45 CFR 150.219 - Final determination.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Final determination. 150.219 Section 150.219... Are Failing To Substantially Enforce HIPAA Requirements § 150.219 Final determination. If, after... the State a written notice of its final determination. The notice includes the following: (a...

49 CFR 21.9 - Compliance information.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Compliance information. 21.9 Section 21.9 Transportation Office of the Secretary of Transportation NONDISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS OF THE DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.9 Compliance information. (a) Cooperation and...

48 CFR 653.219 - Small business programs.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business programs. 653.219 Section 653.219 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES AND FORMS FORMS Prescription of Forms 653.219 Small business programs. ...

Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

International Nuclear Information System (INIS)

Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

2016-01-01

To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

Energy Technology Data Exchange (ETDEWEB)

Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

2016-06-01

To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

20 CFR 219.1 - Introduction.

Science.gov (United States)

2010-04-01

... Annuity), 234 (Lump-Sum Payments), and 222 (Family Relationships), certain requirements must be met before... used as evidence. Part 222 defines and explains family relationships for which evidence requirements... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 219.1 Section 219.1 Employees...

22 CFR 219.160 - Communications.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 219.160 Section 219.160 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... communication with applicants, participants, personnel of other Federal entities, and members of the public. (1...

48 CFR 1353.219 - Small business programs.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business programs. 1353.219 Section 1353.219 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS FORMS Prescription of Forms 1353.219 Small business programs. Use Form CD-570, Small Business Set...

20 CFR 219.2 - Definitions.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Definitions. 219.2 Section 219.2 Employees... some other person. Benefit means any employee annuity, spouse annuity, survivor annuity, or lump-sum... proves to the satisfaction of the Board that an individual meets a requirement for eligibility for...

49 CFR 1542.219 - Supplementing law enforcement personnel.

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Supplementing law enforcement personnel. 1542.219 Section 1542.219 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.219 Supplementing law...

36 CFR 219.17 - Interaction with private landowners.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with private landowners. 219.17 Section 219.17 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Sustainability § 219.17 Interaction with private landowners. The responsible official must seek to collaborate...

Evaluation of Nitrogen Uptake and Growth Performance of Advanced Mutant Lines MR219-4 and MR219-9 Grown Under Aerobic Conditions

International Nuclear Information System (INIS)

Shyful Azizi Abdul Rahman; Abdul Rahim Harun; Rusli Ibrahim; Khairuddin Abdul Rahim

2014-01-01

Developing a good crop production management package; drought resistance variety, effective water and nutrient management in rice production practices is crucial for global climate change adaptation. A research project under IAEA RAS5065 (Supporting Climate-Proofing Rice Production Systems (CRiPS) Based on Nuclear Applications) was conducted from 2012 to 2013, in collaboration with MARDI. Two advanced mutant lines, MR219-4 and MR219-9 were used in this research project to evaluate growth, yield potential and fertilizer uptake under different water input condition (flooded and aerobic). The advanced mutant line MR219-9 showed comparable growth, yield and nitrogen uptake under both flooded and aerobic conditions. The yield and yield components are not significantly different from the parent variety (MR219) but total N uptake was lower than MR219 regardless of water regime. The field trial showed that MR219-9 has a better total N content which is comparable to the aerobic rice variety (MRIA 1) and this indicates that this advance mutant line MR219-9 is a potential aerobic rice variety. (author)

37 CFR 1.219 - Early publication.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Early publication. 1.219... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication of Applications § 1.219 Early publication. Applications that will be published under § 1.211 may be published...

20 CFR 219.23 - Evidence to prove death.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...

36 CFR 219.19 - Ecological, social, and economic sustainability.

Science.gov (United States)

2010-07-01

... economic sustainability. 219.19 Section 219.19 Parks, Forests, and Public Property FOREST SERVICE..., Social, and Economic Sustainability § 219.19 Ecological, social, and economic sustainability. Sustainability, composed of interdependent ecological, social, and economic elements, embodies the Multiple-Use...

Formation and evolution of ultrafine particles produced by radiolysis and photolysis

International Nuclear Information System (INIS)

Madelaine, G.J.; Perrin, M.L.; Renoux, A.

1980-01-01

Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation

48 CFR 52.219-22 - Small Disadvantaged Business Status.

Science.gov (United States)

2010-10-01

.... Status as a small business and status as a small disadvantaged business for general statistical purposes... Business Status. 52.219-22 Section 52.219-22 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.219-22 Small Disadvantaged Business Status. As prescribed in 19.308(b), insert the following...

30 CFR 219.102 - Method of payment.

Science.gov (United States)

2010-07-01

... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...

Zinc finger protein 219-like (ZNF219L) and Sox9a regulate synuclein-γ2 (sncgb) expression in the developing notochord of zebrafish.

Science.gov (United States)

Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Liao, Yung-Feng; Han, Yu-San; Huang, Chang-Jen

2013-12-13

Zebrafish synuclein-γ2 (sncgb) has been reported to be expressed specifically in the notochord. However, the mechanism by which the sncgb gene promoter is regulated has not been described. In this paper, we demonstrate that Zinc finger protein 219-like (ZNF219L) and sox9a are involved in the regulation of sncgb gene expression. Furthermore, we observed that over-expression of both ZNF219L and Sox9a resulted in increased sncgb expression. In addition, ZNF219L is physically associated with Sox9a, and simultaneous morpholino knockdown of znf219L and sox9a caused a synergistic decrease of sncgb expression in the notochord. Taken together, our results reveal that coordination of ZNF219L with Sox9a is involved in the regulation of notochord-specific expression of sncgb. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

40 CFR 86.219-94 - CVS calibration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 18 2010-07-01 2010-07-01 false CVS calibration. 86.219-94 Section 86.219-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

49 CFR 173.219 - Life-saving appliances.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Life-saving appliances. 173.219 Section 173.219... Life-saving appliances. (a) A life-saving appliance, self-inflating or non-self-inflating, containing small quantities of hazardous materials that are required as part of the life-saving appliance must...

7 CFR 58.219 - High pressure pumps and lines.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false High pressure pumps and lines. 58.219 Section 58.219....219 High pressure pumps and lines. High pressure lines may be cleaned-in-place and shall be of such construction that dead ends, valves and the high pressure pumps can be disassembled for hand cleaning. The high...

36 CFR 219.12 - Collaboration and cooperatively developed landscape goals.

Science.gov (United States)

2010-07-01

... cooperatively developed landscape goals. 219.12 Section 219.12 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for Sustainability § 219.12 Collaboration and cooperatively developed landscape goals. (a...

