousand years before present (ka) with time varying orbital forcing, greenhouse gases, ice sheets, and other geographical changes. A choice of two ice sheet reconstructions is given. Additional focussed simulations will also be coordinated on an ad-hoc basis by the working group, for example to investigate the effect of ice sheet and iceberg meltwater, and the uncertainty in other forcings. Some of these focussed simulations will concentrate on shorter durations around specific events to allow the more computationally expensive models to take part. Ivanovic, R. F., Gregoire, L. J., Kageyama, M., Roche, D. M., Valdes, P. J., Burke, A., Drummond, R., Peltier, W. R., and Tarasov, L.: Transient climate simulations of the deglaciation 21-9 thousand years before present; PMIP4 Core experiment design and boundary conditions, Geosci. Model Dev. Discuss., 8, 9045-9102, doi:10.5194/gmdd-8-9045-2015, 2015.

  7. 中国人内源性高甘油三酯血症患者ATP结合盒转运子A1基因R219K多态性研究%Analysis of ATP binding cassette A1 gene R219K polymorphism in patients with endogenous hypertriglyceridemia in Chinese population

    Institute of Scientific and Technical Information of China (English)

    吴银; 白怀; 刘瑞; 刘宇; 刘秉文


    目的 研究ATP结合盒转运子A1(ATP binding cassette A1, ABCA1)基因R219K多态性是否与中国人内源性高甘油三酯血症(hypertriglyceridemia, HTG)有关联,为探讨本病的分子遗传基础提供依据.方法 应用聚合酶链反应-限制性片段长度多态性分析法,对成都地区309名汉族人(200名正常人和109例内源性高甘油三酯血症患者)ABCA1基因R219K多态性位点进行分析.结果 中国人ABCA1基因R219K多态位点K等位基因频率在对照组和HTG组分别为0.472与0.436; HTG组和对照组R219K位点之间基因型和等位基因的频率差异无统计学意义.对照组和HTG组KK基因型携带者血清高密度脂蛋白胆固醇(high density lipoprotein-cholesterol, HDL-C)水平均较相应组RR基因型携带者显著升高[(1.48±0.45) mmol/L vs (1.27±0.29) mmol/L, P<0.05;(1.07±0.30) mmol/L vs (0.87±0.19) mmol/L, P<0.05];对照组RK型携带者血清甘油三酯水平较RR型携带者显著降低[(1.22±0.37) mmol/L vs (1.41±0.84) mmol/L, P<0.05],HTG组血清甘油三酯在RR、RK、KK型之间有逐渐降低的趋势[(3.82±2.02) mmol/L vs (3.42±1.67) mmol/L vs (3.33±1.43) mmol/L, P>0.05]; HTG组K等位基因携带者(RK或KK型者)总胆固醇(total cholesterol, TC)/HDL-C比值均较RR型携带者显著降低(KK vs RK vs RR:4.82±1.28 vs 5.42±1.62 vs 6.33±1.70, P<0.05).结论 ABCA1基因R219K多态性不仅与中国成都地区正常汉族人血清HDL-C、甘油三酯含量有关,而且还与内源性高甘油三酯血症患者血清HDL-C水平、TC/HDL-C比值相关联.

  8. Transient climate simulations of the deglaciation 21-9 thousand years before present (version 1) - PMIP4 Core experiment design and boundary conditions (United States)

    Ivanovic, Ruza F.; Gregoire, Lauren J.; Kageyama, Masa; Roche, Didier M.; Valdes, Paul J.; Burke, Andrea; Drummond, Rosemarie; Peltier, W. Richard; Tarasov, Lev


    The last deglaciation, which marked the transition between the last glacial and present interglacial periods, was punctuated by a series of rapid (centennial and decadal) climate changes. Numerical climate models are useful for investigating mechanisms that underpin the climate change events, especially now that some of the complex models can be run for multiple millennia. We have set up a Paleoclimate Modelling Intercomparison Project (PMIP) working group to coordinate efforts to run transient simulations of the last deglaciation, and to facilitate the dissemination of expertise between modellers and those engaged with reconstructing the climate of the last 21 000 years. Here, we present the design of a coordinated Core experiment over the period 21-9 thousand years before present (ka) with time-varying orbital forcing, greenhouse gases, ice sheets and other geographical changes. A choice of two ice sheet reconstructions is given, and we make recommendations for prescribing ice meltwater (or not) in the Core experiment. Additional focussed simulations will also be coordinated on an ad hoc basis by the working group, for example to investigate more thoroughly the effect of ice meltwater on climate system evolution, and to examine the uncertainty in other forcings. Some of these focussed simulations will target shorter durations around specific events in order to understand them in more detail and allow for the more computationally expensive models to take part.

  9. Probabilistic risk assessment: Number 219

    International Nuclear Information System (INIS)

    This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)

  10. Evaluation of Adenosine Triphosphate-Binding Cassette Transporter A1 (ABCA1) R219K and C-Reactive Protein Gene (CRP) +1059G/C Gene Polymorphisms in Susceptibility to Coronary Heart Disease. (United States)

    Li, Jing-Fang; Peng, Dian-Ying; Ling, Mei; Yin, Yong


    BACKGROUND This meta-analysis investigated the correlation of ABCA1 R219K and C-Reactive Protein Gene (CRP) +1059G/C gene polymorphisms with susceptibility to coronary heart disease (CHD). MATERIAL AND METHODS We searched PubMed, Springer link, Wiley, EBSCO, Ovid, Wanfang database, VIP database, and China National Knowledge Infrastructure (CNKI) databases to retrieve published studies by keyword. Searches were filtered using our stringent inclusion and exclusion criteria. Resultant high-quality data collected from the final selected studies were analyzed using Comprehensive Meta-analysis 2.0 software. Eleven case-control studies involving 3053 CHD patients and 3403 healthy controls met our inclusion criteria. Seven studies were conducted in Asian populations, 3 studies were done in Caucasian populations, and 1 was in an African population. RESULTS Our major finding was that ABCA1 R219K polymorphism increased susceptibility to CHD in allele model (OR=0.729, 95% CI=0.559~0.949, P=0.019) and dominant model (OR=0.698, 95% CI=0.507~0.961, P=0.027). By contrast, we were unable to find any significant association between the CRP +1059G/C polymorphism and susceptibility to CHD (allele model: OR=1.170, 95% CI=0.782~1.751, P=0.444; dominant model: OR=1.175, 95% CI=0.768~1.797, P=0.457). CONCLUSIONS This meta-analysis provides convincing evidence that polymorphism of ABCA1 R219K is associated with susceptibility to CHD while the CRP +1059G/C polymorphism appears to have no correlation with susceptibility to CHD. PMID:27560308

  11. Evaluation of Adenosine Triphosphate-Binding Cassette Transporter A1 (ABCA1) R219K and C-Reactive Protein Gene (CRP) +1059G/C Gene Polymorphisms in Susceptibility to Coronary Heart Disease (United States)

    Li, Jing-Fang; Peng, Dian-Ying; Ling, Mei; Yin, Yong


    Background This meta-analysis investigated the correlation of ABCA1 R219K and CRP +1059G/C gene polymorphisms with susceptibility to coronary heart disease (CHD). Material/Methods We searched PubMed, Springer link, Wiley, EBSCO, Ovid, Wanfang database, VIP database, and China National Knowledge Infrastructure (CNKI) databases to retrieve published studies by keyword. Searches were filtered using our stringent inclusion and exclusion criteria. Resultant high-quality data collected from the final selected studies were analyzed using Comprehensive Meta-analysis 2.0 software. Eleven case-control studies involving 3053 CHD patients and 3403 healthy controls met our inclusion criteria. Seven studies were conducted in Asian populations, 3 studies were done in Caucasian populations, and 1 was in an African population. Results Our major finding was that ABCA1 R219K polymorphism increased susceptibility to CHD in allele model (OR=0.729, 95% CI=0.559~0.949, P=0.019) and dominant model (OR=0.698, 95% CI=0.507~0.961, P=0.027). By contrast, we were unable to find any significant association between the CRP +1059G/C polymorphism and susceptibility to CHD (allele model: OR=1.170, 95% CI=0.782~1.751, P=0.444; dominant model: OR=1.175, 95% CI=0.768~1.797, P=0.457). Conclusions This meta-analysis provides convincing evidence that polymorphism of ABCA1 R219K is associated with susceptibility to CHD while the CRP +1059G/C polymorphism appears to have no correlation with susceptibility to CHD. PMID:27560308

  12. Development of X80M Steel Gradeφ1 219 mm×33 mm Pipeline Steel Pipe%X80M钢级φ1219 mm×33 mm管线钢管的开发

    Institute of Scientific and Technical Information of China (English)

    张志明; 韩秀林; 姜金星; 武占芳; 刘宏博; 刘鉴卫; 赵彪


    通过对X80M钢级Φ1 219 mm×33 mm大壁厚管线钢管千吨级的试制, 总结了大壁厚管线钢管开发的技术特点. 采用超低C, 控Mn, Nb和Ti微合金化成分设计和轻压下、 热机械控制工艺(TMCP)超快冷等工艺控制措施, 国内首次批量开发出了X80M钢级33 mm大壁厚管线钢. 其母材微观组织为细小针状铁素体加弥散粒状贝氏体. 通过制管后检测, 母材及焊缝的拉伸性能、 冲击韧性和止裂性能等完全满足陕京四线工程的要求.%Through kiloton trial production for X80M Φ1 219 mm ×33 mm pipeline steel pipe, it summarized the technical characteristics of line pipe with heavy wall thickness. By the use of ultra-low C, control Mn, Nb, Ti micro-alloying composition design and soft reduction, TMCP ultrafast cold and other control measures, the X80 pipeline steel with 33 mm thickness was developed firstly in China domestic. The microstructure of base metal consists of small timber acicular ferrite and diffuse granular bainite. Through the detection, the tensile properties, impact toughness of base metal and?weld, crack arrest performance fully meet the rigorous requirements of NO.4 Shaanxi Beijing pipeline project.

  13. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    International Nuclear Information System (INIS)

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  14. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)


    Waldek, Achim Marcus


    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  15. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    International Nuclear Information System (INIS)

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  16. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  17. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications


    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon


    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  18. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  19. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    International Nuclear Information System (INIS)

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  20. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    International Nuclear Information System (INIS)

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  1. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  2. 36 CFR 219.36 - Definitions. (United States)


    ... conditions and trends of ecosystem composition, structure, and processes are deemed useful for setting objectives for desired conditions and for judging the effectiveness of plan decisions. Responsible official... Policy Act (NEPA) and the Council on Environmental Quality regulations (40 CFR chapter V) as described...

  3. 20 CFR 219.2 - Definitions. (United States)


    ... some other person. Benefit means any employee annuity, spouse annuity, survivor annuity, or lump-sum... proves to the satisfaction of the Board that an individual meets a requirement for eligibility...

  4. 32 CFR 219.102 - Definitions. (United States)


    ... subject's environment that are performed for research purposes. Interaction includes communication or interpersonal contact between investigator and subject. “Private information” includes information...

  5. 36 CFR 219.1 - Purpose. (United States)


    ... continuation of this array of benefits, this regulation affirms sustainability as the overall goal for... management of these lands. (3) Sustainability, composed of interdependent ecological, social, and economic... productivity of the land. Sustainability means meeting needs of the present generation without compromising...

  6. 12 CFR 219.3 - Cost reimbursement. (United States)


    ... financial records pertaining to a customer, by written request, through: (i) A court order; (ii) A subpoena... industry category “Credit Intermediation and Related Activities” (NAICS Code Number 522000) (or successor...” represented by “total benefits” for the “Credit Intermediation and Related Activities” industry...

  7. 32 CFR 219.107 - IRB membership. (United States)


    ... the institution. The IRB shall be sufficiently qualified through the experience and expertise of its members, and the diversity of the members, including consideration of race, gender, and cultural... IRB consists entirely of men or entirely of women, including the institution's consideration...

  8. 36 CFR 219.2 - Principles. (United States)


    ... achievement of goals. (b) Planning contributes to social and economic sustainability by providing for a wide... responsive to a broad range of ecological, social, and economic. (5) Planning acknowledges the limits...

  9. Association between ε2/3/4, Promoter Polymorphism (−491A/T, −427T/C, and −219T/G at the Apolipoprotein E Gene, and Mental Retardation in Children from an Iodine Deficiency Area, China

    Directory of Open Access Journals (Sweden)

    Jun Li


    Full Text Available Background. Several common single-nucleotide polymorphisms (SNPs at apolipoprotein E (ApoE have been linked with late onset sporadic Alzheimer’s disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n=130, borderline MR (n=124, and controls (n=334 from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ2 test (P>0.05. However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004, indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4 and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.

  10. Assessment of soil contamination by potentially toxic trace elements (PTSD) (As, Cd, Cu, Hg, Pb, Zn) in a lower plain of the Hron River according to Law no. 219/2008 Coll., by geo-accumulation index, anthropogenic factor and Tomlinson index

    International Nuclear Information System (INIS)

    Soil contamination by different PTSD may have different geogenic and anthropogenic origin and occurs in all countries of the world. The aim of this paper is to evaluate the soils contamination of a lower plain of the Hron River. This paper used the results of the thesis Soil contamination of the Hron River floodplain by trace elements (As, Cd, Cu, Hg, Pb, Zn) [1]. Soil contamination was evaluated by: Act. 219/2008 Coll. on the protection and use of agricultural land, by anthropogenic factor (AF), geo-accumulation index (IgeoE) and Tomlinson index - the index of the pollution load (PLI). (author)

  11. Investigation on the Full Thickness Repair Welding Process of X80Mφ1 219 mm×18.4 mm SAWH Pipe%X80M级准1219 mm×18.4 mm螺旋埋弧焊管全壁厚补焊工艺研究

    Institute of Scientific and Technical Information of China (English)

    杨军; 苟世峰; 符利兵; 陈长青


    利用夏比冲击、显微硬度和拉伸试验对6种焊材在相同补焊工艺下的全壁厚刨透补焊焊缝进行了性能对比研究,筛选出焊缝性能较优的对应补焊焊材。并以此焊材作为X80M级φ1219 mm ×18.4 mm螺旋埋弧焊管焊缝缺陷手工修补用专用焊材,进行了不同补焊工艺参数的全壁厚刨透补焊试验,并对补焊焊缝进行低温冲击试验,通过比较确定出X80M级φ1219 mm×18.4 mm螺旋埋弧焊管全壁厚刨透补焊工艺方案。结果表明,上海焊接器材厂生产的SH J557焊条用于X80M级φ1219 mm×18.4 mm螺旋埋弧焊管焊缝缺陷全壁厚刨透手工修补更为合适,各项性能指标更高;确定的补焊工艺参数合理可行,确保了补焊焊缝的质量和钢管的批量化生产。%The properties of full thickness repair welding seam that generated by 6 kinds of welding material under the same repair welding condition were comparatively investigated by V-notch Charpy impact toughness test, micro-hardness test and tensile test, and selected out the repair welding material matching with better weld performance. Taking the selected welding material as special welding material for manual repairing the weld defect in φ1 219 mm ×18.4 mm X80M SAWH pipe, the full thickness repair welding tests for the different welding process parameter were conducted, and the low temperature impact test for repair weld was carried out. Finally, it determined the repair welding process for φ1 219 mm×18.4 mm X80M SAWH pipe. The results indicated that the SHJ557 welding electrode produced by Shanghai Welding Equipment Factory is more suitable for the above repair welding process of φ1 219 mm ×18.4 mm X80M SAWH pipe, the various performance indexes are higher; the determined repair welding process parameters are reasonable, it ensures the quality of repair weld and the mass production of steel pipe.

  12. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  13. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  14. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  15. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  16. Dicty_cDB: CHM219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rkl*s*attnigngfeirtlfnelfll**trkcfrekrrnr*c*s l*vykirfw*kngvkireil*se*rkkipskkikpikti*v*...LYKTKNSINTLTFVDERRDKFFGKESRQEDKIAEQKLIAIS AGVKE--- ---*rdihniy*rekkiiilsnhkywkrirdpnii**iifiiinskmf*rkkke*mmlkf isl*n*ilvkk...yghhmd*qyihiwdyhy*iqyyyyyleqy*qmviqy*pnkkr ymkrtkky*q*kkhlki**iyikqktv*ih*pl*mkeetnflekkvdkrtrlqnkn**qy qqe*k--- ---tretftifikek...rtksg t*kerksissrrsi*kfnefi*nkkqykyinlcr*kkrqifwkrk*trgqdcrtkinsni srskr--- ---LERHSQYLLKRKENYNPKQPQIL...0 m3a: 0.00 m3b: 0.00 m_ : 0.00 36.0 %: extracellular, including cell wall 32.0 %: plasma membrane 20.0 %: endoplasmic re

  17. Dicty_cDB: VHM219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NNNNN Length of 5' end seq. 620 3' end seq. ID - 3' end seq. - Length of 3' end seq. - Connect...ed seq. ID - Connected seq. - Length of connected seq. - Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...skrsf*nk*f*ism ftfnnnlihwfkcnihyshaillnpnwldvngclsywfngnw**lys*nffkesis*fny wnncnvtivis...) Oryza sativa Japonica Group genom... 109 5e-23 U09503_1( U09503 |pid:none) Arabidopsis thaliana Co...lumbia chloropl... 108 9e-23 AF229392_1( AF229392 |pid:none) Arabidopsis thaliana cultivar Colu... 1

  18. 29 CFR 1910.219 - Mechanical power-transmission apparatus. (United States)


    ... described in paragraph (o)(5) of this section. (3) Tail rods or extension piston rods. Tail rods or extension piston rods shall be guarded in accordance with paragraphs (m) and (o) of this section, or by a... when rod is fully extended. (c) Shafting—(1) Installation. (i) Each continuous line of shafting...

  19. Dicty_cDB: VFA219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N BD092935 |BD092935.1 Methods and compositions for synthesis of long chain poly...unsaturated fatty acids in plants. 1213 0.0 3 BD082645 |BD082645.1 Methods and compositions for synthesis of... long chain polyunsaturated fatty acids. 1213 0.0 3 BD082630 |BD082630.1 Methods and compositions for synthe

  20. 24 CFR 884.219 - Overcrowded and underoccupied units. (United States)


    ... Contract unit is larger than appropriate for the size of the Family in occupancy, housing assistance payments with respect to such unit will not be abated, unless the Owner fails to offer the Family a... reasonable time, HUD (or the PHA) will assist the Family in finding a suitable dwelling unit and require...

  1. 49 CFR 219.203 - Responsibilities of railroads and employees. (United States)


    ... duty tour. An employee who has been transported to receive medical care is not released from duty for... testing does not excuse such refusal by the employee timely to provide the required specimens. (c)...

  2. 48 CFR 52.219-1 - Small Business Program Representations. (United States)


    ... check the category in which its ownership falls: __ Black American. __ Hispanic American. __ Native American (American Indians, Eskimos, Aleuts, or Native Hawaiians). __ Asian-Pacific American (persons with... provision: Small Business Program Representations (MAY 2004) (a)(1) The North American...

  3. Dicty_cDB: VSF219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.009 2 BU042820 |BU042820.1 PP_LEa0014B11f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LE...a0014B11f, mRNA sequence. 52 0.010 1 BU041769 |BU041769.1 PP_LEa0010G24f Peach developing...32.1 PP_LEa0019F12f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0019F12f, mRNA sequence.

  4. 47 CFR 90.219 - Use of signal boosters. (United States)


    ... fill in only weak signal areas and cannot extend the system's normal signal coverage area. (b) Class A... effective radiated power (ERP) of the unit to a maximum of 5 watts under all conditions. Class B broadband signal boosters are limited to 5 watts ERP for each authorized frequency that the booster is designed...

  5. 49 CFR 219.601 - Railroad random drug testing programs. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Random Alcohol and Drug Testing... be selected as the result of the exercise of discretion by the railroad. The selection method must...

  6. 20 CFR 725.219 - Duration of entitlement; child. (United States)


    ...; (3) The child attains age 18; and (i) Is not a student (as defined in § 725.209(b)) during any part of the month in which the child attains age 18; and (ii) Is not under a disability (as defined in § 725.209(a)(2)(ii)) at that time; (4) If the child's entitlement beyond age 18 is based on his or...

  7. 36 CFR 219.4 - Identification and consideration of issues. (United States)


    ... AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Framework for Planning... interested in or affected by National Forest System management; Presidential, Departmental, and Forest Service conservation leadership initiatives; cooperatively developed landscape goals (§...

  8. 49 CFR 219.9 - Responsibility for compliance. (United States)


    .... (a) Any person (an entity of any type covered under 1 U.S.C. 1, including but not limited to the... the standard of liability for a railroad will vary depending upon the requirement involved. See, e.g...) Any independent contractor or other entity that performs covered service for a railroad has the...

  9. 34 CFR 685.219 - Public Service Loan Forgiveness Program. (United States)


    ... organization that is publicly funded and whose principal activities pertain to crime prevention, control or reduction of crime, or the enforcement of criminal law. Military service, for uniformed members of the U.S... library or other school-based services; and (ii) Is not a business organized for profit, a labor union,...

  10. 48 CFR 52.219-9 - Small business subcontracting plan. (United States)


    ... business, and women-owned small business concerns. If the offeror is submitting an individual contract plan... women-owned small business concerns, with a separate part for the basic contract and separate parts for... of this contract entitled “Utilization of Small Business Concerns” in all subcontracts that...

  11. Research and Development of X80 Grade SAWH Pipe with Size of φ1 219 mm×22.0 mm%X80级准1219 mm×22.0 mm螺旋埋弧焊管的研制

    Institute of Scientific and Technical Information of China (English)

    陈楠; 孙志刚; 李建一; 孙少卿; 祁超; 王海生


    The X80 grade hot-rolled coil with large wall thickness was manufactured by using the technology of low carbon, high manganese, Nb-Mo compound additive, micro alloying, clean smelting, controlled rolling and controlled cooling. Through research on steel pipe low tress forming technology, welding speed optimization, double rack ultrasonic testing technology, the X80 grade SAWH pipe with size of φ1 219 mm×22.0 mm was developed. The property tests were conducted in accordance with relevant technical standard. The test results showed that the transverse yield strength of pipe body is 580~670 MPa;the tensile strength is 665~770 MPa;the tensile strength of weld seam is 695~760 MPa;the hardness of welded joint is less than 268 HV10 Under-10℃,the average impact energy of pipe body in transverse is higher than 319 J;the average impact energy of HAZ is higher than 183 J, and the average impact energy of weld seam is higher than 137 J. Under 0℃,the DWTT shear area of pipe body in transverse is 100%. The pipe is with good mechanical properties and weldability.%采用低C高Mn及Nb-Mo复合添加、微合金化设计和洁净化冶炼、控轧控冷工艺制造的X80级大壁厚热轧卷板,通过钢管低应力成型、焊接速度优选以及双探架超声波检测等技术,成功开发出X80级准1219 mm×22.0 mm螺旋埋弧焊管。按标准要求对该产品进行了组批力学性能试验,试验结果显示:钢管管体横向屈服强度为580~670 MPa,抗拉强度为665~770 MPa,焊缝抗拉强度为695~760 MPa;焊接接头最大硬度小于268 HV10;-10℃管体横向平均冲击功大于319 J,热影响区平均冲击功大于183 J,焊缝平均冲击功大于137 J;0℃管体横向DWTT剪切面积均为100%。试验结果表明,钢管整体具有良好的力学性能和可焊性。

  12. Polychlorinated biphenyls (PCB) analysis report for solid sample for 219S tank 102

    International Nuclear Information System (INIS)

    One waste sample was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Extraction follows closely method 354 C of SW-846, analysis follows SW-846 method 8082. A cross reference of laboratory sample number to the customer identification is given in a table

  13. Calibration of ground-based lidar instrument WLS7-219

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Wagner, Rozenn

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...... measurements are given for information only....

  14. Calibration of ground-based Lidar instrument WLS7-219

    DEFF Research Database (Denmark)

    Yordanova, Ginka; Gómez Arranz, Paula

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...... measurements are given for information only....

  15. 49 CFR 219.201 - Events for which testing is required. (United States)


    ... conveyance at a rail/highway grade crossing. No test may be required in the case of an accident/incident the... physical damage be specifically described. (2) A railroad must not require an employee to provide blood...

  16. 7 CFR 2.19 - Under Secretary for Food, Nutrition, and Consumer Services. (United States)


    ... responsibilities. (vi) Serve as a consumer ombudsman and communication link between consumers and the Department... costs for use as standards by families of different sizes, sex-age composition, and economic...

  17. 28 CFR 2.219 - Maximum terms of imprisonment and supervised release. (United States)


    .... 22-2105 Manslaughter 5 years 3 years. 22-2105, 4502 Manslaughter: armed * 5 years 5 years. 22-2201(e... degree 5 years 5 years. Manslaughter 5 years 5 years. Kidnapping 5 years 5 years. Assault with intent to... enforcement officer, second degree murder, manslaughter, kidnapping 5 years 3 years. Attempt/conspiracy...

  18. 2-[1-(9-Anthrylmethyl-1H-pyrazol-3-yl]pyridine

    Directory of Open Access Journals (Sweden)

    Shi-Lu Zhang


    Full Text Available The title compound, C23H17N3, can be used in coordination chemistry. The anthracene ring makes dihedral angles of 86.08 (5 and 76.63 (6°, respectively, with the pyridine and pyrazole rings. The dihedral angle between the pyrazole and pyrimidine rings is 11.79 (7°. In the structure, weak intermolecular C—H...N hydrogen bonds are observed.

  19. 20 CFR 219.37 - Evidence of natural parent or child relationship. (United States)


    ... copy of the child's public or religious birth record. (b) Other evidence of parent or child... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of natural parent or child... parent or child relationship. (a) Preferred evidence. If the claimant is the natural parent of...

  20. 20 CFR 219.34 - When evidence that a marriage has ended is required. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence that a marriage has ended is... a marriage has ended is required. Evidence of how a previous marriage ended may be required to determine whether a later marriage is valid. If a widow or widower remarried after the employee's death...


    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Melanie; Schlasner, Steven; Sorensen, James; Hamling, John


    Carbon dioxide (CO2) is produced in large quantities during electricity generation and by industrial processes. These CO2 streams vary in terms of both composition and mass flow rate, sometimes substantially. The impact of a varying CO2 stream on pipeline and storage operation is not fully understood in terms of either operability or infrastructure robustness. This study was performed to summarize basic background from the literature on the topic of operational flexibility of CO2 transport and storage, but the primary focus was on compiling real-world lessons learned about flexible operation of CO2 pipelines and storage from both large-scale field demonstrations and commercial operating experience. Modeling and pilot-scale results of research in this area were included to illustrate some of the questions that exist relative to operation of carbon capture and storage (CCS) projects with variable CO2 streams. It is hoped that this report’s real-world findings provide readers with useful information on the topic of transport and storage of variable CO2 streams. The real-world results were obtained from two sources. The first source consisted of five full-scale, commercial transport–storage projects: Sleipner, Snøhvit, In Salah, Weyburn, and Illinois Basin–Decatur. These scenarios were reviewed to determine the information that is available about CO2 stream variability/intermittency on these demonstration-scale projects. The five projects all experienced mass flow variability or an interruption in flow. In each case, pipeline and/or injection engineers were able to accommodate any issues that arose. Significant variability in composition has not been an issue at these five sites. The second source of real- world results was telephone interviews conducted with experts in CO2 pipeline transport, injection, and storage during which commercial anecdotal information was acquired to augment that found during the literature search of the five full-scale projects. The experts represented a range of disciplines and hailed from North America and Europe. Major findings of the study are that compression and transport of CO2 for enhanced oil recovery (EOR) purposes in the United States has shown that impurities are not likely to cause transport problems if CO2 stream composition standards are maintained and pressures are kept at 10.3 MPa or higher. Cyclic, or otherwise intermittent, CO2 supplies historically have not impacted in-field distribution pipeline networks, wellbore integrity, or reservoir conditions. The U.S. EOR industry has demonstrated that it is possible to adapt to variability and intermittency in CO2 supply through flexible operation of the pipeline and geologic storage facility. This CO2 transport and injection experience represents knowledge that can be applied in future CCS projects. A number of gaps in knowledge were identified that may benefit from future research and development, further enhancing the possibility for widespread application of CCS. This project was funded through the Energy & Environmental Research Center–U.S. Department of Energy Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  2. 20 CFR 219.55 - Evidence of school attendance for child age 18. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of school attendance for child age... school attendance for child age 18. The child will be asked to submit (on a form furnished by the Board... statement from an official of the school verifying that the child is attending school full-time. The...

  3. 48 CFR 52.219-3 - Notice of total HUBZone set-aside. (United States)


    ... business concerns. (d) A HUBZone joint venture agrees that, in the performance of the contract, the... percent of the cost of personnel for contract performance will be spent for employees of the concern or... nonmanufacturer of the supplies), at least 50 percent of the cost of manufacturing, excluding the cost...

  4. 14 CFR 125.219 - Oxygen for medical use by passengers. (United States)


    ... title 49 CFR parts 171, 172, and 173, except § 173.24(a)(1); (ii) When owned by the certificate holder... the form of a compressed gas as defined in title 49 CFR 173.300(a)— (i) When owned by the certificate... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Oxygen for medical use by passengers....

  5. 48 CFR 52.219-25 - Small Disadvantaged Business Participation Program-Disadvantaged Status and Reporting. (United States)


    ...) (a) Disadvantaged status for joint venture partners, team members, and subcontractors. This clause addresses disadvantaged status for joint venture partners, teaming arrangement members, and subcontractors.... The Contractor shall obtain representations of small disadvantaged status from joint venture...

  6. 25 CFR 166.219 - How do I acquire a permit through negotiation? (United States)


    ... arrangement, the permit may be granted to a joint venture or other legal entity owned, in part, by the Indian... the Indian landowner a partner, joint venturer, or associate of the permittees. (e) We will...

  7. 32 CFR 219.101 - To what does this policy apply? (United States)


    ..., subpart C. The exemption at 45 CFR 46.101(b)(2), for research involving survey or interview procedures or... tests (cognitive, diagnostic, aptitude, achievement), survey procedures, interview procedures, or... assurances on file will abide by provisions of title 45 CFR part 46 subparts A-D. Some of the...

  8. 48 CFR 52.219-6 - Notice of Total Small Business Set-Aside. (United States)


    ... following clause: Notice of Total Small Business Set-Aside (JUN 2003) (a) Definition. Small business concern... business concerns and Federal Prison Industries, Inc. (FPI). Offers received from concerns that are...

  9. 48 CFR 52.219-18 - Notification of Competition Limited to Eligible 8(a) Concerns. (United States)


    ... made to the Small Business Administration, which will subcontract performance to the successful 8(a... that there are no small business manufacturers or processors in the Federal market in accordance with... of its stock or other ownership interest to any other party. (End of clause) Alternate I (APR...

  10. 14 CFR 120.219 - Handling of test results, record retention, and confidentiality. (United States)


    ... requirement. In addition to the records required to be maintained under 49 CFR part 40, employers must..., you must use the Management Information System (MIS) form and instructions as required by 49 CFR part 40 (at 49 CFR 40.26 and appendix H to 49 CFR part 40). You may also use the electronic version of...

  11. Muon scattering at 219 GeV and the proton structure functions

    International Nuclear Information System (INIS)

    Results on the proton structure function, F2, are presented for 0.3 2 2 and 10 < v < 200 GeV. The results support the conclusions of earlier work at 97 and 147 GeV that scaling is violated. A new value for R = sigma/sub s//sigma/sub T/ = 0.44 +- 0.25 has been obtained using all the Fermilab proton measurements

  12. 48 CFR 252.219-7004 - Small business subcontracting plan (test program). (United States)


    ... Subcontracting Plan (Test Program) (AUG 2008) (a) Definition. Subcontract, as used in this clause, means any... Contractor shall submit Standard Form (SF) 295, Summary Subcontract Report, in accordance with the... completed to include semi-annual cumulative— (i) Small business, small disadvantaged business, and...

  13. 36 CFR 219.16 - Relationships with interested individuals and organizations. (United States)


    ..., DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Collaborative... individuals and organizations to work collaboratively with one another to improve understanding and...

  14. Yeast Interacting Proteins Database: YPL031C, YPL219W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ting the cellular response to nutrient levels and environmental conditions and progression through the cell ...e cellular response to nutrient levels and environmental conditions and progression through the cell cycle R

  15. 29 CFR 778.219 - Pay for foregoing holidays and vacations. (United States)


    ... principle: (1) An employee whose rate of pay is $5 an hour and who usually works a 6-day 48-hour week is... earnings—$240. He foregoes his vacation and works 50 hours in the week in question. He is owed $250 as his... day. During the entire week he works a total of 50 hours. He is paid under his contract, $250...

  16. Codon 219 polymorphism of PRNP in healthy caucasians and Creutzfeldt-Jakob disease patients

    Energy Technology Data Exchange (ETDEWEB)

    Petraroli, R.; Pocchiari, M. [Instituto Superiore di Sanita, Rome (Italy)


    A number of point and insert mutations of the PrP gene (PRNP) have been linked to familial Creutzfeldt-Jakob disease (CJD) and Gerstmann-Straussler-Scheinker disease (GSS). Moreover, the methionine/valine homozygosity at the polymorphic codon 129 of PRNP may cause a predisposition to sporadic and iatrogenic CJD or may control the age at onset of familial cases carrying either the 144-bp insertion or codon 178, codon 198, and codon 210 pathogenic mutations in PRNP. In addition, the association of methionine or valine at codon 129 and the point mutation at codon 178 on the same allele seem to play an important role in determining either fatal familial insomnia or CJD. However, it is noteworthy that a relationship between codon 129 polymorphism and accelerated pathogenesis (early age at onset or shorter duration of the disease) has not been seen in familial CJD patients with codon 200 mutation or in GSS patients with codon 102 mutation, arguing that other, as yet unidentified, gene products or environmental factors, or both, may influence the clinical expression of these diseases. 17 refs.

  17. Study on laser atomic spectroscopy

    International Nuclear Information System (INIS)

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  18. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    International Nuclear Information System (INIS)

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  19. La Desercion Escolar en los Niveles de Sexto y Noveno Grado: Una Comparacion Entre Zonas Rurales y Urbanas. Boletin 219 (The Educational Desertion in the 6th and 9th Grades: A Comparison Between Rural and Urban Zones. Bulletin 219). (United States)

    Lopez, Maria I. Hernandez; And Others

    In 1962 and again in 1965, a group of sixth and ninth grade students in selected schools in four Puerto Rican communities were interviewed to investigate the factors influencing students' decision to withdraw from school before completing twelfth grade and to identify some characteristics of dropouts. Of 616 students interviewed in 1962, 20.9% of…

  20. Crystallization and preliminary crystallographic analysis of the catechol 2,3-dioxygenase PheB from Bacillus stearothermophilus BR219

    International Nuclear Information System (INIS)

    PheB, an extradiol-cleaving catecholic dioxygenase, was crystallized by the hanging-drop vapour-diffusion method using PEG 4000 as a precipitant. The crystal belongs to the orthorhombic system, space group P212121, and diffracts to 2.3 Å resolution. Class II extradiol-cleaving catecholic dioxygenase, a key enzyme of aromatic compound degradation in bacteria, cleaves the aromatic ring of catechol by adding two O atoms. PheB is one of the class II extradiol-cleaving catecholic dioxygenases and shows a high substrate specificity for catechol derivatives, which have one aromatic ring. In order to reveal the mechanism of the substrate specificity of PheB, PheB has been crystallized by the hanging-drop vapour-diffusion method using PEG 4000 as a precipitant. The space group of the obtained crystal was P212121, with unit-cell parameters a = 65.5, b = 119.2, c = 158.7 Å. The crystal diffracted to 2.3 Å resolution

  1. 32 CFR 219.103 - Assuring compliance with this policy-research conducted or supported by any Federal Department or... (United States)


    ... capacity; indications of experience such as board certifications, licenses, etc., sufficient to describe..., member of governing panel or board, stockholder, paid or unpaid consultant. Changes in IRB membership..., and for which provisions are made for meeting space and sufficient staff to support the IRB's...

  2. Lithium-vanadium advanced blanket development. ITER final report on U.S. contribution: Task T219/T220

    International Nuclear Information System (INIS)

    The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report

  3. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan... (United States)


    .../stage 4 LPT turbine blades shroud wear and subsequent high-cycle fatigue. They suggested that the... stage and 4th stage low- pressure turbine (LPT) blades for shroud notch wear and replacement of the... prevent turbine blade failures that could result in uncontained engine debris and damage to the...

  4. 75 FR 56533 - Wireless Telecommunications Bureau Postpones Auction of 218-219 MHz Service and Phase II 220 MHz... (United States)


    ... document announces the postponement of Auction 89. FOR FURTHER INFORMATION CONTACT: Wireless.... SUPPLEMENTARY INFORMATION: This is a summary of the Auction 89 Postponement Public Notice, which was released on August 26, 2010. The complete text of the Auction 89 Postponement Public Notice and related...

  5. Lithium-vanadium advanced blanket development. ITER final report on U.S. contribution: Task T219/T220

    Energy Technology Data Exchange (ETDEWEB)

    Smith, D.L.; Mattas, R.F. [comps.


    The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report.

  6. Generator method of 225Ac production without a carrier for nuclear medicine

    International Nuclear Information System (INIS)

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  7. Technical-evaluation report on the monitoring of electric power to the reactor-protection system for the Oyster Creek Nuclear Generating Station. (Docket No. 50-219)

    International Nuclear Information System (INIS)

    During the operating license review for Hatch 2, the Nuclear Regulatory Commission (NRC) staff raised a concern about the capability of the Class 1E reactor protection system (RPS) to operate after suffering sustained, abnormal voltage or frequency conditions from a non-Class 1E power supply. Abnormal voltage or frequency conditions could be produced as a result of one of the following causes: combinations of undetected, random single failures of the power supply components, or multiple failures of the power supply components caused by external phenomena such as a seismic event. The purpose of this report is to evaluate the licensees submittal with respect to the NRC criteria and present the reviewer's conclusion on the adequacy of the design modifications to protect the RPS from abnormal voltage and frequency conditions

  8. Proceedings of US/Japan workshop, Q219 on high heat flux components and plasma surface interactions for next fusion devices

    Energy Technology Data Exchange (ETDEWEB)

    Ulrickson, M.A.; Stevens, P.L.; Hino, T.; Hirohata, Y. [eds.


    This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage.

  9. Improving Lowland Rice (O. sativa L. cv. MR219 Plant Growth Variables, Nutrients Uptake, and Nutrients Recovery Using Crude Humic Substances

    Directory of Open Access Journals (Sweden)

    Perumal Palanivell


    Full Text Available High cation exchange capacity and organic matter content of crude humic substances from compost could be exploited to reduce ammonia loss from urea and to as well improve rice growth and soil chemical properties for efficient nutrients utilization in lowland rice cultivation. Close-dynamic air flow system was used to determine the effects of crude humic substances on ammonia volatilization. A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed with three rates of crude humic substances (20, 40, and 60 g pot−1. Standard procedures were used to evaluate rice plant dry matter production, nutrients uptake, nutrients recovery, and soil chemical properties. Application of crude humic substances increased ammonia volatilization. However, the lowest rate of crude humic substances (20 g pot−1 significantly improved total dry matter, nutrients uptake, nutrients recovery, and soil nutrients availability compared with crude humic substances (40 and 60 g pot−1 and the normal fertilization. Apart from improving growth of rice plants, crude humic substances can be used to ameliorate acid soils in rice cultivation. The findings of this study are being validated in our ongoing field trials.

  10. Reliability and measurement error of frontal and horizontal 3D spinal motion parameters in 219 patients with chronic low back pain

    DEFF Research Database (Denmark)

    Harsted, Steen; Mieritz, Rune M; Bronfort, Gert;


    were evaluated using intraclass correlation coefficients ICC(1,1) and Bland-Altman limits of agreement (LOAs). RESULTS: The reliability analysis based on the whole study sample showed ICC(1,1) coefficients varying between 0.68 and 0.73 for the frontal plane and 0.33 and 0.49 for the horizontal plane....... Relatively wide LOAs were observed for all parameters. Reliability measures in patient subgroups ICC(1,1) ranged between 0.55 and 0.81 for the frontal plane and 0.28 and 0.69 for the horizontal plane. Greater ICC(1,1) coefficients and smaller LOA were observed when patients were examined by the same examiner...

  11. 77 FR 62315 - Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195; Decision and Order (United States)


    ... that * * * as a pharmacist, she is not trained to diagnose, and it's up to the doctor to determine... pursuant to prescriptions, which raised red flags that a pharmacist could not resolve, and thus violated....; Revocation of Registration, 75 FR 78,745, 78,752-54 (2010). Pursuant to Agency practice, the decision...

  12. Integrated plant safety assessment: systematic evaluation program. Oyster Creek nuclear generating station. GPU Nuclear Corporation and Jersey Central Power and Light Company. Docket No. 50-219

    International Nuclear Information System (INIS)

    The Systematic Evaluation Program was initiated in February 1978 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the Oyster Creek Nuclear Generating Station (located in Ocean County, New Jersey), one of ten plants reviewed under Phase II of this program, and indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  13. SU-E-J-219: A Dixon Based Pseudo-CT Generation Method for MR-Only Radiotherapy Treatment Planning of the Pelvis and Head and Neck

    Energy Technology Data Exchange (ETDEWEB)

    Maspero, M.; Meijer, G.J.; Lagendijk, J.J.W.; Berg, C.A.T. van den [Department of Radiotherapy, UMC Utrecht (Netherlands); Seevinck, P.R.; Viergever, M.A. [Image Science Institute, UMC Utrecht (Netherlands)


    Purpose: To develop an image processing method for MRI-based generation of electron density maps, known as pseudo-CT (pCT), without usage of model- or atlas-based segmentation, and to evaluate the method in the pelvic and head-neck region against CT. Methods: CT and MRI scans were obtained from the pelvic region of four patients in supine position using a flat table top only for CT. Stratified CT maps were generated by classifying each voxel based on HU ranges into one of four classes: air, adipose tissue, soft tissue or bone.A hierarchical region-selective algorithm, based on automatic thresholding and clustering, was used to classify tissues from MR Dixon reconstructed fat, In-Phase (IP) and Opposed-Phase (OP) images. First, a body mask was obtained by thresholding the IP image. Subsequently, an automatic threshold on the Dixon fat image differentiated soft and adipose tissue. K-means clustering on IP and OP images resulted in a mask that, via a connected neighborhood analysis, allowing the user to select the components corresponding to bone structures.The pCT was estimated through assignment of bulk HU to the tissue classes. Bone-only Digital Reconstructed Radiographs (DRR) were generated as well. The pCT images were rigidly registered to the stratified CT to allow a volumetric and voxelwise comparison. Moreover, pCTs were also calculated within the head-neck region in two volunteers using the same pipeline. Results: The volumetric comparison resulted in differences <1% for each tissue class. A voxelwise comparison showed a good classification, ranging from 64% to 98%. The primary misclassified classes were adipose/soft tissue and bone/soft tissue. As the patients have been imaged on different table tops, part of the misclassification error can be explained by misregistration. Conclusion: The proposed approach does not rely on an anatomy model providing the flexibility to successfully generate the pCT in two different body sites. This research is founded by ZonMw IMDI Programme, project name: “RASOR sharp: MRI based radiotherapy planning using a single MRI sequence”, project number: 10-104003010.