48 CFR 1352.219-71 - Notification to delay performance (Deviation).

Science.gov (United States)

2010-10-01

... performance (Deviation). 1352.219-71 Section 1352.219-71 Federal Acquisition Regulations System DEPARTMENT OF....219-71 Notification to delay performance (Deviation). As prescribed in 48 CFR 1319.811-3(b), insert the following clause: Notification To Delay Performance (Deviation) (APR 2010) The contractor shall...

12 CFR 219.1 - Authority, purpose and scope.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Authority, purpose and scope. 219.1 Section 219.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM REIMBURSEMENT FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS...

Evaluation and characterization of advanced rice mutant line of rice (Oryza sativa), MR219-4 and MR219-9 under drought condition

International Nuclear Information System (INIS)

Abdul Rahim Harun; Zarith Shafika Kamarudin; Abdullah, M.Z.; Anna, L.P.K.; Sobri Hussain; Rusli Ibrahim; Khairuddin abdul Rahim

2012-01-01

Two advance rice mutant lines, MR219-4 and MR219-9 derived from mutagenesis of Oryza sativa cv. MR219 with gamma radiation at 300 Gy were evaluated in simulated drought condition in the greenhouse at Malaysian Nuclear Agency. The mutants were evaluated simultaneously with ARN1, a drought resistant variety and MR211 a susceptible cultivar as a check. Randomized complete block design with three replicates was used in the experiment. The evaluation and selection were done based on leaf rolling and leaf drying as well as other agronomic traits, such as, number of tillers per plant, plant height, flag leaf area, grain weight per plant, grain yield per plant, 100-grain weight, harvest index, panicle length and plant biomass. The mutants MR219-4 showed moderate tolerance and MR219-9 showed tolerance to drought respectively as compare to the check variety (ARN1, MR211) and control MR219. Leaf rolling, leaf drying, days to flowering and days to maturity are valuable secondary traits that may provide additional information for selection because of associating with the plant survival under water stress. Further research on expression of drought-tolerant lines under different drought conditions is essential in order to identify particular traits that are associated with drought tolerance and high yield potential. Similarly the importance of secondary traits, relative to other putative traits for drought tolerance, needs to be tested in various environments. (author)

Radiological risk of actinon (219Rn)

International Nuclear Information System (INIS)

Crawford, D.J.

1981-12-01

The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the 219 Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of 219 Rn on determinations of the concentration of the 222 Rn decay chain and/or its precursors

14 CFR 21.9 - Replacement and modification articles.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Replacement and modification articles. 21.9... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.9 Replacement and modification articles. (a) If a person knows, or should know, that a replacement or modification article is reasonably likely to be...

20 CFR 219.43 - Evidence of child's dependency.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of child's dependency. 219.43... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.43 Evidence of child's dependency. (a) When the dependency requirement must be met. Usually the dependency requirement must be met at one of the...

20 CFR 219.24 - Evidence of presumed death.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of presumed death. 219.24 Section... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.24 Evidence of presumed death. When a person cannot be proven dead but evidence of death is needed, the Board may presume he or she died at a certain...

MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction

DEFF Research Database (Denmark)

Kocerha, Jannet; Faghihi, Mohammad Ali; Lopez-Toledano, Miguel A

2009-01-01

significantly modulated behavioral responses associated with disrupted NMDA receptor transmission. Furthermore, pretreatment with the antipsychotic drugs haloperidol and clozapine prevented dizocilpine-induced effects on miR-219. Taken together, these data support an integral role for miR-219 in the expression...

Project management plan for Project W-178, 219-S secondary containment

International Nuclear Information System (INIS)

Buckles, D.I.

1995-01-01

This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service

48 CFR 552.219-72 - Preparation, Submission, and Negotiation of Subcontracting Plans.

Science.gov (United States)

2010-10-01

..., and Negotiation of Subcontracting Plans. 552.219-72 Section 552.219-72 Federal Acquisition Regulations... Text of Provisions and Clauses 552.219-72 Preparation, Submission, and Negotiation of Subcontracting... Negotiation of Subcontracting Plans (JUN 2005) (a) An offeror, other than a small business concern, submitting...

49 CFR 219.207 - Fatality.

Science.gov (United States)

2010-10-01

... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Post-Accident Toxicological Testing § 219.207 Fatality. (a) In the..., United States Code (but not the agent of the Secretary for purposes of the Federal Tort Claims Act...

48 CFR 1852.219-73 - Small business subcontracting plan.

Science.gov (United States)

2010-10-01

... Provisions and Clauses 1852.219-73 Small business subcontracting plan. As prescribed in 1819.708-70(a), insert the following provision: Small Business Subcontracting Plan (MAY 1999) (a) This provision is not... contain FAR clause 52.219-9, “Small Business Subcontracting Plan.” The apparent low bidder must submit the...

36 CFR 219.15 - Interaction with American Indian tribes and Alaska Natives.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with American Indian tribes and Alaska Natives. 219.15 Section 219.15 Parks, Forests, and Public Property FOREST... Collaborative Planning for Sustainability § 219.15 Interaction with American Indian tribes and Alaska Natives...

Radiological risk of actinon (/sup 219/Rn)

Energy Technology Data Exchange (ETDEWEB)

Crawford, D.J.

1981-12-01

The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the /sup 219/Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of /sup 219/Rn on determinations of the concentration of the /sup 222/Rn decay chain and/or its precursors.

Comment: 219 [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available Japanese medaka Oryzias latipes Oryzias_latipes_L.png 219.png Taxonomy icon (c) Database Center for Life Sci...ence licensed under CC Attribution2.1 Japan アイコン:メダカ HNI-Ⅱ系統バージョン bando 2010/02/15 15:31:07 2010/02/16 09:53:27 ...

43 CFR 2.19 - When will bureaus waive fees?

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false When will bureaus waive fees? 2.19 Section... OF INFORMATION ACT Requests for Records under the FOIA § 2.19 When will bureaus waive fees? (a) Fees... section and appendix D to this part. The burden is on you to justify entitlement to a fee waiver. Requests...

36 CFR 219.1 - Purpose.

Science.gov (United States)

2010-07-01

... System Land and Resource Management Planning Purpose and Principles § 219.1 Purpose. (a) Land and... management of these lands. (3) Sustainability, composed of interdependent ecological, social, and economic elements, embodies the principles of multiple-use and sustained-yield without impairment to the...

48 CFR 2452.219-70 - Small business subcontracting plan compliance.

Science.gov (United States)

2010-10-01

... of Provisions and Clauses 2452.219-70 Small business subcontracting plan compliance. As prescribed in 2419.708(d), insert the following provision: Small Business Subcontracting Plan Compliance (FEB 2006... the clause at FAR 52.219-9, Small Business Subcontracting Plan. (c) The government will consider...