  14. Safety Evaluation Report related to the full-term operating license for Oyster Creek Nuclear Generating Station (Docket No. 50-219)

    International Nuclear Information System (INIS)

    The Safety Evaluation Report for the full-term operating license application filed by GPU Nuclear Corporation and Jersey Central Power ampersand Light Company for the Oyster Creek Nuclear Generating Station has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located in Ocean County, New Jersey. The staff concludes that the facility can continue to be operated without endangering the health and safety of the public. 1 figs., 5 tabs

  15. Proceedings of US/Japan workshop, Q219 on high heat flux components and plasma surface interactions for next fusion devices

    International Nuclear Information System (INIS)

    This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage

  16. Investigations of the in Planta Expression of Active Cellobiohydrolase I: Cooperative Research and Development Final Report, CRADA Number CRD-07-219

    Energy Technology Data Exchange (ETDEWEB)

    Himmel, M.


    It was the purpose of this project to determine if cellulases produced in transgenic plants could effectively be utilized in the production of ethanol and other feedstock chemicals from lignocellulosic substrates.

  17. SU-E-J-219: Quantitative Evaluation of Motion Effects On Accuracy of Image-Guided Radiotherapy with Fiducial Markers Using CT Imaging

    International Nuclear Information System (INIS)

    Purpose: To investigate quantitatively patient motion effects on the localization accuracy of image-guided radiation with fiducial markers using axial CT (ACT), helical CT (HCT) and cone-beam CT (CBCT) using modeling and experimental phantom studies. Methods: Markers with different lengths (2.5 mm, 5 mm, 10 mm, and 20 mm) were inserted in a mobile thorax phantom which was imaged using ACT, HCT and CBCT. The phantom moved with sinusoidal motion with amplitudes ranging 0–20 mm and a frequency of 15 cycles-per-minute. Three parameters that include: apparent marker lengths, center position and distance between the centers of the markers were measured in the different CT images of the mobile phantom. A motion mathematical model was derived to predict the variations in the previous three parameters and their dependence on the motion in the different imaging modalities. Results: In CBCT, the measured marker lengths increased linearly with increase in motion amplitude. For example, the apparent length of the 10 mm marker was about 20 mm when phantom moved with amplitude of 5 mm. Although the markers have elongated, the center position and the distance between markers remained at the same position for different motion amplitudes in CBCT. These parameters were not affected by motion frequency and phase in CBCT. In HCT and ACT, the measured marker length, center and distance between markers varied irregularly with motion parameters. The apparent lengths of the markers varied with inverse of the phantom velocity which depends on motion frequency and phase. Similarly the center position and distance between markers varied inversely with phantom speed. Conclusion: Motion may lead to variations in maker length, center position and distance between markers using CT imaging. These effects should be considered in patient setup using image-guided radiation therapy based on fiducial markers matching using 2D-radiographs or volumetric CT imaging

  18. SU-E-J-219: A Dixon Based Pseudo-CT Generation Method for MR-Only Radiotherapy Treatment Planning of the Pelvis and Head and Neck

    International Nuclear Information System (INIS)

    Purpose: To develop an image processing method for MRI-based generation of electron density maps, known as pseudo-CT (pCT), without usage of model- or atlas-based segmentation, and to evaluate the method in the pelvic and head-neck region against CT. Methods: CT and MRI scans were obtained from the pelvic region of four patients in supine position using a flat table top only for CT. Stratified CT maps were generated by classifying each voxel based on HU ranges into one of four classes: air, adipose tissue, soft tissue or bone.A hierarchical region-selective algorithm, based on automatic thresholding and clustering, was used to classify tissues from MR Dixon reconstructed fat, In-Phase (IP) and Opposed-Phase (OP) images. First, a body mask was obtained by thresholding the IP image. Subsequently, an automatic threshold on the Dixon fat image differentiated soft and adipose tissue. K-means clustering on IP and OP images resulted in a mask that, via a connected neighborhood analysis, allowing the user to select the components corresponding to bone structures.The pCT was estimated through assignment of bulk HU to the tissue classes. Bone-only Digital Reconstructed Radiographs (DRR) were generated as well. The pCT images were rigidly registered to the stratified CT to allow a volumetric and voxelwise comparison. Moreover, pCTs were also calculated within the head-neck region in two volunteers using the same pipeline. Results: The volumetric comparison resulted in differences <1% for each tissue class. A voxelwise comparison showed a good classification, ranging from 64% to 98%. The primary misclassified classes were adipose/soft tissue and bone/soft tissue. As the patients have been imaged on different table tops, part of the misclassification error can be explained by misregistration. Conclusion: The proposed approach does not rely on an anatomy model providing the flexibility to successfully generate the pCT in two different body sites. This research is founded by ZonMw IMDI Programme, project name: “RASOR sharp: MRI based radiotherapy planning using a single MRI sequence”, project number: 10-104003010

  19. SU-E-J-219: Quantitative Evaluation of Motion Effects On Accuracy of Image-Guided Radiotherapy with Fiducial Markers Using CT Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Ali, I; Oyewale, S; Ahmad, S; Algan, O [University of Oklahoma Health Sciences, Oklahoma City, OK (United States); Alsbou, N [Department of Electrical and Computer Engineering, Ada, OH (United States)


    Purpose: To investigate quantitatively patient motion effects on the localization accuracy of image-guided radiation with fiducial markers using axial CT (ACT), helical CT (HCT) and cone-beam CT (CBCT) using modeling and experimental phantom studies. Methods: Markers with different lengths (2.5 mm, 5 mm, 10 mm, and 20 mm) were inserted in a mobile thorax phantom which was imaged using ACT, HCT and CBCT. The phantom moved with sinusoidal motion with amplitudes ranging 0–20 mm and a frequency of 15 cycles-per-minute. Three parameters that include: apparent marker lengths, center position and distance between the centers of the markers were measured in the different CT images of the mobile phantom. A motion mathematical model was derived to predict the variations in the previous three parameters and their dependence on the motion in the different imaging modalities. Results: In CBCT, the measured marker lengths increased linearly with increase in motion amplitude. For example, the apparent length of the 10 mm marker was about 20 mm when phantom moved with amplitude of 5 mm. Although the markers have elongated, the center position and the distance between markers remained at the same position for different motion amplitudes in CBCT. These parameters were not affected by motion frequency and phase in CBCT. In HCT and ACT, the measured marker length, center and distance between markers varied irregularly with motion parameters. The apparent lengths of the markers varied with inverse of the phantom velocity which depends on motion frequency and phase. Similarly the center position and distance between markers varied inversely with phantom speed. Conclusion: Motion may lead to variations in maker length, center position and distance between markers using CT imaging. These effects should be considered in patient setup using image-guided radiation therapy based on fiducial markers matching using 2D-radiographs or volumetric CT imaging.

  20. 中药贯序疗法治疗肝癌围肝动脉栓塞化疗期患者219例临床观察%Clinical Investigation on Chinese Herb Sequential Therapy for 219 Cases of Liver Cancer with Embolism of Peripheral Hepatic Artery at Chemotherapeutic Stage

    Institute of Scientific and Technical Information of China (English)

    苏小康; 周伟生; 徐发彬; 王芳军; 赵天清; 林宜胜; 温凤媚; 崔学教



  1. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.


    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  2. 75 FR 3221 - Ruby Pipeline, L.L.C.; Notice of Availability of the Final Environmental Impact Statement for the... (United States)


    ... 219, Section 219.35(b) (published in the Federal Register at 65 FR 67514 ; see also 36 CFR 219 Interpretive Rule published at 66 FR 1864 ) and found at . The objection procedures found at 36 CFR 219.32 (published in the Federal Register at 65...

  3. Petrographic atlas characterisation of aggregates regarding potential reactivity to alkalis : RILEM TC 219-ACS recommended guidance AAR-1.2, for use with the RILEM AAR-1.1 petrographic examination method

    CERN Document Server

    Ribeiro, Maria; Broekmans, Maarten; Sims, Ian


    This RILEM AAR 1.2 Atlas is complementary to the petrographic method described in RILEM AAR 1.1. It is designed and intended to assist in the identification of alkali-reactive rock types in concrete aggregate by thin-section petrography. Additional issues include: • optical thin-section petrography conforming to RILEM AAR 1.1 is considered the prime assessment method for aggregate materials, being effective regarding cost and time. Unequivocal identification of minerals in very-fine grained rock types may however require use of supplementary methods. • the atlas adheres to internationally adopted schemes for rock classification and nomenclature, as recommended in AAR 1.1. Thus, rock types are classified as igneous, sedimentary or metamorphic based upon mineral content, microstructure and texture/fabric. • in addition, the atlas identifies known alkali-reactive silica types in each rock type presented. It also identifies consistent coincidence between certain lithologies and silica types; however, it ref...

  4. RILEM recommendations for the prevention of damage by alkali-aggregate reactions in new concrete structures state-of-the-art report of the RILEM technical committee 219-ACS

    CERN Document Server

    Sims, Ian


    This book contains the full set of RILEM Recommendations which have been produced to enable engineers, specifiers and testing houses to design and produce concrete which will not suffer damage arising from alkali reactions in the concrete. There are five recommended test methods for aggregates (designated AAR-1 to AAR-5), and an overall recommendation which describes how these should be used to enable a comprehensive aggregate assessment (AAR-0). Additionally, there are two Recommended International Specifications for concrete (AAR-7.1 & 7.2) and a Preliminary International Specification for dams and other hydro structures (AAR-7.3), which describe how the aggregate assessment can be combined with other measures in the design of the concrete to produce a concrete with a minimised risk of developing damage from alkali-aggregate reactions.

  5. PENGARUH PENGGUNAAN GLIKOL PADA INSEKTISIDA AQUA-K-OTHRINE 20 EW® (b.a. Deltamethrin 21.9 g/l TERHADAP NYAMUK Aedes aegypti dan Culex quinquefasciatus DENGAN METODA PENGASAPAN(Thermal Fogging

    Directory of Open Access Journals (Sweden)

    Hasan Boesri


    Full Text Available ENGLISHK-OTHRINE 20 EW® insecticides were tested in 100 and 200 ml/ha with the application of fumigation using pure water as solvent and mixture of water and glycol. It was equally effective to kill Ae. aegypti mosquitoes indoor and outdoor with the mortality of 100%. Similarly, the insecticide effectively provides mortality of 90.0 – 94.8% to the Cx. quinquefasciatus mosquitoes, indoor and outdoor. The effect of fumigation of K-Othrine 20 EW® insecticide using either pure or mixed solvent of water (9.5 l water + 0.5 l glycol showed no difference to the mortality of mosquitoes, but glycol solution produce the fog, so the particle could be spread out to all directions.INDONESIAPengujian insektisida K-OTHRINE 20 EW® dosis 100 dan 200 ml/ha telah dilakukan dengan aplikasi pengasapan menggunakan pelarut air dan campuran air dengan glikol. Hasil menunjukkan keduanya sama-sama efektif membunuh nyamuk Aedes aegypti di dalam dan luar rumah (kematian 100%; terhadap Culex quinquefasciatus di dalam dan luar rumah efektif memberikan kematian 90.0 – 90.8%. Pengaruh aplikasi pengasapan insektisida K-Othrine 20 EW® baik menggunakan pelarut air maupun campuran (9.5 l air + 0.5 l glikol menunjukkan tidak berbeda terhadap kematian nyamuk uji, perbedaan pada larutan yang ditambah glikol dapat mengeluarkan kabut sehingga partikel yang dikeluarkan dapat tersebar ke semua arah.

  6. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT219-227 during 2010 (NODC Accession 0087988) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  7. Depaule Jean-Charles (avec la collaboration de Jean-Luc Arnaud, À travers le mur, Marseille, éditions Parenthèses, collection Eupalinos, 2014, 219 p.

    Directory of Open Access Journals (Sweden)

    Anna Madoeuf


    Full Text Available Saluons la réédition, aux éditions Parenthèses, dans la collection Eupalinos, d’À travers le mur, de Jean-Charles Depaule, ouvrage qui est tant une contribution rare et originale aux études urbaines, qu’un opus d’anthropologie sur l’espace habité, de même qu’une source de références multiples, notamment littéraires. « Rêver des lourdes portes, des passages en chicane et plus encore, peut-être des moucharabiehs perdus […] ». Cette sollicitation onirique et énigmatique, quatrième de couverture ...

  8. Application of solar energy to the supply of industrial process hot water: preliminary design and performance report. Volume I. Technical report. Aerotherm report TR-76-219. [For can washing at Campbell Soup Plant in Sacramento

    Energy Technology Data Exchange (ETDEWEB)



    The design and performance of a solar hot water system for can washing at the Campbell Soup Plant in Sacramento, California, are presented. The collector field is located on the roof of the finished products warehouse of the Campbell Soup Sacramento plant. Water is supplied from a 3.8 cm (1/sup 1///sub 2/ in.) supply line which is located directly below an existing roof access hatch. A supply pipe will be brought up through that hatch. The water flow will then be split into two manifold lines which supply the dual rows of flat plate collectors. The preheated water from the flat plates is then passed into six sets of parallel connected concentrators. Each set consist of eight 1.83 x 3.05 m (6 x 10 foot) modules connected in series. The water from these units is gathered in a 3.8 cm (1/sup 1///sub 2/ in.) insulated pipe which transports it to the storage tank. This pipe will be attached to an existing pipe run until it reaches the can washing building. From there the pipe will follow the can washing building around to the storage tank. The storage tank is a 75,200 1 (20,000 gal) steel tank which is coated internally with a USDA approved phenolic liner. The outside of the tank is insulated. A 2.2 kw (3 hp) motor is used to pump the stored water for the tank into the can washing line. Detail drawings and descriptions of the collector field, installation, piping, controls, data acquisition equipment, and roof structure are included. Furthermore, a program schedule with equipment and manpower costs for successfully completing Phase II of this contract is included. Also included is an organization chart of the Phase II program personnel. (WHK)

  9. New production in the South China Sea

    Institute of Scientific and Technical Information of China (English)

    CAI; Pinghe


    [1]Dugdale, R. C., Goering, J. J., Uptake of new and regenerated nitrogen in primary productivity, Limnology and Oceanog-raphy, 1967, 12: 196-206.[2]Eppley, R. W., Peterson, B. J., Particulate organic matter flux and planktonic new production in the deep ocean, Nature, 1979, 282: 677-680.[3]Allen, C. B., Kanda, J., Laws, E. A., New production and photosynthetic rates within and outside a cyclonic mesoscale eddy in the North Pacific Subtropical gyre, Deep-Sea Research Ⅱ, 1996, 43(6): 917-936.[4]Jenkins, W. J., Tritium-helium dating in the Sargasso Sea: A measurement of oxygen utilization rates, Nature, 1977, 196: 291-292.[5]Spitzer, W. S., Jenkins, W. J., Rates of vertical mixing, gas exchange and new production: Estimates from seasonal gas cy-cle in the upper ocean near Bermuda, Journal of Marine Research, 1989, 47: 169-196.[6]Sarmiento, J. L., Thiele, G., Key, R. M. et al., Oxygen and nitrate new production and remineralization in the North At-lantic Subtropical Gyre, Journal of Geophysical Research, 1990, 95: 18303-18315.[7]Ku, T. L., Luo, S., Kusakabe, M. et al., 228Ra-derived nutrient budgets in upper equatorial Pacific and the role of "new" silicate in limiting productivity, Deep-Sea Research II, 1995, 42(2/3): 479-497.[8]Wheeler, P. A., Rates of nitrate assimilation at the equator during the US-JGOFS spring time series: Estimates of new pro-duction, EOS, Transactions, American Geophysical Union, 1992, 73: 281.[9]Huang, Y., Xie, Y., Chen, M. et al., Distribution feature of 228Ra in surface seawater of the Nansha sea area, in Isotopes Marine Chemistry of Nansha Islands Waters (in Chinese), Beijing: Ocean Press, 1996, 70-78.[10]Reid, D. F., Key, R. M., Schink, D., Radium, thorium and actinium extraction from seawater using an improved manga-nese-oxide-coated fiber, Earth and Planetary Science Letters, 1979, 43: 223-226.[11]Shi, W., Qiu, X., Huang, Y., Distribution of dissolved 226Ra in the Jiulongjiang-Xiamen bay

  10. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  11. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    International Nuclear Information System (INIS)

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  12. Sorption studies of radioelements on geological materials


    Berry, J. A; 油井 三和; 北村 暁


    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  13. Purification of cerium, neodymium and gadolinium for low background experiments


    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  14. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  15. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)



    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  16. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura


    IKEDA, Nagao


    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  17. History of the unraveling of the natural decay series

    International Nuclear Information System (INIS)

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  18. History of the unraveling of the natural decay series

    International Nuclear Information System (INIS)

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  19. Grids of Agricultural Pesticide Use in the Conterminous United States, 1997 (United States)

    U.S. Geological Survey, Department of the Interior — This spatial dataset consists of 219 1-kilometer (km) resolution grids depicting estimated agricultural use of 219 pesticides in 1997 for the conterminous United...

  20. System for recovery of daughter isotopes from a source material (United States)

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID


    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  1. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)


    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot


    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or


    International Nuclear Information System (INIS)

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  4. AcEST: BP914632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ion tr|A2Q219|A2Q219_MEDTR Xanthine/uracil/vitamin C permease (Fragment) OS=Medicago truncatula...g significant alignments: (bits) Value tr|A2Q219|A2Q219_MEDTR Xanthine/uracil/vitamin... OS=Zea m... 35 2.8 >tr|A2Q219|A2Q219_MEDTR Xanthine/uracil/vitamin... 5.1 sp|P42345|FRAP_HUMAN FKBP12-rapamycin complex-associated protein... 30 5.1 s...lla paten... 44 0.006 tr|Q5N911|Q5N911_ORYSJ cDNA clone:J013164P20, full insert sequen... 40 0.087 tr|B8ACH2|B8ACH2_ORYSI Puta

  5. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France. (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M


    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data. PMID:25686474

  6. Decree of the State Office for Nuclear Safety No. 219/1997 of 22 August 1997 specifying details for emergency preparedness of nuclear facilities and workplaces handling ionizing radiation sources and specifying requirements for the contents of internal emergency plans and emergency rules

    International Nuclear Information System (INIS)

    The Decree addresses the following issues: definition of a radiological event and interventions to be accomplished if a radiological event takes place; emergency preparedness; establishing a radiological event; assessment of a radiological event; warnings, notifications and alarms during a radiological event; intervention - management, procedures, instructions; radiological situation monitoring programme; provisions to restrict human exposure; health care provisions; documentation; informing the State Office for Nuclear Safety; personnel instructions and training; emergency preparedness inspection; internal emergency plan; emergency rules; and related issues. (P.A.)

  7. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State


    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  8. The identification of soil radionuclides in the area of Puspiptek and surrounding

    International Nuclear Information System (INIS)

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  9. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  10. Mixed valency of the RE and Ac ions in solid states

    International Nuclear Information System (INIS)

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  11. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    International Nuclear Information System (INIS)

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  12. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.


    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  13. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller


    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  14. Purification of cerium, neodymium and gadolinium for low background experiments (United States)

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  15. Dicty_cDB: Contig-U06096-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||| Sbjct: 64 gaaatngatgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 123 Query: 124 ggnaatgttggngatgntacaacnccna...ctt 154 ||||||||||||||||||||||||||||||| Sbjct: 124 ggnaatgttggngatgntacaacnccnactt 154 Query: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 |||||||||||||||||||||||||||||||||||||||...||||||||||| Sbjct: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 >Contig-U11917-1 (Contig-U1191...atgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 147 Query: 124 ggnaatgttggngatgntacaacnccnacttnaaaanaa

  16. Drug: D01883 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01883 Drug Aniracetam (JAN/USAN/INN) C12H13NO3 219.0895 219.2365 D01883.gif Mental performance ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BX Other psychostimulants and no ...