25 CFR 166.219 - How do I acquire a permit through negotiation?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false How do I acquire a permit through negotiation? 166.219 Section 166.219 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GRAZING PERMITS Permit Requirements Obtaining A Permit § 166.219 How do I acquire a permit through negotiation? (a) Permits may be negotiated and granted by th...

48 CFR 219.800 - General.

Science.gov (United States)

2010-10-01

... (Acquisition, Technology, and Logistics) its authority under paragraph 8(a)(1)(A) of the Small Business Act (15... DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.800 General. (a) By Partnership Agreement (PA) between the Small Business...

A novel zinc finger protein 219-like (ZNF219L) is involved in the regulation of collagen type 2 alpha 1a (col2a1a) gene expression in zebrafish notochord.

Science.gov (United States)

Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Hung, Chin-Chun; Liao, Wei-Hao; Hwang, Pung-Pung; Han, Yu-San; Huang, Chang-Jen

2013-01-01

The notochord is required for body plan patterning in vertebrates, and defects in notochord development during embryogenesis can lead to diseases affecting the adult. It is therefore important to elucidate the gene regulatory mechanism underlying notochord formation. In this study, we cloned the zebrafish zinc finger 219-like (ZNF219L) based on mammalian ZNF219, which contains nine C2H2-type zinc finger domains. Through whole-mount in situ hybridization, we found that znf219L mRNA is mainly expressed in the zebrafish midbrain-hindbrain boundary, hindbrain, and notochord during development. The znf219L morpholino knockdown caused partial abnormal notochord phenotype and reduced expression of endogenous col2a1a in the notochord specifically. In addition, ZNF219L could recognize binding sites with GGGGG motifs and trigger augmented activity of the col2a1a promoter in a luciferase assay. Furthermore, in vitro binding experiments revealed that ZNF219L recognizes the GGGGG motifs in the promoter region of the zebrafish col2a1a gene through its sixth and ninth zinc finger domains. Taken together, our results reveal that ZNF219L is involved in regulating the expression of col2a1a in zebrafish notochord specifically.

49 CFR 219.701 - Standards for drug and alcohol testing.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Standards for drug and alcohol testing. 219.701... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Drug and Alcohol Testing Procedures § 219.701 Standards for drug and alcohol testing. (a) Drug testing required or authorized by subparts B...

20 CFR 219.30 - When evidence of marriage is required.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of marriage is required. 219.30... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.30 When evidence of marriage is required. (a) When an application is filed for benefits. Documentary evidence of marriage is required when an...

20 CFR 219.33 - Evidence of a deemed valid marriage.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a deemed valid marriage. 219.33... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.33 Evidence of a deemed valid marriage. (a) Preferred evidence. Preferred evidence of a deemed valid marriage is— (1) Evidence of a ceremonial marriage...

20 CFR 219.32 - Evidence of a common-law marriage.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes that...

36 CFR 219.36 - Definitions.

Science.gov (United States)

2010-07-01

... Forest System Land and Resource Management Planning Definitions § 219.36 Definitions. Definitions of the... vision for a specific area of land or type of land within the plan area. Statements of desired conditions... species of plants or animals which are not indigenous to an area but valued for their contribution to...

49 CFR 219.5 - Definitions.

Science.gov (United States)

2010-10-01

... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.5 Definitions. As used in this part— Accident or... alcohol) that has known mind- or function-altering effects on a human subject, specifically including any... ownership or control of the railroad and not operated or staffed by a salaried officer or employee of the...

48 CFR 252.219-7004 - Small business subcontracting plan (test program).

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7004 Small business subcontracting plan (test program). As prescribed in 219.708(b)(1)(B), use the following clause: Small Business...

40 CFR 80.219 - Designation and downstream requirements for GPA gasoline.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Designation and downstream requirements for GPA gasoline. 80.219 Section 80.219 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... sold or dispensed for use in motor vehicles at a retail outlet or wholesale purchaser-consumer facility...

20 CFR 219.42 - When evidence of child's dependency is required.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of child's dependency is required. 219.42 Section 219.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... child's dependency is required. Evidence of a child's dependency on the employee is required when— (a...

48 CFR 1552.219-71 - Procedures for Participation in the EPA Mentor-Protege Program.

Science.gov (United States)

2010-10-01

... Participation in the EPA Mentor-Protege Program. 1552.219-71 Section 1552.219-71 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.219-71 Procedures for Participation in the EPA Mentor-Protege... EPA Mentor-Protege Program (OCT 2000) (a) This provision sets forth the procedures for participation...

12 CFR 219.6 - Payment procedures.

Science.gov (United States)

2010-01-01

... obtain payment of costs incurred prior to the time the financial institution receives this notice. [Reg... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.6 Payment procedures. (a) Notice...

36 CFR 219.20 - Ecological sustainability.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Ecological sustainability... Sustainability § 219.20 Ecological sustainability. To achieve ecological sustainability, the responsible official... diversity and species diversity are components of ecological sustainability. The planning process must...

27 CFR 28.219 - Return of wine withdrawn for export with benefit of drawback.

Science.gov (United States)

2010-04-01

... Exportation of Wine With Benefit of Drawback § 28.219 Return of wine withdrawn for export with benefit of... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Return of wine withdrawn for export with benefit of drawback. 28.219 Section 28.219 Alcohol, Tobacco Products and Firearms...

48 CFR 219.702 - Statutory requirements.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 219.702 Statutory requirements. (1) Section 834 of Public Law 101-189, as amended (15 U.S.C. 637... on a corporate, division, or plant-wide basis will reduce administrative burdens while enhancing...