  17. 75 FR 65439 - Defense Federal Acquisition Regulation Supplement; Electronic Subcontracting Reporting System (United States)


    ... contracts that meet the requirements of Section 211 of Public Law 95-507. (c) The Contractor shall-- (1..., rather than Standard Form 294--Subcontract Report for Individual Contracts, and Standard Form 295.... Section 219.708 is amended by revising paragraph (b)(1) to read as follows: 219.708 Contract clauses....

  18. EST Table: BY937615 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BY937615 E_FL_e100_02B06_F_0 10/09/28 88 %/219 aa gb|EEZ97711.1| Ras opposite [Trib... aa gnl|Amel|GB12540-PA 10/09/10 88 %/219 aa gi|270001264|gb|EEZ97711.1| Ras opposite [Tribolium castaneum] FS768412 e100 ...

  19. Improving quality of care among COPD outpatients in Denmark 2008-2011

    DEFF Research Database (Denmark)

    Tøttenborg, Sandra Søgaard; Lange, P.; Thomsen, R.W.; Nielsen, Henrik; Johnsen, S.P.; Frausing Hansen, E.


    % for all indicators. Compared to 2008, a higher proportion of COPD outpatients in 2011 received annual measurements of the forced expiratory volume in one second in percent of predicted (FEV1% predicted) (RR 2.14, 95% CI, 2.09; 2.19), assessment of BMI (RR 2.24, 95% CI, 2.19; 2.29), assessment of...

  20. Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3

    International Nuclear Information System (INIS)

    This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms

  1. Frekventni odziv turbulentnog osnosimetriчnog mlaza vazduha na modifikaцijy zvuчnim osцilaцijama iz spoљaшњeg izvora pobude

    Czech Academy of Sciences Publication Activity Database

    Cvetinović, D.; Čantrak, S.; Tihon, Jaroslav; Drahoš, Jiří

    205-219, 3-4 (2009), s. 205-219. ISBN 0350-218X Institutional research plan: CEZ:AV0Z40720504 Keywords : turbulent axisymmetric jet * acoustic oscillations modi fication * impinging jet heat transfer Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  2. 77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments (United States)


    ..., Contractor Code of Business Ethics and Conduct, is the DoD Office of Inspector General at the following...'' and adding ``datafax (571) 372-6094'' in its place. PART 203--IMPROPER BUSINESS PRACTICES AND PERSONAL.../ CPF'' and adding ``DPAP/CPIC'' in its place. PART 219--SMALL BUSINESS PROGRAMS 219.202-1 0 8....

  3. 26 CFR 1.806-3 - Certain changes in reserves and assets. (United States)


    ... assets were held, the numerator shall be the number of days during the taxable year which such reserves... the transfer. In computing the period held for purposes of the numerator, the day on which such... October 19, 1958, $70,000 ($64,000+$76,000=$140,000÷2) by the fraction 219/365 (the numerator of 219...

  4. Curing of the 2 mu DNA plasmid from Saccharomyces cerevisiae.


    Toh-e, A; Wickner, R B


    The 2 mu DNA plasmid is often eliminated from yeast cells when they are transformed with the 2 mu DNA-LEU2-pMB9 composite plasmid pJDB219. Since pJDB219 is subsequently lost with high frequency, derivatives lacking all 2 mu DNA can be prepared from any strain.

  5. Modélisation pluie-débit en région tropicale humide : application des réseaux de neurones sur quatre stations hydrométriques du Bandama Blanc (Bada, Marabadiassa, Tortiya et Bou situées au Nord de la Côte d'Ivoire. Thèse de l'Université de Cocody (Côte d'Ivoire, 2007, 219 p.

    Directory of Open Access Journals (Sweden)

    Yao Blaise Koffi


    Full Text Available La relation pluie-débit fait l'objet de nombreuses études, à cause de son importance dans la mise en œuvre de nombreux projets de développement. La communauté scientifique, dans le souci de faire face aux problèmes d'eau, tels que les inondations et les sècheresses, utilise différents modèles. Mais ces modèles sont généralement confrontés à la non-linéarité de la relation pluie-débit. Dans le cas du Bandama Blanc, objet de cette étude, cette non-linéarité est accentuée par la présence de plusieurs barrages à vocation agro-pastorale situés dans la partie nord de la zone d'étude et qui utilisent les eaux de ce fleuve. Ce mémoire de thèse traite donc de la modélisation des débits mensuels du Bandama Blanc, aux stations de Bada, Marabadiassa, Tortiya et Bou, à l'aide des réseaux de neurones, déjà éprouvés dans ce contexte de relation non-linéaire. Elle projette de fournir des outils plus robustes aux hydrologues africains pour la simulation et la prévision des débits des rivières jaugées. Pour atteindre cet objectif, deux Perceptrons Multicouches entraînés avec l'algorithme de la rétropropagation de l'erreur ont été construits. Le premier modèle a été utilisé seulement en simulation et le second en simulation et en prévision. Le modèle conceptuel GR2M, a été utilisé pour valider les résultats obtenus avec les réseaux de neurones. Pour cette étude, une importante base de données climatiques (pluie et température et hydrométriques (débits mensuels a été utilisée. Les résultats obtenus sont forts satisfaisants et nettement supérieurs à ceux obtenus avec le modèle conceptuel global GR2M. En effet, les réseaux de neurones parviennent à expliquer plus de 70 % de la variation des débits, avec des coefficients de corrélation de Pearson qui excèdent 0,80. Cependant ces modèles arrivent difficilement à simuler et à faire la prévision des débits extrêmes (étiages et crues, à cause probablement du nombre réduit de données à notre disposition et de la séparation des bases de calage et de validation.The rainfall-runoff relationship is the subject of many studies because of its importance in the implementation of many development projects. The scientific community, in order to cope with water problems such as floods and droughts, used different models. But these models are usually faced with the non-linearity of the rainfall-runoff relationship. In the case of the Bandama Blanc purpose of this study, this non-linearity is enhanced by the presence of several agro-pastoral dams located in the northern part of the study area and using the waters of this river. This thesis therefore deals with the modeling of flows of Bandama Blanc hydrometric stations (Bada Marabadiassa, Tortiya and Bou using neural networks already experienced in the context of non-linear relationship. It plans to provide more robust tools to African hydrologist in the simulation and forecasting of river flows. To achieve this goal, two Multilayer Perceptrons trained with the backpropagation algorithm of error have been built. The first model was used only in simulation and the second in simulation and prediction. The conceptual model GR2M was used to validate the results obtained with neural networks. An extensive database climate (rainfall and temperature and river monthly flow was used in this study. The results obtained are very satisfactory and well above those obtained with the overall conceptual model GR2M. Indeed, neural networks are able to explain more than 70% of the variation in rates, with Pearson correlation coefficients exceeding 0.80. However, these models have difficulty to simulate and predict extremes flow probably because of the reduced number of data at our disposal and separation of bases calibration and validation.

  6. Source identification in two criminal cases using phylogenetic analysis of HIV-1 DNA sequences. (United States)

    Scaduto, Diane I; Brown, Jeremy M; Haaland, Wade C; Zwickl, Derrick J; Hillis, David M; Metzker, Michael L


    Phylogenetic analysis has been widely used to test the a priori hypothesis of epidemiological clustering in suspected transmission chains of HIV-1. Among studies showing strong support for relatedness between HIV samples obtained from infected individuals, evidence for the direction of transmission between epidemiologically related pairs has been lacking. During transmission of HIV, a genetic bottleneck occurs, resulting in the paraphyly of source viruses with respect to those of the recipient. This paraphyly establishes the direction of transmission, from which the source can then be inferred. Here, we present methods and results from two criminal cases, State of Washington v Anthony Eugene Whitfield, case number 04-1-0617-5 (Superior Court of the State of Washington, Thurston County, 2004) and State of Texas v Philippe Padieu, case numbers 219-82276-07, 219-82277-07, 219-82278-07, 219-82279-07, 219-82280-07, and 219-82705-07 (219th Judicial District Court, Collin County, TX, 2009), which provided evidence that direction can be established from blinded case samples. The observed paraphyly from each case study led to the identification of an inferred source (i.e., index case), whose identity was revealed at trial to be that of the defendant. PMID:21078965

  7. Purification system of gram-amount neptunium using anion exchange chromatography

    International Nuclear Information System (INIS)

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  8. A francium-223 reservoir source

    International Nuclear Information System (INIS)

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  9. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  10. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    International Nuclear Information System (INIS)

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  11. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  12. Theoretical Study on Properties of New Isotope 265Bh

    Institute of Scientific and Technical Information of China (English)


    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  13. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  14. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)



    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  15. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    International Nuclear Information System (INIS)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  16. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    International Nuclear Information System (INIS)

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)

  17. Dicty_cDB: Contig-U14270-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||| Sbjct: 191 gttcaacacaatgcngntcngcaacatgctganccagntgccaagccagccgaattaacc 250 Query: 251 natgcccnagaattncaacaagaacaccna...||||||| Sbjct: 251 natgcccnagaattncaacaagaacaccnaagncaagnagctctcgcaaaacnncnngct 3...10 Query: 311 cgtattagncaacaaaatcntgtcaaacaagcngcccnanagaaacgaacctcgcnacgt 370 |||||||||||||||||||||||||||||...||||||||||||||||||||||||||||||| Sbjct: 311 cgtattagncaacaaaatcntgtcaaacaagcngcccnanagaaacgaacctcgcnacgt 370 ...ct: 219 cngctgctcngggggctgccaanccagttcaacacaatgcngntcngcaacatgctganc 160 Query: 225 cagntgccaagccagccgaattaaccnatgcccna

  18. 50 CFR Table 2d to Part 679 - Species Codes-Non-FMP Species (United States)


    ... 220 Pacific tomcod 250 Poacher (Family Agonidae) 219 Prowfish 215 Ratfish 714 Rockfish, black (GOA) 142 Rockfish, blue (GOA) 167 Rockfish, dark 173 Sardine, Pacific (pilchard) 170 Sea cucumber, red...

  19. Drug: D03362 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03362 Drug Trafermin (genetical recombination) (JAN); Trafermin (USAN/INN); Fiblast (TN) C764H1 ... 201N217O219S6 17111.7836 17122.4232 Stroke ... treatment; Fibroblast growth factor Therapeutic ca ...

  20. Oscillation and nonoscillation criteria for half-linear second order differential equations

    Czech Academy of Sciences Publication Activity Database

    Došlý, O.; Lomtatidze, Alexander


    Roč. 36, č. 2 (2006), s. 203-219. ISSN 0018-2079 Institutional research plan: CEZ:AV0Z10190503 Keywords : half-linear equation s * generalized Euler Equation * principal solution Subject RIV: BA - General Mathematics

  1. Comparison of the Chromosome Banding Pattern in the 2n = 5 6 Cytotypes of Nannospalax leucodon and N. xanthodon from Turkey

    Czech Academy of Sciences Publication Activity Database

    Arslan, A.; Arisoy, A.; Zima, Jan


    Roč. 2014, č. 121690 (2014), s. 121690. ISSN 1537-744X Institutional support: RVO:68081766 Keywords : mole rats * karyotype characteristics Subject RIV: EG - Zoology Impact factor: 1.219, year: 2013

  2. Doctoral Theses in Library and Information Science Completed in Indian Universities, 2001-2007 (United States)

    Mestri, D. D.


    Provides a complete listing and analysis of 219 doctoral theses submitted to the departments of library and information science (DLIS) in 45 Indian universities between January 2001 and December 2007. (Contains 10 tables.)

  3. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek


    Roč. 7, č. 2 (2015), s. 219-248. ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal taxes * unobservable human capital * income taxes Subject RIV: AH - Economics Impact factor: 3.780, year: 2014

  4. An exploratory study of the interaction of cognitive complexity, dogmatism, and repression-sensitization among college students (United States)

    Starbird, Dannel H.; Biller, Henry B.


    A total of 219 male and female college students returned questionnaire measures relating to cognitive complexity, dogmatism, and repression-sensitization. Analyses revealed very complex interactions among the variables. (Author/SB)

  5. Dicty_cDB: SLA529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1999. 2.19 Translated Amino Acid sequence ffffffffffl*lattakynkpkrt*isskillfs*avsltnsltapaslpaf*eiskdi gvve...quence (All Frames) Frame A: ffffffffffl*lattakynkpkrt*isskillfs*avsltnsltapaslpaf*eiskdi gvveervipkfadsftks

  6. Comeniana aus dem Nachlass von Dietrich Mahnke. Die Korrespondenz zwischen Dietrich Mahnke und Dmitrij Tschižewskij aus dem Jahre 1935. Beilage: die Korrespondenz

    Czech Academy of Sciences Publication Activity Database

    Schifferová, Věra

    18/42/, - (2004), s. 219-223. ISSN 0231-5955 Institutional research plan: CEZ:AV0Z9009908 Keywords : The interpretation of Comenius * the pupils of Edmund Husserl * rationalism and mysticism Subject RIV: AA - Philosophy ; Religion

  7. Viability of Basidiomycete Strains after Cryopreservation: Compatison of Ewo Different Freezing Protocols

    Czech Academy of Sciences Publication Activity Database

    Homolka, Ladislav; Lisá, Ludmila; Nerud, František


    Roč. 48, č. 2 (2003), s. 219-226. ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5020903 Keywords : basidiomycete strains * culture Subject RIV: EE - Microbiology, Virology Impact factor: 0.857, year: 2003

  8. Novel biophysical determination of miRNAs related to prostate and head and neck cancers

    Czech Academy of Sciences Publication Activity Database

    Hudcová, K.; Trnková, L.; Kejnovská, Iva; Vorlíčková, Michaela; Gumulec, J.; Kizek, R.; Masarik, M.


    Roč. 44, č. 3 (2015), s. 131-138. ISSN 0175-7571 Institutional support: RVO:68081707 Keywords : SQUAMOUS-CELL CARCINOMA * ELIMINATION VOLTAMMETRY * CYTOSINE SIGNALS Subject RIV: BO - Biophysics Impact factor: 2.219, year: 2014

  9. On Development of Medical Informatics Education via European Cooperation

    Czech Academy of Sciences Publication Activity Database

    Zvárová, Jana


    Roč. 50, - (1998), s. 219-223. ISSN 1386-5056 Keywords : information technologies * education * training * medical informatics * medical statistics * epidemiology Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.357, year: 1998

  10. Gene : CBRC-ACAR-01-0376 [SEVENS

    Lifescience Database Archive (English)


  11. U.S. Health Report Card Finds Racial, Ethnic Disparities Persist (United States)

    ... percent in 2014). Childhood obesity rates varied widely, too. Hispanics ages 2 to 19 had the highest rate of obesity (21.9 percent) between 2011 and 2014 while Asians had the lowest rate (8.6 percent). Hispanic ...

  12. An open-label study to assess the effect of a single dose of Nebivolol and Ivabradine on heart rate and pulse wave velocity in hypertensive patients receiving amlodipine

    Directory of Open Access Journals (Sweden)

    Rama Mohan Pathapati


    Conclusions: Nebivolol is an effective HR lowering agent compared to Ivabradine. However, significant decrease in arterial stiffness was observed with Ivabradine. [Int J Basic Clin Pharmacol 2015; 4(2.000: 219-223

  13. Alternative models of entrance exams and access to higher education: the case of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Konečný, Tomáš; Basl, J.; Mysliveček, Jan; Simonová, N.


    Roč. 63, č. 2 (2012), s. 219-235. ISSN 0018-1560 Institutional support: PRVOUK-P23 Keywords : higher education * admission exams * educational equity Subject RIV: AO - Sociology, Demography Impact factor: 0.937, year: 2012

  14. Evolutionary history of tree squirrels (Rodentia, Sciurini) based on multilocus phylogeny reconstruction

    Czech Academy of Sciences Publication Activity Database

    Pečnerová, P.; Martínková, Natália


    Roč. 41, č. 3 (2012), s. 211-219. ISSN 0300-3256 Institutional research plan: CEZ:AV0Z60930519 Keywords : phylogeny * Sciurus * biogeography * colonisation Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012

  15. 22 CFR 1203.735-216 - Miscellaneous statutory provisions. (United States)


    ... Government (18 U.S.C. 285). (15) The prohibition against political activities in subchapter III of chapter 73... (18 U.S.C. 219). (17) The prohibition against discrimination because of politics, race, religion,...

  16. Varianty Gellnerovy komedie Přístav manželství jako rozcestník jeho tvorby

    Czech Academy of Sciences Publication Activity Database

    Peisertová, Lucie


    Roč. 44, č. 2012 (2012), s. 201-219. ISSN 0231-5904 Institutional support: RVO:68378068 Keywords : Czech drama * Gellner, František * text ual criticism Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Microseismic monitoring in early Haynesville development

    Czech Academy of Sciences Publication Activity Database

    Duncan, P.M.; Barker, W.B.; Eisner, Leo; Smith, P.G.; Smith, K.; Williams-Stroud, S.

    Tulsa: AAPG, 2013 - (Hammes, U.; Gale, J.), s. 219-236. (AAPG Memoir. 105). ISBN 9780891813859 Institutional support: RVO:67985891 Keywords : microseismicity * shale gas * Haynesville Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  18. Medline Plus

    Full Text Available ... Flash Player for free at . The videos open in a second window. ... Angioplasty Stent Placement (Shawnee Mission Medical Center, Merriam, KS, 2/19/ ...

  19. Plant species richness-productivity relationships in a low-productive boreal region

    Czech Academy of Sciences Publication Activity Database

    Axmanová, I.; Chytrý, M.; Danihelka, Jiří; Lustyk, P.; Kočí, M.; Kubešová, S.; Horsák, M.; Cherosov, M. M.; Gogoleva, P. A.


    Roč. 214, č. 2 (2013), s. 207-219. ISSN 1385-0237 Institutional support: RVO:67985939 Keywords : competitive excluison * forest herb layer * grassland Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013

  20. Prevalence of gestational diabetes mellitus, its associated risk factors and pregnancy outcomes at a rural setup in Central India

    Directory of Open Access Journals (Sweden)

    Kanika R. Kalyani


    Conclusion: GDM adversely affects maternal and fetal outcomes and its prevalence is steadily rising. Appropriate interventions are required for its control. [Int J Reprod Contracept Obstet Gynecol 2014; 3(1.000: 219-224

  1. EST data: 5872 [RED

    Lifescience Database Archive (English)

    Full Text Available RA0286 D23831 AU164531 DPlate 061 H02 TCGTGCACGCCGACGCGGTC TTGGTGAGGAAGTTGGCCTC >AC002329_18(AC0 ... nucleotide-disulphide oxidoreductases located from residues ... 197 to 219 [CAVCD...IGGGD]. ...

  2. EST data: 5857 [RED

    Lifescience Database Archive (English)

    Full Text Available RA0132 D23778 DPlate 061 A01 GCCGACCTCATGGACCGCTG GGTTCCAGAATGCGTCGGAG >AC002329_18(AC002329|pid ... nucleotide-disulphide oxidoreductases located from residues ... 197 to 219 [CAVCD...IGGGD]. ...

  3. Drug: D09952 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ACE VTHQGLSSPV TKSFNRGEC (Disulfide bridge: 23-93; 139-199; H130-L219, Dimer) Peptide Treatment of's disease monoclonal antibody beta-amyloid CAS: 1178862-65-1 PubChem: 124490631 ...

  4. Explanatory Style of Secondary Vocational Educators. (United States)

    Hall, Helen C.; Smith, Bettye P.


    A study of the explanatory style of secondary vocational education in Georgia (n=219) indicated that most had an optimistic explanatory style. Business teachers were most likely and agriculture teachers least likely to use this style. (JOW)

  5. Red Pericarp Advanced Breeding Lines Derived from Oryza rufipogon × Oryza sativa: Physicochemical Properties, Total Antioxidant Activity, Phenolic Compounds and Vitamin E Content


    Parviz Fasahat; Aminah Abdullah; Kharidah Muhammad; Tilakavati Karupaiah; Wickneswari Ratnam


    Two new red pericarp transgressive variants (advanced breeding lines from BC2F7 generation) with high yield, derived from a cross between the wild relative, O. rufipogon Griff. and O. sativa subsp. indica cv. MR219, were analysed to determine their proximate composition, total antioxidant activity, phenolic acid composition and tocochromanol content in comparison with two commonly consumed rice varieties, MR219 (brown coloured) and Thailand rice (red coloured). The red pericarp variants were ...

  6. Longitudinal view of the psychological correlates and antecedents of subjectively assessed psychosomatic problems

    Czech Academy of Sciences Publication Activity Database

    Slezáčková, Alena; Blatný, Marek; Millová, Katarína; Jelínek, Martin


    Roč. 26, č. 2 (2011), s. 219-219. ISSN 0887-0446. [European Health Psychology Conference: Engaging with Other Health Professions: Challenges and Perspectives /25./. 20.09.2011-24.09.2011, Hersonissos, Kréta] R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : psychosomatic problems * middle adulthood * subjectively assessed health Subject RIV: AN - Psychology

  7. Domain Modeling: NP_872414.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_872414.2 chr12 Crystal structure of a human Notch1 ankyrin domain mutant p2qc9b_ chr12/NP_872414.2.../NP_872414.2_apo_18-219.pdb p2he0a_ chr12/NP_872414.2/NP_872414.2_holo_18-219.pdb psi-blast 305L,306D,307H,308L,309V,340K EDO 1 ...

  8. Drug: D05274 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05274 Drug Ornidazole (USAN/INN) C7H10ClN3O3 219.0411 219.6256 D05274.gif Anti-infective ATC co ... ICS, EXCL. COMBINATIONS WITH CORTICOSTEROIDS G01AF Imidazole ... derivatives G01AF06 Ornidazole D05274 Ornidazole ( ... S FOR SYSTEMIC USE J01X OTHER ANTIBACTERIALS J01XD Imidazole ... derivatives J01XD03 Ornidazole D05274 Ornidazole ( ...

  9. Isolation and characterization of a novel endoglucanase from a Bursaphelenchus xylophilus metagenomic library.

    Directory of Open Access Journals (Sweden)

    Lin Zhang

    Full Text Available A novel gene (designated as cen219 encoding endoglucanase was isolated from a Bursaphelenchus xylophilus metagenomic library by functional screening. Sequence analysis revealed that cen219 encoded a protein of 367 amino acids. SDS-PAGE analysis of purified endoglucanase suggested that Cen219 was a monomeric enzyme with a molecular mass of 40 kDa. The optimum temperature and pH for endoglucanase activity of Cen219 was separately 50 °C and 6.0. It was stable from 30 to 50 °C, and from pH 4.0 to 7.0. The activity was significantly enhanced by Mn(2+ and dramatically reduced by detergent SDS and metals Fe(3+, Cu(2+ or Hg(2+. The enzyme hydrolyzed a wide range of β-1, 3-, and β-1, 4-linked polysaccharides, with varying activities. Activities towards microcrystalline cellulose and filter paper were relatively high, while the highest activity was towards oat gum. The Km and Vmax of Cen219 towards CMC was 17.37 mg/ml and 333.33 U/mg, respectively. The findings have an insight into understanding the molecular basis of host-parasite interactions in B. xylophilus species. The properties also make Cen219 an interesting enzyme for biotechnological application.

  10. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  11. AcEST: BP917738 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G10 219 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G10. BP9177...38 CL2559Contig1 Show BP917738 Clone id YMU001_000104_G10 Library YMU01 Length 219 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_G10. Accession BP917738 Tissue type prothallium Developmental stag...s Res. 25:3389-3402. Query= BP917738|Adiantum capillus-veneris mRNA, clone: YMU001_000104_G10. (219 letters)... Res. 25:3389-3402. Query= BP917738|Adiantum capillus-veneris mRNA, clone: YMU001

  12. Elsevier收录材料科学类期刊可开放获取情况的调查与分析

    Institute of Scientific and Technical Information of China (English)

    何燕; 瞿其春; 张雪娟




    International Nuclear Information System (INIS)

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and


    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.


    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  15. Red Pericarp Advanced Breeding Lines Derived from Oryza rufipogon × Oryza sativa: Physicochemical Properties, Total Antioxidant Activity, Phenolic Compounds and Vitamin E Content

    Directory of Open Access Journals (Sweden)

    Parviz Fasahat


    Full Text Available Two new red pericarp transgressive variants (advanced breeding lines from BC2F7 generation with high yield, derived from a cross between the wild relative, O. rufipogon Griff. and O. sativa subsp. indica cv. MR219, were analysed to determine their proximate composition, total antioxidant activity, phenolic acid composition and tocochromanol content in comparison with two commonly consumed rice varieties, MR219 (brown coloured and Thailand rice (red coloured. The red pericarp variants were not significantly different in grain quality related traits. For fat content, neither variant showed any significant difference to the recurrent parent MR219, however for amylose content they possessed lower levels compared to MR219 but for both traits results were comparable to Thailand red rice. Variants G33 and G37 produced significantly (p<0.05 higher total phenolic content (0.49 and 0.51 mgGAE/g, respectively than the white control sample, MR219 (0.32 mgGAE/g but lower than Thailand red rice (1.59 mgGAE/g (p<0.05. Ferric-Reducing Ability Power (FRAP was significantly (p<0.01 higher in both variants compared to MR219 but lower than in Thailand red rice. For DPPH0 radical scavenging, both variants were not significantly different from both controls. Caffeic and ferulic acid detected in all samples were in higher amounts compared to the other compounds and hydroxycinnamic acids were considered as the main phenolic acids. Across all samples, the content of total E vitamin was higher in G37 and (-tocotrienol, which was the most abundant tocol. In conclusion both red pericarp variants can be used in cultivar development program for red rice with high nutritional value.

  16. A Study of Selected Isozymes in Capsicum baccatum, Capsicum eximium, Capsicum cardenasii and Two Interspecific F1 Hybrids in Capsicum Species


    Ahmet Naci ONUS


    Selected isozymes were investigated in plants of Capsicum baccatum L. ( Solanaceae) accessions SA219 (P.G.Smith), Hawkes 6489 (P.G.Smith), Capsicum cardenasii Heiser and Smith accession SA268 (P.G.Smith), Capsicum eximium A.T.Hunz accession Hawkes 3860 (J.G.Hawkes) and two interspecific F1 hybrids, C. baccatum SA219 x C. eximium Hawkes 3860 and C. baccatum Hawkes 6489 x C. cardenasii SA 268. The standard technique of horizontal gel electrophoresis was employed. The gel was cut into severa...

  17. Fifth international symposium on the natural radiation environment (NRE - V). Book of abstracts

    International Nuclear Information System (INIS)

    Most of the 219 contributions Are on radon (to a much lesser extent: thoron) and its daughter products in dwellings and in the environment; on corresponding measuring instruments and - methods; on measurements done; and on radiation doses to professional workers and to the public. The section heading give a fairly good account of the subject matters treated. Measurement Techniques and Metrology (Nrs 1-33); Exposure to Natural Radiation in Non-Domestic Environments (34-56); Natural Radionuclides and Transfer Pathways (57-107); Radioactivity and Radiation in the Human Environment (108-183); Health Effects of Natural Radiation (184-205); Industrially Modified Levels of Radiation Exposure (206-219). (Quittner)

  18. AcEST: BP920795 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_F12 508 Adiantum capillus-veneris mRNA. clone: YMU001_000141_F12. BP920795 - Show ... 88 (47%), Gaps = 10/88 (11%) Frame = +3 Query: 264 DIY YTNVSRQTGNTSMPA-------YEASLGRATSTNYPLVNFLLSADADFVIG ... ALGS-- 416 DIY + R+ GN A Y + T Y L N+ +ADA+ VI A+GS Sbjct: 223 DIY ... itives = 23/46 (50%) Frame = +3 Query: 240 SKAYSRWWDIY YTNVSRQTGNTSMPAYEASLGRATSTNYPLVNFLL 377 S SRW + N T ... HYSVLYFSEGYISDIRGNTF 219 Query: 219 MQEVIEESKAYSRWWDIY YTNVSRQTGNTSMPAYEASLGRATSTNYPLVNFLLSADADFV 398 + +V ...

  19. Variables sociodemográficas y estilos de vida como predictores de la autovaloración de la salud de los inmigrantes en el País Vasco Sociodemographic variables and lifestyle as predictors of self-perceived health in immigrants in the Basque Country (Spain)


    Elena Rodríguez Álvarez; Nerea Lanborena Elordui; Meftaha Senhaji; Celina Pereda Riguera


    Objetivo: Investigar la importancia de los factores sociodemográficos y de los estilos de vida en la autovaloración de la salud en los inmigrantes de origen magrebí, subsahariano, latinoamericano y europeo no comunitario del País Vasco. Métodos: Estudio descriptivo transversal con una muestra formada por 219 magrebíes (31,8%), 152 subsaharianos (22,1%), 167 latinoamericanos (24,2%) y 151 europeos no comunitarios (21,9%). La herramienta para la recopilación de datos fue la Encuesta de Salud de...

  20. Self-Limited versus Delayed Resolution of Acute Inflammation: Temporal Regulation of Pro-Resolving Mediators and MicroRNA


    Gabrielle Fredman; Yongsheng Li; Jesmond Dalli; Nan Chiang; Serhan, Charles N.


    Mechanisms underlying delays in resolution programs of inflammation are of interest for many diseases. Here, we addressed delayed resolution of inflammation and identified specific microRNA (miR)-metabolipidomic signatures. Delayed resolution initiated by high-dose challenges decreased miR-219-5p expression along with increased leukotriene B4 (5-fold) and decreased (~3-fold) specialized pro-resolving mediators, e.g. protectin D1. Resolvin (Rv)E1 and RvD1 (1 nM) reduced miR-219-5p in human mac...

  1. AcEST: DK961289 [AcEST

    Lifescience Database Archive (English)


  2. AcEST: DK947792 [AcEST

    Lifescience Database Archive (English)


  3. Několik poznámek k problematice ochrany duševního vlastnictví

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich


    Roč. 5, č. 2 (2011), s. 217-219. ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography

  4. The local heat treatment technology for not easily accessible welded joints of sodium-conducting pipes in nuclear power stations

    International Nuclear Information System (INIS)

    Experimental works results in local heat treatment of not easily accessible welded joints for the nuclear power stations sodium-conducting pipes using flexible wired resistance heaters are described. Vertical welded joints 820x13, 630x13, 219x10 and 245x11 were studied. It was found out that for the tubes welded joints 219x10 and 245x11mm the normal process of austenization without reflectors inside the welded joint is achieved under heating by means of one electric heater. It was suggested that the electric heater capacity should be increased for tubes welded joints 820x13 and 630x13 mm

  5. Unfolding transitions in myosin give rise to the double-hyperbolic force-velocity relation in muscle

    DEFF Research Database (Denmark)

    Nielsen, Bjørn Gilbert


    This work presents an extension to a recent model of muscle contraction that was based on entropic elasticity (Nielsen 2002 J. Theor Biol. 219 99-119). By using entropic elasticity as the origin of muscle force, various possibilities emerge that can account for the presence of the double-hyperbol......This work presents an extension to a recent model of muscle contraction that was based on entropic elasticity (Nielsen 2002 J. Theor Biol. 219 99-119). By using entropic elasticity as the origin of muscle force, various possibilities emerge that can account for the presence of the double...

  6. UREDNIČKI OPOZIV RADA: Fleksibilni Fourierov stacionarni test BDP-a po stanovniku za Srednjoistočne europske zemlje


    Chang, Hsu-Ling; Su, Chi-Wei; Zhu, Meng-Nan


    Statement of Retraction (Zb. rad. Ekon. fak. Rij. • 2012 • vol. 30 • sv. 2 • 219-219, Želimo obavijestiti poštovane čitatelje da je Urednički odbor časopisa Zbornik radova Ekonomskog fakulteta u Rijeci, časopis za ekonomsku teoriju i praksu/ Proceedings of Rijeka Faculty of Economics, Journal of Economics and Business povukao sljedeći članak iz publikacije: “Flexible Fourier Stationary Test in GDP per capita for Cent...

  7. Monolithic Hybrid and Passive Mode-Locked 40GHz Quantum Dot Laser Diodes

    DEFF Research Database (Denmark)

    Thompson, M. G.; Larsson, David; Rae, A. R.;


    For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs.......For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs....

  8. Resposta de plantas micropropagadas de abacaxizeiro à inoculação de bactérias diazotróficas em casa de vegetação Response of pineapple plantlets to inoculation with diazotrophic bacteria in greenhouse

    Directory of Open Access Journals (Sweden)

    Olmar Baller Weber


    Full Text Available O objetivo deste trabalho foi selecionar e avaliar bactérias diazotróficas isoladas de abacaxizeiro (Ananas comosus (L. Merril no desenvolvimento de cultivares micropropagadas da mesma espécie em casa de vegetação. Plantas da cultivar Perolera foram submetidas à inoculação com Asaia bogorensis (AB219 e cultivadas em tubetes, durante 145 dias, com as misturas: casca de arroz carbonizada, folha de carnaubeira triturada e vermicomposto; casca de arroz carbonizada, pó da casca do coco maduro e vermicomposto; casca de arroz carbonizada, vermiculita e vermicomposto. Plantas da cultivar Primavera receberam inóculos com o AB219 e bactérias relacionadas a Burkholderia cepacia (AB202 e AB213, enquanto plantas das cultivares Pérola e Smooth Cayenne receberam AB219 e AB213, sendo cultivadas, por 140 dias, em tubetes com a mistura de vermicomposto e vermiculita. A colonização dos abacaxizeiros pelas bactérias diazotróficas foi confirmada. As plantas da cultivar Perolera cresceram melhor em casca de arroz carbonizada, vermiculita e vermicomposto e responderam positivamente ao AB219. Já as plantas da cultivar Primavera não apresentaram resposta significativa à inoculação com AB219, AB202 e AB213. Houve incremento de 23,1% a 38,5% na matéria seca de raízes das plantas da cultivar Pérola na presença de AB213 e AB219, respectivamente. A presença de AB213 incrementou em 15,2% a matéria seca da parte aérea das plantas da cultivar Smooth Cayenne. Os resultados revelam a eficiência de bactérias diazotróficas na promoção do crescimento de abacaxizeiros.The objective of this work was to select and to evaluate isolates of diazotrophic bacteria associated to pineapple (Ananas comosus (L. Merril plants in the development of micropropagated plantlets of cultivars pineapple in greenhouse. Plantlets from the Perolera cultivar have been submitted to inoculation with Asaia bogorensis (AB219 and were cultivated during 145 days on the following


    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  10. Formerly utilized MED/AEC sites remedial action program. Radiological survey of the E. I. Du Pont de Nemours and Co. , Deepwater, New Jersey. Final report

    Energy Technology Data Exchange (ETDEWEB)



    The results of a radiological survey of the E. I. Du Pont Company, Deepwater, New Jersey, are presented in this report. During the 1940's this site was used for development of a process for the conversion of uranium oxide to produce uranium tetrafluoride and small quantities of uranium metal. The survey included measurements of the following: residual alpha and beta--gamma contamination levels, both fixed and transferable, in the one remaining uranium tetrafluoride operations building; external gamma radiation levels at 1 m above the surface inside this building and at outdoor locations where radioactive materials were handled; radon and radon daughter concentrations in the air in the operations building; uranium, radium, actinium, and thorium concentrations in soil and water on and near the site; and the airborne concentrations of uranium, thorium, and radium in the operations building. Elevated concentrations of uranium were found in residues from the operations building and in some surface and subsurface soil samples. Alpha and beta--gamma contamination levels in some areas of the operations building were above the limits of current federal guidelines set for the release of property for unrestricted use. 18 figures, 11 tables.

  11. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    International Nuclear Information System (INIS)

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  12. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO{sub 2} and TBP Complex

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)


    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO{sub 3} Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO{sub 3} Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO{sub 3} Complex.

  13. Tumor immunotargeting using innovative radionuclides. (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques


    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  14. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré


    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  15. Purification of lanthanides for double beta decay experiments (United States)

    Polischuk, O. G.; Barabash, A. S.; Belli, P.; Bernabei, R.; Boiko, R. S.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Tretyak, V. I.


    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain 238U, 226Ra and 232,228Th typically on the level of ˜ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO2, Nd2O3 and Gd2O3. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R&D of the methods to remove the pollutions with improved efficiency is in progress.

  16. Radionuclides in coastal swampland soils in South Australia - An unusual distribution?

    International Nuclear Information System (INIS)

    A plant processing uranium ore was constructed during the 1950's on coastal swamplands at Port Pirie, South Australia, with tailings and chemical residues stored in clay-lined dams on site. Environmental soil samples collected recently from this area showed an unusual radionuclide distribution which suggested possible contamination from the former uranium plant nearby. On subsequent investigation it appears this distribution is a general property of swampland soils. The concentration of uranium in these soils is significantly greater (2-10 times) than that of its decay products, with an observed range of uranium concentrations from 50 to 300 Bq/kg. In contrast, 'normal' soils in South Australia contain between 5 and 60 Bq/kg, with decay products close to secular equilibrium. In addition, actinium (and its parent, protactinium) occur in sediments in greater concentration than expected - 6 to 36 Bq/kg compared with a 'normal soil' range of 0.2 to 3 Bq/kg. Results obtained suggest: organic residues in the sediments play a major part in the concentration of radionuclides; and the probable source of radionuclides is sea-water. These observations are consistent with results of other workers who examined the incorporation of stable trace metals into coastal swampland sediments in South Australia. Representative data are presented and discussed

  17. Study of Thorium Utilization in a Large Scale Sodium Cooled Fast Reactor

    International Nuclear Information System (INIS)

    The breeding performance of 232Th in fast reactor is better than 238U, since the capture cross section of 232Th is slightly higher than 238U under the fast neutron spectrum. There are much less fission neutrons in the blanket, so the proportion of neutron with energy above 6MeV (the threshold energy of (n,2n) reaction of 232Th) is very small. Therefore, the 233U produced in fast reactor blanket would have high purity. In this paper, an large scale fast reactor core was taken as the reference core for 232Th utilization study. In the calculation results, the whole capability of 233U production is about 443kg/(GWe•a) in the blanket; at the end of the first cycle (160EFPD), the 233U production per unit mass of 232Th is about 10.71g/(kgTh), and the weight fraction of 232U in actinium is less than 0.019%. It is an attractive technology option to produce 233U in the blanket. (author)

  18. A Critical Review of Alpha Radionuclide Therapy-How to Deal with Recoiling Daughters? (United States)

    de Kruijff, Robin M; Wolterbeek, Hubert T; Denkova, Antonia G


    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  19. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters? (United States)

    de Kruijff, Robin M.; Wolterbeek, Hubert T.; Denkova, Antonia G.


    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  20. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    Directory of Open Access Journals (Sweden)

    Robin M. de Kruijff


    Full Text Available This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET. Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium, 223Ra, and 225Ac (actinium can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue.

  1. Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

    International Nuclear Information System (INIS)

    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y-1. From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g-1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y-1 ranging from 2.79 to 14.17 mSv y-1. (authors)

  2. Emanations and 'induced' radioactivity: from mystery to (mis)use

    International Nuclear Information System (INIS)

    The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD (210Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

  3. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.


    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  4. Development of an Ultra-Low Background Liquid Scintillation Counter for Trace Level Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Erchinger, Jennifer L.; Orrell, John L.; Aalseth, Craig E.; Bernacki, Bruce E.; Douglas, Matthew; Finn, Erin C.; Fuller, Erin S.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Panisko, Mark E.; Shaff, Sarah M.; Warren, Glen A.; Wright, Michael E.


    Low-level liquid scintillation counting (LSC) has been established as one of the radiation detection techniques useful in elucidating environmental processes and environmental monitoring around nuclear facilities. The Ultra-Low Background Liquid Scintillation Counter (ULB-LSC) under construction in the Shallow Underground Laboratory at Pacific Northwest National Laboratory aims to further reduce the MDAs and/or required sample processing. Through layers of passive shielding in conjunction with an active veto and 30 meters water equivalent overburden, the background reduction is expected to be 10 to 100 times below typical analytic low-background liquid scintillation systems. Simulations have shown an expected background of around 14 counts per day. A novel approach to the light collection will use a coated hollow light guide cut into the inner copper shielding. Demonstration LSC measurements will show low-energy detection, spectral deconvolution, and alpha/beta discrimination capabilities, from trials with standards of tritium, strontium-90, and actinium-227, respectively. An overview of the system design and expected demonstration measurements will emphasize the potential applications of the ULB-LSC in environmental monitoring for treaty verification, reach-back sample analysis, and facility inspections.