Morphological differentiation of Streptomyces viridochromogenes E-219 on solid culture

International Nuclear Information System (INIS)

Liang Xinle; Zhu Jing; Jin Yingyan

2012-01-01

The Streptomyces viridochromogenes E-219 was derived from Streptomyces viridochromogenes CGMCC4.1119 treated with 60 Co γ-rays irradiation and protoplast fusion. With the help of fluorescent probes, fluorescence microscope and electron microscopy, the morphology and development of E-219 on solid surface culture were investigated in this study. The effect of agarslant culture time on the production of Avilamycin was also studied to provide theoretical basis for industrial fermentation of selecting the appropriate seed to culture on the agarslant culture medium. The results implied that the development of colonies of Streptomyces viridochromogenes accompanied the intermittent hyhae apoptosis, and the production of spores was from the active mycelium. The colonial morphology of strain E-219 was significantly different from the original strain CGMCC4h1119. There were variegated hyphae formation in the stage of spore germination and initial hyphae development (10 h) with the live and dead segments alternated in a highly regular fashion within the same hypha. After the early single colony formation, the third phase was followed by profuse growth of the live segments derived from the variegated hypha, then the second apoptosis of the mycelia (48 h) was occurred with another quick growth, and sporulation was occurred at 96 h. Strain CGMCC4.1119 had spiral sporotrichial and round conidiophores with spike, whereas strain E-219 had linear sporotrichial, smooth and dylindrical conidiophore. The results of shake flask experiments indicated that the spores of E-219 had that highest activity when cultured on agarslant culture medium and incubated for 106 h with the production of avilamycin up to 1200 mg/L. (authors)

48 CFR 752.219-8 - Utilization of small business concerns and small disadvantaged business concerns.

Science.gov (United States)

2010-10-01

... business concerns and small disadvantaged business concerns. 752.219-8 Section 752.219-8 Federal... AND CONTRACT CLAUSES Texts of Provisions and Clauses 752.219-8 Utilization of small business concerns and small disadvantaged business concerns. The Foreign Assistance Act calls for USAID to give small...

48 CFR 219.7104 - Developmental assistance costs eligible for reimbursement or credit.

Science.gov (United States)

2010-10-01

... costs eligible for reimbursement or credit. 219.7104 Section 219.7104 Federal Acquisition Regulations... reimbursement or credit. (a) Developmental assistance provided under an approved mentor-protege agreement is... eligible for reimbursement are set forth in appendix I. (b) Before incurring any costs under the Program...

48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts).

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan (DoD contracts). As prescribed in 219.708(b)(1)(A), use the following clause: Small Business...

36 CFR 219.18 - Role of advisory committees.

Science.gov (United States)

2010-07-01

... PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for... variety of public purposes, particularly those groups organized to develop landscape goals (§ 219.12(b...

48 CFR 1052.219-73 - Department of the Treasury Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... Mentor-Protégé Program. 1052.219-73 Section 1052.219-73 Federal Acquisition Regulations System... and Clauses 1052.219-73 Department of the Treasury Mentor-Protégé Program. As described in DTAR 1019.202-70, insert the following provision: Department of the Treasury Mentor-Protégé Program (JAN 2000...

49 CFR 219.800 - Annual reports.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Annual Report § 219.800 Annual reports. (a) Each... also use the electronic version of the MIS form provided by the DOT. The Administrator may designate... submission to FRA. For information on where to submit MIS forms and for the electronic version of the form...

20 CFR 219.50 - When evidence of “living with” is required.

Science.gov (United States)

2010-04-01

... with” is required. Evidence of “living with” (see part 222 of this chapter on Family Relationships) is... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of âliving withâ is required. 219.50 Section 219.50 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD...

12 CFR 219.5 - Conditions for payment.

Science.gov (United States)

2010-01-01

... financial records prior to the time the financial institution is notified of such event. (c) Itemized bill... FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.5 Conditions for...

Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source

Energy Technology Data Exchange (ETDEWEB)

Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology

2014-04-01

The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)

9 CFR 93.219 - Declaration for poultry.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Declaration for poultry. 93.219... AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS...

21 CFR 2.19 - Methods of analysis.

Science.gov (United States)

2010-04-01

... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ADMINISTRATIVE RULINGS AND DECISIONS General Provisions § 2.19 Methods of analysis. Where the method of analysis... issues of the “Journal of the Association of Official Analytical Chemists”), which are incorporated by...

Configurations and level structure of 219Rn

International Nuclear Information System (INIS)

Sheline, R.K.; Liang, C.F.; Paris, P.

1998-01-01

The level structure of 219 Rn has been studied using the alpha decay of 223 Ra and coincident gamma rays. While only modest changes are required in the level structure, and only above 342.8 keV, severe changes are required throughout the level scheme in the spin assigments. These changes allow the assignment of two sets of anomalous bands with K=5/2 ± and K=3/2 ± . The K=5/2 ± bands have configurations intermediate between the reflection asymmetric configuration and the g 9/2 shell model configuration, while the K=3/2 ± bands have configurations intermediate between the mixed reflection asymmetric configuration and the i 11/2 shell model configuration. Comparison of the systematics of 219 Rn with neighboring isotones, isobars, and isotopes shows clearly the collapse of the quadrupole-octupole-type configurations into the less degenerate shell model configurations. copyright 1998 The American Physical Society

48 CFR 53.219 - Small Business Programs.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Programs... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.219 Small Business Programs. (a) The following form may be used in reporting small disadvantaged business contracting data: OF 312 (10/00), Small...

12 CFR 219.23 - Recordkeeping and reporting requirements.

Science.gov (United States)

2010-01-01

... Funds § 219.23 Recordkeeping and reporting requirements. (a) Domestic and international funds transfers... recordkeeping and reporting requirements for domestic and international funds transfers by insured depository... usefulness in criminal, tax, or regulatory investigations or proceedings. These regulations are codified at...

MicroRNA-219-5p Promotes Tumor Growth and Metastasis of Hepatocellular Carcinoma by Regulating Cadherin 1

Directory of Open Access Journals (Sweden)

Jing Yang

2018-01-01

Full Text Available MicroRNAs play significant roles in the development of cancer and may serve as promising therapeutic targets. In our previous work, miR-219-5p was identified as one of the important metastasis-related microRNAs in HCC. Here we demonstrated that miR-219-5p expression was elevated in HCC tissues and was associated with vascular invasion and dismal prognosis. In multivariate analysis, miR-219-5p was identified as an independent prognostic indicator for HCC patients. Functional mechanism analyses showed that miR-219-5p promoted HCC cell proliferation and invasion in in vitro, as well as in vivo, tumor growth and metastasis in nude mice models bearing human HCC tumors. In addition, cadherin 1 (CDH1 was revealed to be a downstream target of miR-219-5p in HCC cells. In conclusion, miR-219-5p promotes tumor growth and metastasis of HCC by regulating CDH1 and can serve as a prognostic marker for HCC patients.

25 CFR 2.19 - Action by Area Directors and Education Programs officials on appeal.

Science.gov (United States)

2010-04-01

... Programs officials on appeal. (a) Area Directors, Area Education Programs Administrators, Agency... 25 Indians 1 2010-04-01 2010-04-01 false Action by Area Directors and Education Programs officials on appeal. 2.19 Section 2.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROCEDURES...

The TLX-miR-219 cascade regulates neural stem cell proliferation in neurodevelopment and schizophrenia iPSC model.

Science.gov (United States)

Murai, Kiyohito; Sun, Guoqiang; Ye, Peng; Tian, E; Yang, Su; Cui, Qi; Sun, Guihua; Trinh, Daniel; Sun, Olivia; Hong, Teresa; Wen, Zhexing; Kalkum, Markus; Riggs, Arthur D; Song, Hongjun; Ming, Guo-li; Shi, Yanhong

2016-03-11

Dysregulated expression of miR-219, a brain-specific microRNA, has been observed in neurodevelopmental disorders, such as schizophrenia (SCZ). However, its role in normal mammalian neural stem cells (NSCs) and in SCZ pathogenesis remains unknown. We show here that the nuclear receptor TLX, an essential regulator of NSC proliferation and self-renewal, inhibits miR-219 processing. miR-219 suppresses mouse NSC proliferation downstream of TLX. Moreover, we demonstrate upregulation of miR-219 and downregulation of TLX expression in NSCs derived from SCZ patient iPSCs and DISC1-mutant isogenic iPSCs. SCZ NSCs exhibit reduced cell proliferation. Overexpression of TLX or inhibition of miR-219 action rescues the proliferative defect in SCZ NSCs. Therefore, this study uncovers an important role for TLX and miR-219 in both normal neurodevelopment and in SCZ patient iPSC-derived NSCs. Moreover, this study reveals an unexpected role for TLX in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.

48 CFR 52.219-2 - Equal Low Bids.

Science.gov (United States)

2010-10-01

.... If the bidder is awarded a contract as a result of receiving priority consideration under this... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.219-2 Equal...) amount to more than 50 percent of the contract price. (c) Failure to identify the labor surplus areas as...

Code Assessment of SPACE 2.19 using LSTF Steam Generator Tube Rupture Test

Energy Technology Data Exchange (ETDEWEB)

Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)

2016-10-15

The SPACE is a best estimated two-phase three-field thermal-hydraulic analysis code used to analyze the safety and performance of pressurized water reactors. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. The present work is on the line of expanding the work by Kim et al. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run LSTF SB-SG-06 experiment simulating a Steam Generator Tube Rupture (SGTR) transient. In order to identify the predictability of SPACE 2.19, the LSTF steam generator tube rupture test was simulated. To evaluate the computed results, LSTF SB-SG-06 test data simulating the SGTR and the RELAP5/ MOD3.1 are used. The calculation results indicate that the SPACE 2.19 code predicted well the sequence of events and the major phenomena during the transient, such as the asymmetric loop behavior, reactor coolant system cooldown and heat transfer by natural circulation, the primary and secondary system depressurization by the pressurizer auxiliary spray and the steam dump using the intact loop steam generator relief valve.

48 CFR 852.219-72 - Evaluation factor for participation in the VA mentor-protégé program.

Science.gov (United States)

2010-10-01

... participation in the VA mentor-protégé program. 852.219-72 Section 852.219-72 Federal Acquisition Regulations... Texts of Provisions and Clauses 852.219-72 Evaluation factor for participation in the VA mentor-protégé... the VA Mentor-Protégé Program (DEC2009) This solicitation contains an evaluation factor or sub-factor...

33 CFR 135.219 - Notification of changes affecting certification.

Science.gov (United States)

2010-07-01

... SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.219 Notification of changes affecting... Fund Administrator in writing when any changes occur which prevent the owner, operator, or guarantor...

25 CFR 39.219 - What happens if a residential program does not maintain residency levels required by this subpart?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false What happens if a residential program does not maintain residency levels required by this subpart? 39.219 Section 39.219 Indians BUREAU OF INDIAN AFFAIRS..., Student Counts, and Verifications Residential Programs § 39.219 What happens if a residential program does...

20 CFR 725.219 - Duration of entitlement; child.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Duration of entitlement; child. 725.219... of entitlement; child. (a) An individual is entitled to benefits as a child for each month beginning... month in which any one of the following events first occurs: (1) The child dies; (2) The child marries...

MicroRNA-219-2-3p functions as a tumor suppressor in gastric cancer and is regulated by DNA methylation.

Directory of Open Access Journals (Sweden)

Huizi Lei

Full Text Available BACKGROUND AIMS: Gastric cancer is the most frequent gastrointestinal tumor in adults and is the most lethal form of human cancer. Despite of the improvements in treatments, the underlying mechanism of gastric carcinogenesis is not well known. To define novel modulators that regulate susceptibility to tumorgenesis, we focused on miR-219-2-3p. METHODS: Quantitative RT-PCR was employed to investigate the level of miR-219-2-3p in gastric cancer (GC tissues (n = 113 and their matched adjacent normal tissues (n = 113. In vitro cell proliferation, apoptosis assays, cell migration, and invasion assays were performed to elucidate biological effects of miR-219-2-3p. Since silencing of miRNA by promoter CpG island methylation may be an important mechanism in tumorgenesis, GC cells were treated with 5-aza-2'-deoxycytidine and trichostatin A, and expression changes of miR-219-2-3p were subsequently examined by quantitative RT-PCR. Finally, the methylation status of CpG island upstream of miR-219-2-3p was analyzed by methylation-specific PCR in GC tissues (n = 22. RESULTS: miR-219-2-3p was down-regulated in GC and cell lines. In addition, the experiments documented the lower expression of miR-219-2-3p in GC specimens with higher grade and later stage tumors. Meanwhile, miR-219-2-3p exerted antiproliferative, proapoptotic, and antimetastatic roles and reduced levels of p-ERK1/2 in GC cells. Furthermore, 5-aza-2'-deoxycytidine and trichostatin A increased the expression (~2 fold of miR-219-2-3p in GC cells. By methylation-specific PCR, DNA methylation in the upstream region of miR-219-2-3p was detected in both adjacent normal tissues and cancer tissues. As expected, the methylation level was considerably higher in the miR-219-2-3p down-regulated group than up-regulated group. CONCLUSIONS: miR-219-2-3p is potentially involved in gastric cancer progression and metastasis by regulating ERK1/2-related signal pathways, which may provide a novel therapeutic strategy

Hypothalamic miR-219 regulates individual metabolic differences in response to diet-induced weight cycling

Directory of Open Access Journals (Sweden)