  5. Enhanced radioactivity due to natural oil and gas production and related radiological problems

    International Nuclear Information System (INIS)

    Within the scope of a research contract, the following aspects are considered: External radiation exposure at production sites; internal radiation exposures during cleaning operations such as removing of scale by sand blasting; problems of waste disposal; internal radiation exposure due to radon inhalation by consumers; the origin of the high radium content of brines from oil and gas fields. Enhanced dose rates up to 50 μSv/h have been found at the external surface of saltwater tanks, but 72% of the 160 sites investigated did not show any increase above the natural background. Brines from gas contained radium-226 up to 286 Bq/1 and scale up to 1 kBq/g. In brines and scale from oil fields radium-228 was usually the dominating radionuclide. Some samples contained significant amounts of lead-210 and even actinium-227, too, but practically no uranium or thorium. The radon-222 concentrations in natural gas samples varied between 0.004 and 4 Bq/l with an average value of 0.6 Bq/l. Related radiological problems are discussed. (orig./HP)

  6. Neutron measurements with miniature fission chambers

    International Nuclear Information System (INIS)

    This report analyses the use and qualification of miniature fission chambers for two types of neutron measurements: 1) relative measurements in nuclear power reactors, or nuclear irradiation reactors. We consider the problem of burnable fissile material in detectors, under important neutron exposures and conclude on recommending the use of regenerating neutron detectors. 2) Measurements of integral physical parameters in experimental reactors. This method has been applied to measurements of fission rates in detectors with strong alpha-rays emitter deposits in order to establish standard tables of physical parameters. It has been used in particular for detectors including very radioactive actinium series. After a discussion of the instrumentation choice and data processing, specific to each measurements, we provide results on: 1) the technological and neutron behaviour of regenerating miniature fission chambers, in the swimming pool reactor 'TRITON', under a neutron exposure of 7.1020 n cm-2 and a gamma-rays exposure of 1,5.1011 rads about. The fissile material is 235U and the fertile material 234U. 2) The integral measurements of effective cross sections for 241Am and 238Pu in the experimental reactor 'MINERVE' use for study of problems of fast neutron reactors

  7. Quantification of radionuclide transfer in terrestrial and freshwater environments: A summary

    International Nuclear Information System (INIS)

    Exposure may occur as a result of incidental releases and discharges from all stages of the nuclear fuel cycle. This includes uranium mines, fuel fabrication facilities, reactors, reprocessing plants and low, intermediate and high level radioactive waste repository sites. Each of these releases involves mainly fission and neutron activation products as well as actinides. Uranium mining and fuel fabrication also involve radionuclides of the uranium, actinium and thorium decay series. In addition, some industries such as mineral sands production and processing, phosphate ore processing, coal burning and oil and gas production can generate naturally occurring radioactive materials (NORMs) as waste. Other sources of human exposure include nuclear weapon testing and radiation accidents or incidents. Any radiological assessments are based on an analysis of radionuclide transport patterns and processes governing radionuclide behaviour in the environment. Therefore, it is an aim of the IAEA to support Member States to enhance their capability for evaluating radionuclide transport, geochemical and biochemical enrichment, and radiation effects on human beings and other biota

  8. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    International Nuclear Information System (INIS)

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

  9. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

    International Nuclear Information System (INIS)

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO3 Complex

  10. Exposure to radioactive aerosols in mining and milling operations: the importance of 227Ac and 231Pa

    International Nuclear Information System (INIS)

    'Full-Text:' 227Ac (half-life of 21.8 y) is the daughter or 231Pa; a beta emitter and parent of a subseries with five short-lived alpha-emitters. 231Pa (half-life of 3.27x104 y) is an alpha-emitter of the actinium series, the decay chain of 235U. As daughters of this uranium isotope they are thought to be unimportant as a radiological hazard, despite the fact that their ALI values for ingestion and inhalation are the lowest of any other radionuclide. Both nuclides can be considered as being in secular equilibrium with uranium in most geological media and so the mass concentration of 231Pa is the same of the 226Ra and that of 227Ac is the same of the 210Pa, to mention only two radionuclides of radiological concern. It is shown in this paper that if 231Pa and 227Ac are considered in the evaluations of dose commitments incurred by inhalation of aerosols in mining and milling operations, the results can be 70% higher than those calculated by the methodology of ICRP Publication 47. (author)

  11. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin

    International Nuclear Information System (INIS)

    The objective of this work was to establish a new procedure for 228Ra determination of natural waters via preconcentration of radium on MnO2 and separation of its daughter, 228Ac, using Diphonix ion exchange resin. Following removal of potential interferences via passage through an initial Diphonix Resin column, the first daughter of 228Ra, 228Ac, is isolated by chromatographic separation via a second Diphonix column. A holding time of >30 h for 228Ac ingrowth in between the two column separations ensures secular equilibrium. Barium-133 is used as a yield tracer. Actinium-228 is eluted from the second Diphonix Resin with 5 ml 1 M 1-Hydroxyethane-1,1-diphosphonic acid (HEDPA) and quantified by addition of scintillation cocktail and LSC counting. Radium (and 133Ba) from the load and rinse solutions from the 2nd Diphonix column may be prepared for alpha spectrometry (for determination of 223Ra, 224Ra, and 226Ra) by BaSO4 microprecipitation and filtration. Decontamination tests indicate that U, Th, and Ra series nuclides do not interfere with these measurements, although high contents of 90Sr (90Y) require additional treatment for accurate measurement of 228Ra. Addition of stable Sr as a 'hold back' carrier during the initial MnO2 preconcentration step was shown to remove most 90Sr interference

  12. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    International Nuclear Information System (INIS)

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  13. Theoretical Study on Properties of New Isotope 265Bh

    International Nuclear Information System (INIS)

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blocked BCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265Bh is studied and some new magic numbers are found, while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The α-decay lifetimes in the 265Bh decay chain are evaluated by different formulae, and compared with experimental data. The methods which give good agreement with the data are selected.

  14. Workplace monitoring and related health hazard evaluation in South African mining and mineral processing industries by application of nuclear and related analytical techniques

    International Nuclear Information System (INIS)

    The South African Government notice R 849 (23 April 1994) requires application to the South African Council for Nuclear Safety (CNS) for a nuclear licence if materials are dealt with that contain more than 0,2 but less than 1 Becquerel per gram of any radionuclide of the natural uranium, thorium and actinium decay series. If the material is to be used in the construction of buildings the application should have been made before 1 April 1996, otherwise before 31 March 1999. The first phase of the monitoring programme assesses the observed radioactivity levels of waste products and the possible radiological impact on people working on site and living in the direct environment of the operational site. Information has been obtained on the radionuclide content and elemental composition of the various sources of the coal, waste ash, ash related products, crusher materials and effluent water. Except for the effluent and coal samples all other materials showed activity levels for one or more nuclides above the 0,2 Bq/g but not exceeding the 1 Bq/g level. Accordingly a first order assessment of the possible radiological impact on workers and the public has been performed for water consumption and dust inhalation. Actual dust concentrations recorded at various sites within the operational area are used to evaluate the yearly dose to workers. (author)

  15. Purification of lanthanides for double beta decay experiments

    Energy Technology Data Exchange (ETDEWEB)

    Polischuk, O. G. [Institute for Nuclear Research, MSP 03680 Kyiv, Ukraine and INFN, Section of Rome, La Sapienza, I-00185 Rome (Italy); Barabash, A. S. [Institute of Theoretical and Experimental Physics, 117259 Moscow (Russian Federation); Belli, P. [INFN, Section of Rome Tor Vergata, I-00133 Rome (Italy); Bernabei, R. [INFN, Section of Rome Tor Vergata, I-00133 Rome, Italy and Department of Physics, University of Rome Tor Vergata, I-00133 Rome (Italy); Boiko, R. S.; Danevich, F. A.; Mokina, V. M.; Poda, D. V.; Tretyak, V. I. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Cappella, F.; Incicchitti, A. [INFN, Section of Rome La Sapienza, I-00185 Rome, Italy and Department of Physics, University of Rome La Sapienza, I-00185 Rome (Italy); Cerulli, R.; Laubenstein, M.; Nisi, S. [INFN, Gran Sasso National Laboratories, I-67100 Assergi (Aq) (Italy)


    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain {sup 238}U, {sup 226}Ra and {sup 232,228}Th typically on the level of ∼ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO{sub 2}, Nd{sub 2}O{sub 3} and Gd{sub 2}O{sub 3}. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R and D of the methods to remove the pollutions with improved efficiency is in progress.

  16. Kategorie výzdobného stylu na lineární keramice z Bylan

    Czech Academy of Sciences Publication Activity Database

    Květina, Petr; Končelová, Markéta


    Roč. 63, č. 2 (2011), s. 195-219. ISSN 0323-1267 R&D Projects: GA ČR(CZ) GAP405/11/1590 Institutional research plan: CEZ:AV0Z80020508 Keywords : Early Neolithic * style of pottery decoration * Bylany Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. 2D hydrodynamic simulations of super star cluster winds in a bimodal regime

    Czech Academy of Sciences Publication Activity Database

    Wünsch, Richard; Palouš, Jan; Tenorio-Tagle, G.; Silich, S.


    Roč. 324, 2-4 (2009), s. 219-223. ISSN 0004-640X R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : stellar wind s * star cluster s * dynamics of ISM Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.404, year: 2009

  18. A simulation analysis of an extension of one-dimensional speckle correlation method for detection of general in-plane translation

    Czech Academy of Sciences Publication Activity Database

    Hamarová, Ivana; Šmíd, Petr; Horváth, P.; Hrabovský, M.


    Roč. 2014, č. 1 (2014), "704368-1"-"704368-12". ISSN 1537-744X R&D Projects: GA ČR GA13-12301S Institutional support: RVO:68378271 Keywords : one -dimensional speckle correlation * speckle * general In-plane translation Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.219, year: 2013

  19. Biodegradation of spilled diesel fuel in agricultural soil: Effect of humates, zeolite, and bioaugmentation

    Czech Academy of Sciences Publication Activity Database

    Kuráň, P.; Trögl, J.; Nováková, J.; Pilařová, V.; Dáňová, P.; Pavlorková, J.; Kozler, J.; Novák, František; Popelka, J.

    -, č. 642427 (2014). ISSN 1537-744X Grant ostatní: GA MPO(CZ) FR-TI1/456 Institutional support: RVO:60077344 Keywords : biodegradation * spilled diesel fuel * agricultural soil Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 1.219, year: 2013

  20. Single crystalline film scintillators based on the orthosilicate, perovskite and garnet compounds

    Czech Academy of Sciences Publication Activity Database

    Zorenko, Y.; Gorbenko, V.; Savchyn, V.; Voznyak, T.; Sidletskiy, O.; Grinyov, B.; Nikl, Martin; Mareš, Jiří A.; Martin, T.; Douissard, P.-A.


    Roč. 59, č. 5 (2012), s. 2260-2268. ISSN 0018-9499 R&D Projects: GA ČR GA202/08/0893 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ce 3+ , Tb 3+ and Sc 3+ dopants * garnets Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.219, year: 2012

  1. Inventory of rodent damage to forests

    Czech Academy of Sciences Publication Activity Database

    Kamler, Jiří; Turek, K.; Homolka, Miloslav; Baňař, P.; Barančeková, Miroslava; Heroldová, Marta; Krojerová, Jarmila; Suchomel, J.; Purchart, L.


    Roč. 57, č. 5 (2011), s. 219-225. ISSN 1212-4834 R&D Projects: GA MZe QH72075 Institutional research plan: CEZ:AV0Z60930519 Keywords : bank vole * field vole * bark damage * forest protection Subject RIV: GK - Forestry

  2. The lamellar spacing in self-assembling bacteriochlorophyll aggregates is proportional to the length of the esterifying alcohol

    Czech Academy of Sciences Publication Activity Database

    Pšenčík, J.; Torkkeli, M.; Župčanová, Anita; Vácha, František; Serimaa, R.E.; Tůma, R.


    Roč. 104, 2-3 (2010), s. 211-219. ISSN 0166-8595 R&D Projects: GA ČR GA206/09/0375 Institutional research plan: CEZ:AV0Z50510513 Keywords : Green photosynthetic bacteria * Chlorosome * Bacteriochlorophyll Subject RIV: CE - Biochemistry Impact factor: 2.410, year: 2010

  3. Comparative analysis of genome-wide divergence, domestication footprints and genome-wide association study of root traits for Gossypium hirsutum and Gossypium barbadense (United States)

    Use of 10,129 singleton SNPs of known genomic location in tetraploid cotton provided unique opportunities to characterize genome-wide diversity among 440 Gossypium hirsutum and 219 G. barbadense cultivars and landrace accessions of widespread origin. Using genome-wide distributed SNPs, we examined ...

  4. N,3,4-Trisubstituted pyrrolidines by electron transfer-induced oxidative cyclizations of N-allylic beta-amino ester enolates

    Czech Academy of Sciences Publication Activity Database

    Jahn, Ullrich; Kafka, František; Pohl, Radek; Jones, P.G.


    Roč. 65, č. 52 (2009), s. 10917-10929. ISSN 0040-4020 Institutional research plan: CEZ:AV0Z40550506 Keywords : electron transfer * pyrrolidines * oxidation Subject RIV: CC - Organic Chemistry Impact factor: 3.219, year: 2009

  5. 36 CFR 223.279 - Personal use. (United States)


    .... In conjunction with determining sustainable harvest levels under § 223.219, the responsible Forest... 223.279 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Forest Botanical Products § 223.279 Personal use. (a)...

  6. Malakostratigrafie vchodového valu Medvědí jeskyně ve Slovenském ráji

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen


    Roč. 2011, podzim (2012), s. 219-222. ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Slovenský raj * Medvedia Cave * entrance rampart * Holocene * Mollusca * foam sinter Subject RIV: DB - Geology ; Mineralogy

  7. 75 FR 28606 - Agency Information Collection Activities; Submission to OMB for Review and Approval; Comment... (United States)


    ... July 30, 2009 (74 FR 38005), EPA sought comments on this ICR pursuant to 5 CFR 1320.8(d). EPA received... information is estimated to average 219 hours per response. Burden means the total time, effort, or financial..., due to a math error in the previous ICR. Also, there is an increase in both respondent and...

  8. Escherichia coli rpiA gene encoding ribose phosphate isomerase A

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne; Maigaard, Marianne


    was sequenced and shown to harbor an open reading frame of 219 codons, sufficient to encode a polypeptide with an Mr of 22,845. The synthesis of the rpiA-encoded polypeptide was detected by analysis of minicells, which established the subunit Mr as 27,000. The assignment of the correct reading frame...

  9. Complexation of Eu3+ with a macrocyclic lactam receptor: Experimental and theoretical study

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Záliš, Stanislav; Sedláková, Zdeňka; Vaňura, P.


    Roč. 1038, APR 2013 (2013), s. 216-219. ISSN 0022-2860 Institutional support: RVO:61388955 ; RVO:61389013 Keywords : europium * macrocyclic lactam receptor * complexation Subject RIV: CF - Physical ; Theoretical Chemistry; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 1.599, year: 2013

  10. [Christofer Herrmann. Kloster und Burg - die architektur des Deutschens Ordens im Pressen und Livland. In : Glaube, Macht und Pracht. GeistlicheGemeinschaften des Ostseeraums im Zeitalter der Backsteingotik] / Dennis Hortmuth

    Index Scriptorium Estoniae

    Hortmuth, Dennis


    Arvustus: Christofer Herrmann. Kloster und Burg - die Architektur des Deutschen Ordens in Preussen und Livland. In : Glaube, Macht und Pracht. GeistlicheGemeinschaften des Ostseeraums im Zeitalter der Backsteingotik (=Archäologie und Geschichte im Ostseeraum; Archaeology and History of the Baltic 6) Rahden : Verlag Marie Leidorf, 2009. S. 209-219. Saksa Ordu arhitektuurist Preisi- ja Liivimaal

  11. Facing Guilt: Role of Negative Affectivity, Need for Reparation, and Fear of Punishment in Leading to Prosocial Behaviour and Aggression

    Czech Academy of Sciences Publication Activity Database

    Caprara, G. V.; Barbaranelli, C.; Pastorelli, C.; Čermák, Ivo; Rozsa, S.


    Roč. 15, č. 3 (2001), s. 219-237. ISSN 0890-2070 Institutional research plan: CEZ:AV0Z7025918 Keywords : emotional predictors of aggression * Guilt * Negative Affectivity Subject RIV: AN - Psychology Impact factor: 1.081, year: 2001

  12. Molecular evidence for extra-pair paternity and intraspecific blood parasitism in the black-headed gull

    Czech Academy of Sciences Publication Activity Database

    Ležalová-Piálková, Radka

    Perth: International Society for Behavioral Ecology, 2010. s. 219. [Congress of the International Society for Behavioral Ecology /13./. 26.09.2010-01.10.2010, Perth] Institutional research plan: CEZ:AV0Z60930519 Keywords : black headed gull Subject RIV: EG - Zoology

  13. Sochařství z Mnichova v Čechách a čeští sochaří v Mnichově / Die Bildhauerkunst aus München in Böhmen und tschechische Bildhauer in München

    Czech Academy of Sciences Publication Activity Database

    Petrasová, Taťána

    Praha: Academia, 2012 - (Petrasová, T.; Prahl, R.), s. 219-256 ISBN 978-80-200-1889-2 R&D Projects: GA AV ČR IAA800330602 Institutional research plan: CEZ:AV0Z80330511 Keywords : Czech sculpture * 19th century * artistic schools Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. Oratorium v Czechach, na Morawach i v Morawskiej czesci Slaska v XVII-XLIX wieku,

    Czech Academy of Sciences Publication Activity Database

    Freemanová, Michaela

    Vol. III. Wroclaw: Polskie stowarzyszenie pedagogow spiewu - Akademia muzyczna im. Karola Lipinskiego we Wroclawiu, 2005 - (Sasiadek,, E.; Werner, B.), s. 219-228. (Wokalistyka i Pedagogika Wokalna. IV). ISBN 83-86534-37-0. [Sesja naukowa Muzyka. Wroclaw (PL), 04.04.2000] Institutional research plan: CEZ:AV0Z9058907 Keywords : Oratorio * Bohemia * Silesia Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Ernst Mach a evoluční pojetí vědy

    Czech Academy of Sciences Publication Activity Database

    Havlík, Vladimír

    Vol. 2. Brno: Masarykova univerzita Brno, 2010 - (Dub, P.; Musilová, J.), s. 206-219 ISBN 978-80-210-4808-9. [Mach - Fyzika - Filosofie. Brno (CZ), 16.05.2008 -] Institutional research plan: CEZ:AV0Z90090514 Keywords : E. Mach * evolutionary epistemology * philosophy of science * empiriocriticism Subject RIV: AA - Philosophy ; Religion

  16. Regard de Jan Patočka sur T.G.Masaryk

    Czech Academy of Sciences Publication Activity Database

    Kohák, Erazim

    Paris: Institut d´études slaves, 2007, s. 211-219 R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : Jan Patočka * T. G. Masaryk * Czech Philosophy Subject RIV: AA - Philosophy ; Religion

  17. Flow-induced vibration of circular cylindrical structures

    Energy Technology Data Exchange (ETDEWEB)

    Chen, S.S.


    This report summarizes the flow-induced vibration of circular cylinders in quiescent fluid, axial flow, and crossflow, and applications of the analytical methods and experimental data in design evaluation of various system components consisting of circular cylinders. 219 figs., 30 tabs. (JDB)

  18. Anti-Semitism on Campus. (United States)

    Malaney, Gary D.; Williams, Elizabeth A.


    Investigated and compared Jewish (n=219) and non-Jewish (n=197) students' perceptions of the anti-Semitic atmosphere at University of Massachusetts at Amherst. Jewish students were significantly more likely to perceive anti-Semitic environment than were non-Jewish students. Nonetheless, 71.4% of non-Jewish students believed Jewish students were…

  19. Chemical composition of flesh of diploid and triploid population of tench (Tinca tinca, Linnaeus 1758)

    Czech Academy of Sciences Publication Activity Database

    Buchtová, H.; Vorlová, L.; Svobodová, Z.; Flajšhans, Martin


    Roč. 50, č. 5 (2005), s. 213-219. ISSN 1212-1819 Institutional research plan: CEZ:AV0Z50450515 Keywords : tench * genome polyploidy * dry matter Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.254, year: 2005

  20. The shape variability of human tibial epiphyses in an early medieval Great Moravian population (9th-10th century AD): A geometric morphometric assessment

    Czech Academy of Sciences Publication Activity Database

    Brzobohatá, Hana; Krajíček, V.; Velemínský, P.; Poláček, Lumír; Velemínská, J.


    Roč. 71, č. 3 (2014), s. 219-236. ISSN 0003-5548 Grant ostatní: GA UK(CZ) 613012 Institutional support: RVO:67985912 ; RVO:68081758 Keywords : geometric morphometrics * tibia * sex ual dimorphism * Great Moravian Empire * Early Middle Ages * socioeconomic status * optical scanning Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.250, year: 2014

  1. More Abstracts on Effects of Radiation on Electronic Devices (United States)

    Bouquet, Frank L.


    Second volume of bibliography summarizes literature on radiation effects on new electronic devices. Includes those of protons, electrons, neutrons, gamma rays, and cosmic rays at energies up to about 20 GeV. Volume contains 219 abstracts from unclassified sources. Organized into four sections: dose-rate effects, new technology, post-irradiaton effects, and test environments.

  2. Analysis of major histocompatibility complex class II gene in water voles using capillary electrophoresis-single stranded conformation polymorphism

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Galan, M.; Charbonnel, N.; Cosson, J.-F.


    Roč. 5, č. 1 (2005), s. 173-176. ISSN 1471-8278 Institutional research plan: CEZ:AV0Z6093917 Keywords : water vole * population genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.219, year: 2005

  3. What Do Employers Ask for in Advertisements for Special Education Positions? (United States)

    Stephenson, Jennifer; Carter, Mark


    Although qualified special educators are more likely to provide effective teaching for students with disabilities and special education needs, it seems many teachers in special education and support positions are not qualified for this role. The study reported here provided analysis of 219 job advertisements for special education positions in…

  4. Electrochemical Evidence of Host-Guest Interactions. Change of Redox Mechanism of Fungicides Iprodione and Procymidone in the Nano-cavity of Cyclodextrins

    Czech Academy of Sciences Publication Activity Database

    Hromadová, Magdaléna; Pospíšil, Lubomír; Giannarelli, S.; Fuoco, R.; Colombini, M. P.


    Roč. 73, - (2002), s. 213-219. ISSN 0026-265X R&D Projects: GA MŠk OC D15.10; GA ČR GP203/02/P082 Institutional research plan: CEZ:AV0Z4040901 Keywords : electrochemical evidence * fungicide * cyclodextrin Subject RIV: CG - Electrochemistry Impact factor: 1.325, year: 2002

  5. Comorbidity of Migraine with ADHD (United States)

    Fasmer, Ole Bernt; Riise, Trond; Lund, Anders; Dilsaver, Steven C.; Hundal, Oivind; Oedegaard, Ketil J.