Mariana Schroeder

2018-03-01

Full Text Available Consumption of a low calorie diet is the most common approach to lose weight. While generally effective at first, it is frequently followed by a relapse where the pre-diet weight is regained, and often exceeded. This pattern of repeated weight loss/regain is referred to as weight cycling and the resulting metabolic response varies greatly between individuals. Objective: We attempted to address the issue of individual differences in the response to weight cycling in male mice. Methods: We first exposed adult wild type mice to repeated cycles of high/low fat food. Next, using a lentiviral approach, we knocked-down or over-expressed miR-219 in the ventromedial hypothalamus (VMH of an additional mouse cohort and performed a full metabolic assessment. Results: Exposure of wild type males to weight cycling resulted in the division of the cohort into subsets of resistant versus metabolic-syndrome-prone (MS animals, which differed in their metabolic profile and hypothalamic miR-219 levels. Lentiviral knock-down of miR-219 in the VMH led to exacerbation of metabolic syndrome. In contrast, over-expression of miR-219 resulted in moderation of the metabolic syndrome phenotype. Conclusions: Our results suggest a role for miR-219 in the mediation of the metabolic phenotype resulting from repeated weight cycling. Keywords: Weight cycling, Metabolic syndrome, miRNAs, Ventromedial hypothalamus, High fat diet, Diabetes

48 CFR 52.219-19 - Small Business Concern Representation for the Small Business Competitiveness Demonstration Program.

Science.gov (United States)

2010-10-01

... Representation for the Small Business Competitiveness Demonstration Program. 52.219-19 Section 52.219-19 Federal... Representation for the Small Business Competitiveness Demonstration Program. As prescribed in 19.1008(a), insert the following provision: Small Business Concern Representation for the Small Business Competitiveness...

36 CFR 219.4 - Identification and consideration of issues.

Science.gov (United States)

2010-07-01

... capabilities and available resources, including current and likely Forest Service budgets; (iv) The scientific... restore ecological conditions that are similar to the biological and physical range of expected variability (§ 219.20(b)(1)); and (vii) Opportunities to contribute to knowledge about and preservation of...

20 CFR 219.35 - Evidence that a marriage has ended.

Science.gov (United States)

2010-04-01

... divorce or annulment; or (2) Evidence of the death (See § 219.23) of a party to the marriage. (b) Other..., the claimant must explain the reason therefor and submit other convincing evidence that the marriage...

Conceptual design report, 219-S secondary containment upgrade, Project W-178

International Nuclear Information System (INIS)

Beyer, J.J.

1993-05-01

The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000

26 CFR 1.219-2 - Definition of active participant.

Science.gov (United States)

2010-04-01

... individuals whose compensation exceeds a certain amount accrue benefits under the plan. An individual whose... participant. However, any benefit that may vary with future compensation of an individual provides additional... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of active participant. 1.219-2...

48 CFR 952.219-70 - DOE Mentor-Protege program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false DOE Mentor-Protege program... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.219-70 DOE Mentor.... DOE Mentor-Protege Program (MAY 2000) The Department of Energy has established a Mentor-Protege...

48 CFR 52.219-9 - Small business subcontracting plan.

Science.gov (United States)

2010-10-01

... Clauses 52.219-9 Small business subcontracting plan. As prescribed in 19.708(b), insert the following clause: Small Business Subcontracting Plan (OCT 2010) (a) This clause does not apply to small business... business, and women-owned small business concerns. If the offeror is submitting an individual contract plan...

Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators

Science.gov (United States)

Wolszczak, W.; Dorenbos, P.

2017-06-01

Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.

48 CFR 1852.219-79 - Mentor requirements and evaluation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor requirements and... and Clauses 1852.219-79 Mentor requirements and evaluation. As prescribed in 1819.7215, insert the following clause: Mentor Requirements and Evaluation (MAY 2009) (a) The purpose of the NASA Mentor-Protégé...

41 CFR 302-3.219 - Is there a limit on how many times I may receive reimbursement for tour renewal travel?

Science.gov (United States)

2010-07-01

... many times I may receive reimbursement for tour renewal travel? 302-3.219 Section 302-3.219 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RELOCATION....219 Is there a limit on how many times I may receive reimbursement for tour renewal travel? (a) If you...

38 CFR 21.219 - Supplies consisting of clothing, magazines and periodicals, and items which may be personally...

Science.gov (United States)

2010-07-01

... clothing, magazines and periodicals, and items which may be personally used by the veteran. 21.219 Section....219 Supplies consisting of clothing, magazines and periodicals, and items which may be personally used... will be supplied. (b) Furnishing magazines and periodicals. Appropriate past issues of magazines...

48 CFR 52.219-1 - Small Business Program Representations.

Science.gov (United States)

2010-10-01

... section 8(a), 8(d), 9, or 15 of the Small Business Act or any other provision of Federal law that... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Program....219-1 Small Business Program Representations. As prescribed in 19.308(a)(1), insert the following...

48 CFR 552.219-76 - Mentor Requirements and Evaluation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and....219-76 Mentor Requirements and Evaluation. As prescribed in 519.7017(b), insert the following clause: Mentor Requirements and Evaluation (SEP 2009) (a) The purpose of the GSA Mentor-Protégé Program is for a...

48 CFR 752.219-71 - Mentor requirements and evaluation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor requirements and....219-71 Mentor requirements and evaluation. As prescribed in AIDAR 719.273-11(b), insert the following clause: Mentor Requirements and Evaluation (July 13, 2007) (a) Mentor and Protégé firms shall submit an...

5 CFR 591.219 - How does OPM compute shelter price indexes?

Science.gov (United States)

2010-01-01

... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.219 How does OPM compute shelter price indexes? (a) In addition to rental...

Code Assessment of SPACE 2.19 using LSTF 10% Main Steam-Line-Break Test

Energy Technology Data Exchange (ETDEWEB)

Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)

2016-10-15

The Safety and Performance Analysis Code for Nuclear Power Plants (SPACE) has been developed in recent years by the Korea Hydro and Nuclear Power Co. through collaborative works with other Korean nuclear industries and research institutes. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run SBSL- 01 for a 10% main steam line break transient in a pressurized water reactor. The LSTF 10% main steam line break test were simulated using the SPACE 2.19 for code V and V work. The overall comparisons between the SPACE 2.19 code prediction and the LSTF Test Run SB-SL-01 experimental data are reasonably satisfactory. The comparisons were conducted in terms of the variations of mass flow rate, void fraction, pressure, collapsed liquid level, temperature, and system flow rate for the transient. In addition, the input model was modified for simulation accuracy of PZR pressure based on the calculated results. The correction of PORV setpoint affects to simulate the PORV open and close phenomena similarly with experiments. From the modification, the computed results show a reasonable agreement with experimental data in overall transient time.

36 CFR 219.11 - Monitoring and evaluation for adaptive management.

Science.gov (United States)

2010-07-01

... OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.11 Monitoring and evaluation for adaptive management. (a) Plan monitoring strategy... national, regional, and local supply and demand for products, services, and values. Special consideration...

Synthesis, radiochemistry and biological evaluation of a new somatostatin analogue (SDZ 219-387) labelled with technetium-99m

International Nuclear Information System (INIS)

Maina, T.; Stolz, B.; Albert, R.; Bruns, C.; Koch, P.; Maecke, H.

1994-01-01

A new derivative of octreotide SDZ 219-387 [PnAO-(D)Phe 1 -octreotide] was synthesized, which binds specifically and with high affinity to somatostatin receptors in vitro (pK i =9.79±0.16). This new somatostatin analogue chelates technetium-99m under mild labelling conditions in good yields. The resulting [ 99m Tc]SDZ 219-387 was stable up to 6 h after labelling and could be isolated in a pure radiochemical and chemical form by high-perfomance liquid chromatographic purification. The intravenous administration of purified [ 99m Tc]SDZ 219-387 revealed that the radioligand was rapidly cleared from circulation, and tumour uptake of 0.38% ID/g was observed at 1.5 h post injection. [ 99m Tc]SDZ 219-387 specifically interacted with somatostatin binding sites on the tumour. However, the radioligand is highly lipophilic and excreted mainly through the hepatobiliary system. As a consequence, [ 99m Tc]SDZ 219-387 exhibits increased background activity and therefore is not appropriate for the in vivo visualization of somatostatin receptor-positive tumours and/or their metastases in the abdomen. (orig.)

Marker-assisted introgression of broad-spectrum blast resistance genes into the cultivated MR219 rice variety.

Science.gov (United States)

Miah, Gous; Rafii, Mohd Y; Ismail, Mohd R; Puteh, Adam B; Rahim, Harun A; Latif, Mohammad A

2017-07-01

The rice cultivar MR219 is famous for its better yield and long and fine grain quality; however, it is susceptible to blast disease. The main objective of this study was to introgress blast resistance genes into MR219 through marker-assisted selection (MAS). The rice cultivar MR219 was used as the recurrent parent, and Pongsu Seribu 1 was used as the donor. Marker-assisted foreground selection was performed using RM6836 and RM8225 to identify plants possessing blast resistance genes. Seventy microsatellite markers were used to estimate recurrent parent genome (RPG) recovery. Our analysis led to the development of 13 improved blast resistant lines with Piz, Pi2 and Pi9 broad-spectrum blast resistance genes and an MR219 genetic background. The RPG recovery of the selected improved lines was up to 97.70% with an average value of 95.98%. Selected improved lines showed a resistance response against the most virulent blast pathogen pathotype, P7.2. The selected improved lines did not express any negative effect on agronomic traits in comparison with MR219. The research findings of this study will be a conducive approach for the application of different molecular techniques that may result in accelerating the development of new disease-resistant rice varieties, which in turn will match rising demand and food security worldwide. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

36 CFR 223.219 - Sustainable harvest of special forest products.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sustainable harvest of....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total...

The corrosion Characteristics and Behaviors of the Ti-2.19Al-2.35Zr alloy

International Nuclear Information System (INIS)

Kim, Tae Hoon; Kang, Chang Sun; Baek, Jong Hyuk; Kim, Hyun Gil; Choi, Byoung Kwon; Jeong, Yong Hwan

2007-01-01

Ti-2.19Al-2.35Zr alloy is being considered as a steam generator tube material for the advanced pressurized water reactor (PWR) which is being developed by KAERI for the purpose of seawater desalination as well as a small scale electricity production. The main operational environment of SMART differs somewhat from that of a commercial PWR. That is, a heat-exchange tube is always exposed to a high temperature/pressure condition and an ammonia water chemistry is designed as a pH controlling agent without an addition of boric acid. The excellent mechanical and corrosion resistance properties are required for the steam generator tube material in SMART. Thus Ti-2.19Al-2.35Zr alloy was studied to investigate of the corrosion characteristics and behaviors of the Ti- 2.19Al-2.35Zr alloy in a simulated-SMART loop

Influence of APOE and RNF219 on Behavioral and Cognitive Features of Female Patients Affected by Mild Cognitive Impairment or Alzheimer’s Disease

Directory of Open Access Journals (Sweden)

Alessandra Mosca

2018-04-01

Full Text Available The risk for Alzheimer’s disease (AD is associated with the presence of the 4 allele of Apolipoprotein E (APOE gene and, recently, with a novel genetic variant of the RNF219 gene. This study aimed at evaluating interactions between APOE-4 and RNF219/G variants in the modulation of behavioral and cognitive features of two cohorts of patients suffering from mild cognitive impairment (MCI or AD. We enrolled a total of 173 female MCI or AD patients (83 MCI; 90 AD. Subjects were screened with a comprehensive set of neuropsychological evaluations and genotyped for the APOE and RNF219 polymorphic variants. Analysis of covariance was performed to assess the main and interaction effects of APOE and RNF219 genotypes on the cognitive and behavioral scores. The analysis revealed that the simultaneous presence of APOE-4 and RNF219/G variants results in significant effects on specific neuropsychiatric scores in MCI and AD patients. In MCI patients, RNF219 and APOE variants worked together to impact the levels of anxiety negatively. Similarly, in AD patients, the RNF219 variants were found to be associated with increased anxiety levels. Our data indicate a novel synergistic activity APOE and RNF219 in the modulation of behavioral traits of female MCI and AD patients.

Estimating isotopic ratios, spatial distribution and inventory of radionuclides at Nuclear Sites 201, 219 and 221

International Nuclear Information System (INIS)

Gilbert, R.O.; Simpson, J.C.; Engel, D.W.; Kinnison, R.R.

1984-03-01

For NS201 the estimated average 239 240 Pu to 241 Am ratios for vegetation and soil are 7.3 and 11.5, respectively, where the 241 Am data were obtained using wet chemistry. The geometric mean 90 Sr to 137 Cs ratios for vegetation and soil at NS201 are estimated to be 1.1 and 1.9. These results suggest that the true (population) median 239 240 Pu to 241 Am and 90 Sr to 137 Cs ratios are smaller for vegetation than for soil at NS201. For NS219 and NS221 the estimated average 239 240 Pu to 241 Am ratios for surface soil at NS219 and NS221 are 2.8 and 0.78, respectively. There is an obvious statistical difference in the average 239 240 Pu to 241 Am ratios at these sites. The geometric mean 239 240 Pu to 241 Am ratios for vegetation samples at NS219 and NS221 are estimated to be 3.2 and 0.82, respectively. The data suggest there may be a difference in the 239 240 Pu to 241 Am ratios for soil and vegetation at NS219, but not at NS221. The geometric mean 90 Sr to 137 Cs ratio for surface soil at NS219 and NS221 combined is 0.93. The geometric mean 90 Sr to 137 Cs ratio for vegetation for the two sites (pooled data) is estimated to be 1.8. 43 references, 42 figures, 7 tables

222-S radioactive liquid waste line replacement and 219-S secondary containment upgrade, Hanford Site, Richland, Washington

International Nuclear Information System (INIS)

1995-01-01

The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission

18 CFR 367.2190 - Account 219, Accumulated other comprehensive income.

Science.gov (United States)

2010-04-01

... COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2190 Account 219...