    Objective: The purpose of this study was to investigate how often drugs used to treat migraine and ADHD are prescribed to the same patients to assess, indirectly, the comorbidity of these disorders. Method: We used data from the Norwegian prescription database for 2006, including the total Norwegian population (N = 4,640,219). Results:…

  6. Geochronology and characteristics of Ni-Cu-(PGE) mineralization at Rožany, Lusatian Granitoid Complex, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Haluzová, Eva; Ackerman, Lukáš; Pašava, J.; Jonášová, Šárka; Svojtka, Martin; Hrstka, Tomáš; Veselovský, F.


    Roč. 60, č. 4 (2015), s. 219-236. ISSN 1802-6222 R&D Projects: GA ČR GA13-15390S Institutional support: RVO:67985831 Keywords : Ni-Cu-(PGE) * Lusatia * Re-Os * Bohemian Massif * sulphur Subject RIV: DD - Geochemistry Impact factor: 1.405, year: 2014

  7. Measurement of dose equivalent distribution on-board commercial jet aircraft

    Czech Academy of Sciences Publication Activity Database

    Kubančák, Ján; Ambrožová, Iva; Ploc, Ondřej; Pachnerová Brabcová, Kateřina; Štěpán, Václav; Uchihori, Y.


    Roč. 162, č. 3 (2014), s. 215-219. ISSN 0144-8420 Institutional support: RVO:61389005 Keywords : aircrew dosimetry * space weather * CERF Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.913, year: 2014

  8. Increased expression of chemokine receptors CCR1 and CCR3 in nasal polyps: molecular basis for recruitment of the granulocyte infiltrate

    Czech Academy of Sciences Publication Activity Database

    Fundová, Petra; Funda, David; Kovář, D.; Holý, R.; Navara, M.; Tlaskalová-Hogenová, Helena


    Roč. 58, č. 3 (2013), s. 219-224. ISSN 0015-5632 R&D Projects: GA MZd NS10054 Institutional support: RVO:61388971 Keywords : INTESTINAL EPITHELIAL-CELLS * GM-CSF * TOLL-LIKE RECEPTORS Subject RIV: EE - Microbiology, Virology Impact factor: 1.145, year: 2013

  9. Predictors of Summer Sun Safety Practice Intentions among Rural High School Students (United States)

    Cho, Hyunyi; Sands, Laura P.; Wilson, Kari M.


    To investigate the association between theoretically grounded psychosocial motivators and the sun safety practice intentions of rural youth. Method: A survey was given to 219 members of FFA (Future Farmers of America) at high schools in the rural Midwest (average age = 16). Results: Perceived self-efficacy, peer norms, response efficacy, and…

  10. Are We Still Afraid of Science?

    Czech Academy of Sciences Publication Activity Database

    Chvatík, Ivan

    Cham: Springer, 2015 - (Učník, L.; Chvatík, I.; Williams, A.), s. 211-219. (Contributions To Phenomenology. 76). ISBN 978-3-319-09827-2 Institutional support: RVO:67985955 Keywords : Hawking * grand design * multiverse theory * brain * free will * quantum fluctuation Subject RIV: AA - Philosophy ; Religion

  11. Thermally stimulated luminescence in Ce-doped yttrium oxyorthosilicate

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Vávrů, K.; Horodyský, P.; Chewpraditkul, W.; Jarý, Vítězslav; Nikl, Martin


    Roč. 59, č. 5 (2012), s. 2085-2088. ISSN 0018-9499 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxide compounds * scintillation detectors * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.219, year: 2012

  12. Reduced chemical kinetic mechanisms for NOx emission prediction in biomass combustion

    DEFF Research Database (Denmark)

    Houshfar, Ehsan; Skreiberg, Øyvind; Glarborg, Peter;


    reactions and chemical species, that is, 35 species and 198 reactions, corresponding to 72% reduction in the number of reactions and, therefore, improving the computational time considerably. Yet, the model based on the reduced mechanism predicts correctly concentrations of NOx and CO that are essentially...... parameters on NOx emission. © 2012 Wiley Periodicals, Inc. Int J Chem Kinet 44: 219–231, 2012...

  13. The supernumerary cheek tooth in tabby/EDA mice-a reminiscence of the premolar in mouse ancestors

    Czech Academy of Sciences Publication Activity Database

    Peterková, Renata; Lesot, H.; Viriot, L.; Peterka, Miroslav


    Roč. 50, - (2005), s. 219-225. ISSN 0003-9969 R&D Projects: GA MŠk OC B23.002; GA ČR GA304/02/0448 Institutional research plan: CEZ:AV0Z5039906 Keywords : supernumerary tooth * molar * odontogenesis Subject RIV: EA - Cell Biology Impact factor: 1.288, year: 2005

  14. 36 CFR 228.102 - Leasing analyses and decisions. (United States)


    ... at 43 CFR parts 1500-1508, and Forest Service implementing policies and procedures set forth in... accordance with the requirements of 36 CFR part 219 (Forest land and resource management planning) and/or, as... there is significant new information or circumstances as defined by 40 CFR 1502.9 requiring...

  15. Thermostability of multidomain proteins: chimeric mesophilic/thermophilic elongation factors EF-Tu

    Czech Academy of Sciences Publication Activity Database

    Šanderová, Hana; Maloň, Petr; Hůlková, Marta; Jonák, Jiří

    Oxford : Blackwell Publishing, 2004, s. 219. [Meeting of the Federation of the European Biochemical Societies /29./. Varšava (PL), 26.06.2004-01.07.2004] R&D Projects: GA ČR GA303/02/0689 Institutional research plan: CEZ:AV0Z5052915 Keywords : thermostability * EF-Tu * chimeric protein Subject RIV: EB - Genetics ; Molecular Biology

  16. Odešla Libuše Hynková

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela


    Roč. 22, č. 3 (2012), s. 219-220. ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Libuše Hynková * necrologue * dance * staging folklor * choreografy of traditional dance Subject RIV: AC - Archeology, Anthropology, Ethnology


    Czech Academy of Sciences Publication Activity Database

    Nováková, Kateřina; Navrátil, Tomáš; Šestáková, Ivana; Mareček, Vladimír; Chýlková, J.


    Roč. 108, č. 3 (2014), s. 219-225. ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP208/12/1645; GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : lecitine * cholesterol * biological membranes Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

  18. 18 CFR 2.1c - Policy statement on consultation with Indian tribes in Commission proceedings. (United States)


    ... (3) Is filed with the Secretary of the Commission. See generally 18 CFR 2.19. Statements of General..., administer justice, and manage and control their lands and resources. Through several Executive Orders and a... Commission's licensing and certificating processes and of the Commission's review of jurisdictional...

  19. Performance of Hamamatsu 64-anode photomultipliers for use with wavelength-shifting optical fibres

    International Nuclear Information System (INIS)

    Hamamatsu R5900-00-M64 and R7600-00-M64 photomultiplier tubes will be used with wavelength-shifting optical fibres to read out scintillator strips in the MINOS near detector. We report on measurements of the gain, efficiency, linearity, crosstalk, and dark noise of 232 of these PMTs, of which 219 met MINOS requirements

  20. 77 FR 74204 - Notice of Availability of the Record of Decision for the Final White-Tailed Deer Management Plan... (United States)


    ... National Park Service Notice of Availability of the Record of Decision for the Final White-Tailed Deer...) announces the availability of the Record of Decision (ROD) for the Final White-tailed Deer Management Plan... (219) 395-1550. SUPPLEMENTARY INFORMATION: The NPS has issued a ROD for the Final White-tailed...

  1. Dialogičnost narativně-biografického interview

    Czech Academy of Sciences Publication Activity Database

    Kubáčková, Patricie

    Praha: ÚJČ AV Ř, 2005 - (Čmejrková, S.; Svobodová, I.), s. 219-235 ISBN 80-86496-23-6 R&D Projects: GA ČR GD405/03/H053 Institutional research plan: CEZ:AV0Z90610518 Keywords : narrative interview * sociolinguistics * ethnomethodology * phatic function Subject RIV: AI - Linguistics

  2. Domain Modeling: NP_003411.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_003411.3 chr3 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr3/NP_003411.3.../NP_003411.3_holo_219-301.pdb blast 224C,226V,227C,228G,229K,230G,231F,232S,233Q,234S

  3. Domain Modeling: NP_001561.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001561.3 chr3 Structural Basis for the Interaction of TAK1 Kinase with its Activ...ating Protein TAB1 p2evaa_ chr3/NP_001561.3/NP_001561.3_holo_194-543.pdb psi-blast 216I,217S,218Q,219G,224V,

  4. File list: His.Liv.10.AllAg.Liver [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Liv.10.AllAg.Liver mm9 Histone Liver Liver SRX591723,SRX591725,SRX591727,SRX219...0338,SRX100343 ...

  5. Dense Alternating Sign Matrices and Extensions

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Hall, F.J.; Stroev, M.


    Roč. 444, 1 March (2014), s. 219-226. ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : alternating sign matrix * dense matrix * totally unimodular matrix * combined matrix * generalized complementary basic matrix Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  6. Complex Wedge-Shaped Matrices: A Generalization of Jacobi Matrices

    Czech Academy of Sciences Publication Activity Database

    Hnětynková, Iveta; Plešinger, M.


    Roč. 487, 15 December (2015), s. 203-219. ISSN 0024-3795 R&D Projects: GA ČR GA13-06684S Keywords : eigenvalues * eigenvector * wedge-shaped matrices * generalized Jacobi matrices * band (or block) Krylov subspace methods Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  7. Word Problem for Knotted Residuated Lattices

    Czech Academy of Sciences Publication Activity Database

    Horčík, Rostislav


    Roč. 219, č. 5 (2015), s. 1548-1563. ISSN 0022-4049 R&D Projects: GA ČR GAP202/11/1632 Institutional support: RVO:67985807 Keywords : residuated lattice * knotted rule * word problem * residuated frame * semi-Thue system * square-free word Subject RIV: BA - General Mathematics Impact factor: 0.474, year: 2014

  8. File list: Oth.Dig.20.VSV-G.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.20.VSV-G.AllCell hg19 TFs and others VSV-G Digestive tract SRX961218,SRX961...219 ...

  9. File list: Oth.Dig.05.VSV-G.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.05.VSV-G.AllCell hg19 TFs and others VSV-G Digestive tract SRX961218,SRX961...219 ...

  10. File list: Oth.Dig.50.VSV-G.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.50.VSV-G.AllCell hg19 TFs and others VSV-G Digestive tract SRX961218,SRX961...219 ...

  11. File list: Oth.Dig.10.VSV-G.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.10.VSV-G.AllCell hg19 TFs and others VSV-G Digestive tract SRX961218,SRX961...219 ...

  12. Voltage clamp analysis of ajmaline-induced block of potassium currents in ventricular myocytes

    Czech Academy of Sciences Publication Activity Database

    Bahníková, M.; Matějovič, P.; Pásek, Michal; Šimurdová, M.; Šimurda, J.

    Brno : Brno University of Technology, 2002 - (Jan, J.; Kozumplík, J.; Provazník, I.), s. 217-219 ISBN 80-214-2633-0. ISSN 1211-412X. [Biosignal 2002. Brno (CZ), 26.06.2002-28.06.2002] Institutional research plan: CEZ:AV0Z2076919 Keywords : cardiac cell * potassium currents * ajmaline Subject RIV: BO - Biophysics

  13. Setting up a STAR Tier 2 Site at Golias/Prague Farm

    Czech Academy of Sciences Publication Activity Database

    Chaloupka, Petr; Jakl, Pavel; Kapitán, Jan; Zerola, Michal; Lauret, J.

    Vol. 219. Bristol : IOP Publishing Ltd, 2010 - (Gruntorad, J.; Lokajíček, M.), 072031 ISSN 1742-6588. [17th International Conference on Computing in High Energy and Nuclear Physics (CHEP). Prague (CZ), 21.05.2009-27.05.2009] Institutional support: RVO:61389005 Keywords : STAR Collaboration * RHIC * High Energy Nuclear Physics Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  14. Mechanisms and evolution of deceptive pollination in orchids

    Czech Academy of Sciences Publication Activity Database

    Jersáková, Jana; Johnson, S.D.; Kindlmann, Pavel


    Roč. 81, - (2006), s. 219-235. ISSN 1464-7931 Institutional research plan: CEZ:AV0Z60870520 Keywords : cross-pollination * floral deception * geitonogamy * inbreeding * nectar * Orchidaceae * pollinaria * reward * self-pollination Subject RIV: EF - Botanics Impact factor: 5.565, year: 2006

  15. Magnetic beads-based electrochemical immunosensor for monitoring allergenic food proteins

    Czech Academy of Sciences Publication Activity Database

    Čadková, M.; Metelka, R.; Holubová, L.; Horák, Daniel; Dvořáková, V.; Bílková, Z.; Korecká, L.


    Roč. 484, 1 September (2015), s. 4-8. ISSN 0003-2697 R&D Projects: GA ČR GAP206/12/0381 Institutional support: RVO:61389013 Keywords : electrochemical immunosensor * magnetic particles * ovalbumin Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.219, year: 2014

  16. Genomic inbreeding and relationships among Holsteins, Jerseys, and Brown Swiss (United States)

    Genomic measures of relationship and inbreeding within and across breeds were compared with pedigree measures using genotypes for 43,385 loci of 25,219 Holsteins, 3,068 Jerseys, and 872 Brown Swiss. Adjustment factors were estimated for means and regressions of genomic on pedigree relationships, for...

  17. 76 FR 13631 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized... (United States)


    .... Radiology 12-122 12-217 IEC 62083 Edition Withdrawn and 2.0:2009-09 Medical replaced with electrical newer... lens design modifications. H. Radiology 12-219 Medical electrical IEC 60336 (Fourth equipment--X-ray... of February 25, 1998 (63 FR 9561), FDA announced the availability of a guidance...

  18. The Division III Student-Athlete: Academic Performance, Campus Involvement and Growth. (United States)

    Richard, Shaunette; Aries, Elizabeth


    A study of 219 seniors, including a broad spectrum of student-athletes, at a Division III school revealed that athletic participation did not impede academic success, or prevent involvement in most other extracurricular activities or with nonathletes. Athletes' personal growth was positively related to time spent with teammates in games and…

  19. Board Members' Views on Training and Development. (United States)

    Weaver, Liz; Inglis, Sue


    A survey of 22 agency directors and 219 volunteer board members showed that 40% of members received 1-5 hours of training in the last 6 months, 47% none. Training needs included board roles and responsibilities, strategic planning, understanding the agency, and fundraising. Preferred methods were facilitated workshop/retreat or board-led training…

  20. 77 FR 57079 - National Board for Education Sciences; Meeting (United States)


    ... National Board for Education Sciences; Meeting AGENCY: Institute of Education Sciences, Department of... agenda of an upcoming meeting of the National Board for Education Sciences. The notice also describes the...:(202) 219-1466; email: . SUPPLEMENTARY INFORMATION: The National Board for...

  1. Legal and Illegal Colours

    DEFF Research Database (Denmark)

    Larsen, John Christian


    :// Accessed 12.05.08.] and parabens [EFSA. (2004). Opinion of the Scientific Panel on Food Additives, Flavourings, Processing Aids and Materials in Contact with Food (AFC) related to para hydroxybenzoates (214e219). Opinion expressed on 13/07/2004. Available at http...

  2. Development and validation of a prognostic model for recurrent glioblastoma patients treated with bevacizumab and irinotecan

    DEFF Research Database (Denmark)

    Urup, Thomas; Dahlrot, Rikke Hedegaard; Grunnet, Kirsten;


    . MATERIAL AND METHODS: A total of 219 recurrent GBM patients treated with BEV plus irinotecan according to a previously published treatment protocol were included in the initial population. Prognostic models were generated by means of multivariate logistic and Cox regression analysis. RESULTS: In...

  3. Main: 1WEE [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1WEE シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Hypothetical Protein F10c21.9 N ... 1g33420; Arabidopsis Thaliana Molecule: Phd Finger Family ... Protein; Chain: A; Fragment: Phd Domain; Engineere ... ama Solution Structure Of Phd Domain In Phd Finger Family ... Protein To Be Published Nmr, Structural Genomics, ...

  4. 75 FR 13422 - Federal Acquisition Regulation; FAR Case 2008-015, Payments Under Fixed-Price Architect-Engineer... (United States)


    ... services work. Discussion and Analysis A proposed rule was published in the Federal Register at 74 FR 20666... Federal Acquisition Regulation; FAR Case 2008-015, Payments Under Fixed-Price Architect-Engineer Contracts.... Suzanne Neurauter, Procurement Analyst, at 202-219-0310. For information pertaining to status...

  5. 36 CFR 251.56 - Terms and conditions. (United States)


    ... plan governing the area (36 CFR part 219). (c) Preconstruction approvals. Forest Service approval of... Special Uses § 251.56 Terms and conditions. (a) General. (1) Each special use authorization must contain... and economic interests; (B) Manage efficiently the lands subject to the use and adjacent thereto;...

  6. The Genetic and Environmental Covariation among Psychopathic Personality Traits, and Reactive and Proactive Aggression in Childhood (United States)

    Bezdjian, Serena; Tuvblad, Catherine; Raine, Adrian; Baker, Laura A.


    The present study investigated the genetic and environmental covariance between psychopathic personality traits with reactive and proactive aggression in 9- to 10-year-old twins (N = 1,219). Psychopathic personality traits were assessed with the Child Psychopathy Scale (D. R. Lynam, 1997), while aggressive behaviors were assessed using the…

  7. Response of photosynthetic apparatus of spring barley (Hordeum vulgare L.) to combined effect of elevated CO2 concentration and different growth irradiances

    Czech Academy of Sciences Publication Activity Database

    Kurasová, I.; Kalina, J.; Štroch, M.; Urban, Otmar; Špunda, V.


    Roč. 41, č. 2 (2003), s. 209-219. ISSN 0300-3604 R&D Projects: GA ČR GA522/00/1381; GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z6087904 Keywords : CO2 concentration * fluorescence * photosynthesis Subject RIV: ED - Physiology Impact factor: 0.661, year: 2003

  8. Pöökpuud kuupaisel : [luuletused] / L{u00E1szl̤ Nagy ; tlk. Ly Seppel, Andres Ehin

    Index Scriptorium Estoniae

    Nagy, L{u00E1szl̤


    Sisu: Pöökpuud kuupaistel ; Härmaehtes maipidu ; Kes kannab siis teisele kaldale armastuse? ; Linna vapp ; Haljas ingel ; Bart̤k ja kiskjad ; Pulmad ; Ümbersünd hõbedasse ; Elagu puud. Eluloolisi andmeid autori kohta lk. 219-220

  9. Utility of the Rosenberg Self-Esteem Scale (United States)

    Davis, Clare; Kellett, Stephen; Beail, Nigel


    The Rosenberg Self-Esteem Scale (RSES) continues to be used to purportedly measure self-esteem of people with intellectual disabilities, despite the lack of sound evidence concerning its validity and reliability when employed with this population. The psychometric foundations of the RSES were analyzed here with a sample of 219 participants with…

  10. What Proportion of Preschool-Aged Children Consume Sweetened Beverages? (United States)

    Nickelson, Jen; Lawrence, Jeannine C.; Parton, Jason M.; Knowlden, Adam P.; McDermott, Robert J.


    Background: Obesity affects nearly 17% of US children and youth 2-19?years old and 10% of infants and toddlers under the age of 2?years. One strategy for addressing obesity is to discourage sugar-sweetened beverage (SSB) consumption. Compared with their older school-aged counterparts, children =5?years depend largely on parents for the purchase…

  11. Endogenous development, pathogenicity and host specificity of Eimeria cahirinensis Couch, Blaustein, Duszynski, Shenbrot and Nevo, 1997 (Apicomplexa: Eimeriidae) from Acomys dimidiatus (Cretzschmar 1826) (Rodentia: Muridae) from the Near East

    Czech Academy of Sciences Publication Activity Database

    Kvičerová, Jana; Ptáčková, P.; Modrý, David


    Roč. 100, č. 2 (2007), s. 219-226. ISSN 0932-0113 R&D Projects: GA ČR GA524/03/1548 Institutional research plan: CEZ:AV0Z60220518 Keywords : Eimeria cahirinensis * Acomys * Near East Subject RIV: EG - Zoology Impact factor: 1.512, year: 2007

  12. Integrating Nutrition into the Physical Education Curriculum (United States)

    Green, Heather L.


    Obesity among children and teens continues to be a major public health concern in the United States. Approximately 16.9% of children and adolescents age 2-19 years are obese. To address this epidemic, schools have been encouraged to develop a coordinated school health program, which includes an interdisciplinary approach to nutrition education.…

  13. Deviates' External Status and Opinion Patterns: Effects on Influence, Attractiveness, and Perceived Rationale. (United States)

    Ruback, R. Barry; Gromme, Marcia A.


    Manipulated external status of a target by presenting person as ethnic majority female, ethnic minority male, or ethnic majority male discussing issue with four ethnic majority males. Subjects were college students (N=219). Results were consistent with previous research showing odd person in a group is more salient than other group members. (ABL)

  14. Biophysical insights into cancer transformation and treatment

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Jiří; Foletti, A.; Kobilková, J.; Jandová, Anna; Vrba, J.; Vrba, J. jr.; Nedbalová, M.; Čoček, A.; Danani, A.; Tuszynski, J. A.


    Roč. 2013, č. 195028 (2013). ISSN 1537-744X R&D Projects: GA ČR(CZ) GAP102/11/0649 Institutional support: RVO:67985882 Keywords : fatty acid * mitochondrial membrane * cancer cell Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.219, year: 2013

  15. Family Engagement in Literacy Activities: Revised Factor Structure for the Familia--An Instrument Examining Family Support for Early Literacy Development (United States)

    Buhs, Eric S.; Welch, Greg; Burt, Jennifer; Knoche, Lisa


    This study evaluated a data-set drawn using "The Familia"--a measure originally developed to evaluate shared-reading activities. A newly developed set of conceptual supports and a confirmatory factor analysis (CFA) were applied to a new factor structure/model. Data were drawn from 219 young children and their families (mean age = 43 months)…

  16. Flow-induced vibration of circular cylindrical structures

    International Nuclear Information System (INIS)

    This report summarizes the flow-induced vibration of circular cylinders in quiescent fluid, axial flow, and crossflow, and applications of the analytical methods and experimental data in design evaluation of various system components consisting of circular cylinders. 219 figs., 30 tabs

  17. Odkaz Viktora Knappa české civilistice

    Czech Academy of Sciences Publication Activity Database

    Eliáš, Karel

    Plzeň: Aleš Čeněk, 2014 - (Gerloch, A.), s. 219-233 ISBN 978-80-7380-509-8 Institutional support: RVO:68378122 Keywords : eminent lawyer * civil law * theory of law Subject RIV: AG - Legal Sciences

  18. Effects of Welfare Participation on Marriage (United States)

    Teitler, Julien O.; Reichman, Nancy E.; Nepomnyaschy, Lenna; Garfinkel, Irwin


    We investigated the widely held premise that welfare participation causes women to refrain from marriage. Using data from the Fragile Families and Child Wellbeing Study (N = 3,219), we employed an event history approach to study transitions to marriage among mothers who have had a nonmarital birth. We found that welfare participation reduces the…

  19. What Can We Learn from Toddlers about Categorical Perception of Color? Comments on Goldstein, Davidoff, and Roberson (United States)

    Franklin, Anna; Wright, Oliver; Davies, Ian R. L.


    We comment on Goldstein, Davidoff, and Roberson's replication and extension ("Journal of Experimental Child Psychology, 102", 219-238 [2009]) of our study of the effect of toddlers' color term knowledge on their categorical perception (CP) of color ("Journal of Experimental Child Psychology, 90", 114-141 [2005]). First, we discuss how best to…

  20. Cognitive and Adaptive Functioning in 28 Girls with Rett Syndrome. Brief Report. (United States)

    Perry, Adrienne; And Others


    This study of 28 girls (ages 2-19) with Rett Syndrome found profound handicaps in the intellectual and adaptive areas, according to standardized tests. Subjects seemed capable of learning some self-help skills at a basic level. The Cattell Mental Age was significantly negatively correlated with chronological age. (JDD)

  1. Electrochemically initiated degradation of a new energetic material 2,2-dinitroethene-1,1-diamine (FOX-7)

    Czech Academy of Sciences Publication Activity Database

    Šimková, Ludmila; Ludvík, Jiří

    Montréal : ECS, 2011. [ECS Meeting /219./. 01.05.2011-06.05.2011, Montreal] R&D Projects: GA ČR GAP206/11/0727 Institutional research plan: CEZ:AV0Z40400503 Keywords : electrochemistry * 2,2-dinitroethene-1,1-diamine Subject RIV: CG - Electrochemistry

  2. Management of upper gastrointestinal bleeding from portal hypertension: Elective or emergency operation?


    Liu, Sen


    Objective : To evaluate the clinical outcome of emergency and elective operation of splenectomy with periesophagogastric devascularization in treating upper gastrointestinal hemorrhage resulted from portal hypertension. Methods : We retrospectively reviewed 219 patients of upper gastrointestinal hemorrhage resulted from portal hypertension treated using emergency or elective operation between Jul 2002 and Aug 2010. The clinical data were collected and analyzed. Results : In the group of elect...

  3. Polyimide based membranes for gas separation

    Czech Academy of Sciences Publication Activity Database

    Martin-Gil, V.; Sysel, P.; Hrabánek, Pavel; Fíla, V.

    Praha : VŠCHT Praha, 2014 - (Bouzek, K.), s. 216-219 ISBN 978-80-7080-889-4. [Moderní trendy v anorganických technologiích 2014 /4./. Praha (CZ), 11.06.2014-13.06.2014] Institutional support: RVO:61388955 Keywords : membrane synthesis * gas separation * copolyimide Subject RIV: CF - Physical ; Theoretical Chemistry

  4. Couples at risk following the death of their child : predictors of grief versus depression

    NARCIS (Netherlands)

    Wijngaards-de Meij, Leoniek; Stroebe, Margaret; Schut, Henk; Stroebe, Wolfgang; van den Bout, Jan; van der Heijden, Peter; Dijkstra, Iris


    This longitudinal study examined the relative impact of major variables for predicting adjustment (in terms of both grief and depression) among bereaved parents following the death of their child. Couples (N = 219) participated 6, 13, and 20 months postloss. Use of multilevel regression analyses ena

  5. Tertiary Structures of the Escherichia coli and Human Chromosome 21 Molecules of DNA

    Czech Academy of Sciences Publication Activity Database

    Hanzálek, Petr; Kypr, Jaroslav


    Roč. 283, č. 1 (2001), s. 219-223. ISSN 0006-291X R&D Projects: GA AV ČR IAA5004802 Institutional research plan: CEZ:AV0Z5004920 Keywords : DNA crystal structure s * phosphorus atom representation * genomic DNA molecules Subject RIV: BO - Biophysics Impact factor: 2.946, year: 2001

  6. Longitudinal Models of Socio-Economic Status: Impact on Positive Parenting Behaviors (United States)

    Azad, Gazi; Blacher, Jan; Marcoulides, George


    Parenting research is frequently conducted without a thorough examination of socio-economic characteristics. In this study, longitudinal observations of positive parenting were conducted across six time points. Participants were 219 mothers of children with and without developmental delays. Mothers' positive parenting increased during early…

  7. Three anisotropic benchmark problems for adaptive finite element methods

    Czech Academy of Sciences Publication Activity Database

    Šolín, Pavel; Čertík, O.; Korous, L.


    Roč. 219, č. 13 (2013), s. 7286-7295. ISSN 0096-3003 R&D Projects: GA AV ČR IAA100760702 Institutional support: RVO:61388998 Keywords : benchmark problem * anisotropic solution * boundary layer Subject RIV: BA - General Mathematics Impact factor: 1.600, year: 2013

  8. Papel de las células NK y linfocitos T en la respuesta inmune frente a Chlamidophyla abortus en modelo murino / Carlos Manuel Martínez Cacéres; directores, Joaquín Sánchez Campillo, Antonio J. Buendía Marín y Jesús Salinas Lorente.


    Martínez Cáceres, Carlos Manuel


    Tesis-Universidad de Murcia. Consulte la tesis en: BCA. GENERAL. ARCHIVO UNIVERSITARIO. T.M. 3026. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Departamentos. E002B TESIS 111. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Sala de estudio. Tesis-V 219.

  9. Activities and Accomplishments in Various Domains: Relationships with Creative Personality and Creative Motivation in Adolescence (United States)

    Hong, Eunsook; Peng, Yun; O'Neil, Harold F., Jr.


    This study examined relationships between five personal traits and adolescents' creative activities and accomplishments in five domains--music, visual arts, creative writing, science, and technology. Participants were 439 tenth graders (220 males and 219 females) in China. The relationships were examined using confirmatory factor analysis.…




  11. Vývoj sociální struktury české společnosti 1988-1999

    Czech Academy of Sciences Publication Activity Database

    Machonin, Pavel; Gatnar, Lumír; Tuček, Milan

    Brno : Konvoj, 2000 - (Kučerová, S.), s. 205-219 ISBN 80-7302-000-9 R&D Projects: GA ČR GA403/98/0170 Institutional research plan: CEZ:AV0Z7028912 Keywords : czech society * social transformation * hybrid structure Subject RIV: AO - Sociology, Demography

  12. Palmyra Atoll Site 15P 3/31/2004 38-39M (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Palmyra Atoll, site 15P 05 52.219N, 162 02.697W, between 38 and 39 meters along a permanent transect.

  13. Resources for Increasing Physical Activity in Children and Youth (United States)

    Ryan, Carol A.; Beighle, Aaron


    The number of children and youth who are overweight has reached epidemic proportions in the United States. According to the 2007-2008 National Health and Nutrition Examination Survey (NHANES) conducted by the Centers for Disease Control and Prevention (CDC), an estimated 17 percent of children and adolescents ages 2-19 years are obese. In…

  14. Psychiatric Disorders in Extremely Preterm Children: Longitudinal Finding at Age 11 Years in the EPICure Study (United States)

    Johnson, Samantha; Hollis, Chris; Kochhar, Puja; Hennessy, Enid; Wolke, Dieter; Marlow, Neil


    Objective: To investigate the prevalence and risk factors for psychiatric disorders in extremely preterm children. Method: All babies born less than 26 weeks gestation in the United Kingdom and Ireland from March through December 1995 were recruited to the EPICure Study. Of 307 survivors at 11 years of age, 219 (71%) were assessed alongside 153…

  15. Physical, Social, and Perceived Availabilities of Alcohol and Last Month Alcohol Use in Rural and Small Urban Communities (United States)

    Stanley, Linda R.; Henry, Kimberly L.; Swaim, Randall C.


    This study seeks to provide a greater understanding of the factors that determine the perceived availability of alcohol and its role in predicting adolescents' alcohol use. Participants were 151,703 7th-12th grade students (50% female) from a sample of 219 rural communities across the United States, with oversampling for predominantly…

  16. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek


    Roč. 7, č. 2 (2015), s. 219-248. ISSN 1945-7707 R&D Projects: GA ČR(CZ) GA13-29370S Institutional support: PRVOUK-P23 Keywords : optimal taxes * unobservable human capital * income taxes Subject RIV: AH - Economics Impact factor: 3.780, year: 2014

  17. A Study of the Effects of Automation on the Nature of the Work of the Draftsman in Industry, and the Innovative Programs of Instruction for Automated Drafting in Selected Junior Colleges in California to be Used for Curricular Revision. Final Report. (United States)

    Husung, William T., Jr.

    Visits to 35 industries and professional offices throughout California and interviews of 219 draftsmen and supervisors were conducted to determine: (1) the effects of automation on the needs of industry for draftsmen with general versus specialized training, and (2) the curricular revisions in vocational drafting programs in junior colleges to…

  18. Zicht op vangsten recreatieve visserij : een nieuwe methode en eerste resultaten

    NARCIS (Netherlands)

    Graaf, de M.; Quak, J.


    Recreatieve vissers hebben in 2010 naar schatting 382 ton kabeljauw gevangen en daarvan 23 ton teruggezet. Die vangst is ruim tien procent van de commerciele vangst van 3.219 ton door de beroepsvissersvloot dat jaar. De gezamenlijke aalvangst door recreatieve vissers op zee en in binnenwater in 2010

  19. Plasmonic composites of semiconductive polyelectrolytes with metal nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Pfleger, Jiří; Kazim, Samrana; Bondarev, D.; Vohlídal, J.

    Pennington : The Electrochemical Society, 2011. A_1294. [ECS Meeting /219./. 01.05.2011-06.05.2011, Montreal] R&D Projects: GA ČR GAP208/10/0941 Institutional research plan: CEZ:AV0Z40500505 Keywords : plasmonic nanoparticles * polyelectrolytes * conductive polymers Subject RIV: CF - Physical ; Theoretical Chemistry

  20. The Influence of Celebrity Exemplars on College Students' Smoking (United States)

    Yoo, Woohyun


    Objective: This study examined the effect of celebrity smoking exemplars in health news on college students' perceptions of smoking-related health risks and smoking intentions. Participants and Methods: The data were collected using a Web-based survey of 219 undergraduate students at a large midwestern university in March 2011. Separate analyses…

  1. Dicty_cDB: CHN835 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tical) Pinus taeda cDNA clone NXRV120_G11 5', mRNA sequence. 48 0.22 1 BA000026 |BA...005344.13 Zebrafish DNA sequence from clone CH211-219E17. 40 0.097 2 BQ699205 |BQ699205.1 NXRV120_G11_F NXRV (Nsf Xylem Root wood Ver

  2. Muscle Dysmorphia, Gender Role Stress, and Sociocultural Influences: An Exploratory Study (United States)

    Readdy, Tucker; Watkins, Patti Lou; Cardinal, Bradley J.


    Our study explored the contribution of gender role stress (GRS) and sociocultural appearance demands to symptoms of muscle dysmorphia (MD) in a college sample of 219 women and 154 men. For women, five GRS subscales, sociocultural appearance demands, age, and frequency of aerobic exercise predicted MD symptoms (model R[superscript 2] = 0.33;…

  3. Palmyra Atoll Site 15P 3/31/2004 44-45M (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Palmyra Atoll, site 15P 05 52.219N, 162 02.697W, between 44 and 45 meters along a permanent transect.

  4. Large expansion of morphologically heterogeneous mammary epithelial cells, including the luminal phenotype, from human breast tumours

    Czech Academy of Sciences Publication Activity Database

    Krásná, Luboslava; Dudorkinová, D.; Vedralová, J.; Veselý, Pavel; Pokorná, Eva; Kudláčková, I.; Chaloupková, Alena; Petruželka, L.; Daneš, J.; Matoušková, Eva


    Roč. 2002, č. 71 (2002), s. 219-235. ISSN 0167-6806 Institutional research plan: CEZ:AV0Z5052915 Keywords : human breast tumours * in vitro cultivation * keratins Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.132, year: 2002

  5. Sociometry in team assessment and development

    Czech Academy of Sciences Publication Activity Database

    Šlechta, Petr

    Londýn : European Congress of Psychology, 2001. s. 219. [VII. European Congress of Psychology. 05.05.2001-07.05.2001, Londýn] Institutional research plan: CEZ:AV0Z7025918 Keywords : sociometry * teamwork training * team assessment Subject RIV: AN - Psychology

  6. 75 FR 28849 - Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign... (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF STATE Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review...

  7. Invasive species

    Czech Academy of Sciences Publication Activity Database

    Pyšek, Petr; Richardson, D. M.

    Vol. 5. Great Barrington : Berkshire Publishing Group, 2012 - (Craig, R.; Nagle, J.; Pardy, B.; Schmitz, O.; Smith, W.), s. 211-219 ISBN 978-1-933782-16-4 Institutional support: RVO:67985939 Keywords : plant invasions * invasibility * invasiveness Subject RIV: EF - Botanics

  8. 75 FR 2477 - Plan Development for Kiowa, Rita Blanca, Black Kettle and McClellan Creek National Grasslands... (United States)


    ... using the provisions of the 1982 planning rule. Authority: 16 U.S.C. 1600-1614; 36 CFR 219.35 (74 FR... Grasslands, Colfax, Harding, Mora and Union Counties, NM; Dallam, Gray and Hemphill Counties, TX; Cimarron... applicable planning rule and how work done on the plan revision under the 2008 planning rule will be used...

  9. Fe2O3-SiO2 composites obtained by sol-gel synthesis

    Czech Academy of Sciences Publication Activity Database

    Savii, C.; Popovici, M.; Enache, C.; Šubrt, Jan; Nižňanský, Daniel; Bakardjieva, Snejana; Caizer, C.; Hrianca, I.


    Roč. 151, 1-4 (2002), s. 219-227. ISSN 0167-2738 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : sol-gel processing * magnetic properties * fine-particle systems Subject RIV: CA - Inorganic Chemistry Impact factor: 1.768, year: 2002

  10. Arginine-, D-arginine-vasopressin, and their inverso analogues in micellar and liposomic models of cell membrane: CD, NMR, and molecular dynamics studies

    Czech Academy of Sciences Publication Activity Database

    Lubecka, E. A.; Sikorska, E.; Sobolewski, D.; Prahl, A.; Slaninová, Jiřina; Ciarkowski, J.


    Roč. 44, č. 8 (2015), s. 727-743. ISSN 0175-7571 Institutional support: RVO:61388963 Keywords : antidiuretic agonists * anionic-zwitterionic micelles * liposomes * inverso analogues Subject RIV: CC - Organic Chemistry Impact factor: 2.219, year: 2014

  11. Palmyra Atoll Site 15P 3/31/2004 89-90M (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 89 and 90 meters along a permanent transect.

  12. Longitudinal Perspectives of Child Positive Impact on Families: Relationship to Disability and Culture (United States)

    Blacher, Jan; Begum, Gazi F.; Marcoulides, George A.; Baker, Bruce L.


    This study examined mothers' perceptions of the positive impact of having a child with an intellectual disability. Trajectories of positive impact from 7 time points were developed using latent growth modeling and 2 predictors: culture (Anglo, Latino) and child disability status (intellectual disability, typical development). Data were from 219

  13. Composition of PM2.5 in Prague during the Year 2006

    Czech Academy of Sciences Publication Activity Database

    Schwarz, Jaroslav; Štefancová, Lucia; Novák, J.; Macek, V.; Smolík, Jiří

    Thessaloniki: Hellenic Association for Aerosol Research, 2008, T06A219P. [European Aerosol Conference 2008. Thessaloniki (GR), 24.08.2008-29.08.2008] Grant ostatní: NF(FI) CZ0049 Institutional research plan: CEZ:AV0Z40720504 Keywords : urban aerosol * chemical composition * carbonaceous particles Subject RIV: CF - Physical ; Theoretical Chemistry

  14. AcEST: BP913319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_H11 491 Adiantum capillus-veneris mRNA. clone: YMU001_000028_H11. BP913319 CL4180C ... ives = 43/49 (87%) Frame = -2 Query: 490 GSWITFNQVVEPA IVPPWPLNGYVRGVTAKIVREILGDLQRECIHLAEM 344 GSW+ F QV+ ... NGYVRGVT +I+RE+L DLQ EC+ L+++ Sbjct: 171 GSWVNFQQVLEPA IVPPWPLNGYVRGVTERIIREMLADLQLECLRLSQV 219 >tr|A9TSV5 ...

  15. High levels of nuclear MYC protein predict the presence of MYC rearrangement in diffuse large B-cell lymphoma

    DEFF Research Database (Denmark)

    Green, Tina Marie; Nielsen, Ole; de Stricker, Karin;


    with poor prognosis in DLBCL. Fluorescence in situ hybridization and karyotyping are standard tests for detecting MYC aberrations, but these techniques are laborious and expensive. Here, we studied MYC status of 219 DLBCLs and Burkitt lymphomas using fluorescence in situ hybridization, immunohistochemistry...

  16. Quasistatic Delamination of Sandwich-Like Kirchhoff-Love Plates

    Czech Academy of Sciences Publication Activity Database

    Freddi, L.; Roubíček, Tomáš; Zanini, Ch.


    Roč. 113, č. 2 (2013), s. 219-250. ISSN 0374-3535 R&D Projects: GA ČR GAP201/10/0357 Institutional research plan: CEZ:AV0Z20760514 Keywords : adhesive contact * delamination * mixed modes Subject RIV: BA - General Mathematics Impact factor: 1.043, year: 2013

  17. Measurement of Perceived Parenting Style Influence on Academic Achievement among Saudi College Students (United States)

    Alanizi, Faris Mayoof Mokheimer


    The purpose of this study was to examine the relation between academic achievement and parenting styles among Saudi college students. The participants in this study consisted of 349 male and 219 female college students, whose age ranged from 18-25 years. The instruments for the current study were: (a) an Arabic translation of the Revised Parental…

  18. Parallel intergrowths in cronstedtite-1T: determination of the degree of disorder

    Czech Academy of Sciences Publication Activity Database

    Hybler, Jiří


    Roč. 18, - (2006), s. 197-205. ISSN 0935-1221 R&D Projects: GA ČR(CZ) GA205/03/0439 Institutional research plan: CEZ:AV0Z10100521 Keywords : polytypism * disorder * layer silicate * parallel intergrowth * Durovic effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.219, year: 2006

  19. Drug: D02107 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Indiclor (TN) InCl3 219.8104 221.177 D02107.gif Radioactive agent Therapeutic category: 4300 Therapeutic ca...tegory of drugs in Japan [BR:br08301] 4 Agents affecting cellular function 43 Radioactive drugs 430 Radioactive drugs 4300 Radio

  20. A first experimental test of multilevel game theory: the PD case

    Czech Academy of Sciences Publication Activity Database

    Hausken, K.; Ortmann, Andreas


    Roč. 15, č. 4 (2008), s. 261-264. ISSN 1350-4851 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : multilevel game theory * prisoner's dilemma Subject RIV: AH - Economics Impact factor: 0.219, year: 2008