48 CFR 52.219-8 - Utilization of small business concerns.

Science.gov (United States)

2010-10-01

... management and daily business operations of which are controlled by one or more veterans. Women-owned small... Clauses 52.219-8 Utilization of small business concerns. As prescribed in 19.708(a), insert the following clause: Utilization of Small Business Concerns (MAY 2004) (a) It is the policy of the United States that...

50 CFR 216.219 - Renewal and modifications of Letters of Authorization.

Science.gov (United States)

2010-10-01

... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.219 Renewal and modifications of Letters of Authorization. (a) A Letter of...

20 CFR 219.31 - Evidence of a valid ceremonial marriage.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a valid ceremonial marriage. 219... marriage. (a) Preferred evidence. Preferred evidence of a ceremonial marriage is— (1) A copy of the public record of the marriage, certified by the custodian of the record or by a Board employee; (2) A copy of a...

The diagnosis and molecular analysis of a novel 21.9kb deletion (Qinzhou type deletion) causing α+ thalassemia.

Science.gov (United States)

Long, Ju; Yan, Shanhuo; Lao, Kegan; Pang, Wanrong; Ye, Xuehe; Sun, Lei

2014-04-01

α-Thalassemia is a common single-gene genetic disease that can cause Hb Bart's hydrops fetalis and Hb H disease in tropical and subtropical regions. When examining conventional thalassemia genes, an only detected --(SEA) genotype sample needs further analysis. In doing so, we found a novel 21.9kb deletion (Qinzhou type deletion). The deletion position of the novel 21.9kb deletion is from 14373bp to 36299bp of the α-globin gene cluster (NG_000006.1); thus, there exists a 21927bp sequence deletion, into which a 29bp sequence is added. After sequence analysis, a group of Gap-PCR primers were synthesized to diagnose this novel thalassemia genotype. Through pedigree analysis, we deduced that the propositus obtained the novel alleles from her mother. The genotype of this propositus is --(SEA)/-α(21.9) and its phenotype conforms to the characteristics of Hb H disease, establishing that the combination between -α(21.9) genotype and α(0) genotype can lead to Hb H disease. By molecular analysis, we established that this case fits the characteristic of an α(+) thalassemia genotype. © 2013.

48 CFR 1852.219-74 - Use of rural area small businesses.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Use of rural area small... and Clauses 1852.219-74 Use of rural area small businesses. As prescribed in 1819.7103, insert the following clause: Use of Rural Area Small Business (SEP 1990) (a) Definitions. Rural area means any county...

48 CFR 3052.219-72 - Evaluation of prime contractor participation in the DHS mentor-protégé program.

Science.gov (United States)

2010-10-01

... contractor participation in the DHS mentor-protégé program. 3052.219-72 Section 3052.219-72 Federal... Evaluation of prime contractor participation in the DHS mentor-protégé program. As prescribed in (HSAR) 48... the DHS Mentor-Protégé Program (JUN 2006) This solicitation contains a source selection factor or...

Long non-coding RNA TUG1 promotes progression of oral squamous cell carcinoma through upregulating FMNL2 by sponging miR-219.

Science.gov (United States)

Yan, Guangqi; Wang, Xue; Yang, Mingliang; Lu, Li; Zhou, Qing

2017-01-01

Oral squamous cell carcinoma (OSCC) is a prevalent oral disease with a high morbidity and mortality rate. Several long non-coding RNAs (lncRNAs) were identified as important regulators of carcinogenesis. However, the pathogenic implications of TUG1 in OSCC are still unclear. In the present study, the expression of TUG1 was increased in OSCC cells. Knockdown of TUG1 inhibited cell proliferation, migration, and invasion, and induced cell cycle arrest at G0/G1 phase, whereas overexpression of TUG1 exerted the opposite effect on OSCC cells. A reciprocal repressive interaction between TUG1 and miR-219 was found, and miR-219 inhibition abolished the tumor-suppressive effect of TUG1 knockdown on cell growth and motility. Furthermore, bioinformatics analysis and luciferase reporter assay showed that FMNL2 was a direct target of miR-219. Restoration of FMNL2 abrogated the miR-219-induced inhibition of cell proliferation, cell cycle progression, migration, and invasion. Besides, overexpression of TUG1 promoted tumor growth and metastasis in vivo . Clinically, the expression of TUG1 and FMNL2 were increased, but miR-219 was decreased in primary tumors compared to non-tumor tissues. Both the upregulated TUG1, and FMNL2 and the downregulated miR-219 was associated with advanced stage of OSCC and poor overall survival. Notably, multivariate analyses confirmed that FMNL2 was an independent risk factor for OSCC. In conclusion, our data revealed that TUG1 confers oncogenic function in OSCC and TUG1/miR-219/FMNL2 axis may be a novel therapeutic strategy in this disease.

48 CFR 653.219-71 - DOS form DS-4053, Department of State Mentor-Protégé Program Application.

Science.gov (United States)

2010-10-01

..., Department of State Mentor-Protégé Program Application. 653.219-71 Section 653.219-71 Federal Acquisition...-4053, Department of State Mentor-Protégé Program Application. As prescribed in 619.102-70(i), DS-4053 is prescribed for use in applying for an agreement under the Department of State Mentor-Protégé...

Introgression of Blast Resistance Genes (Putative Pi-b and Pi-kh) into Elite Rice Cultivar MR219 through Marker-Assisted Selection

Science.gov (United States)

Tanweer, Fatah A.; Rafii, Mohd Y.; Sijam, Kamaruzaman; Rahim, Harun A.; Ahmed, Fahim; Ashkani, Sadegh; Latif, Mohammad A.

2015-01-01

Blast is the most common biotic stress leading to the reduction of rice yield in many rice-growing areas of the world, including Malaysia. Improvement of blast resistance of rice varieties cultivated in blast endemic areas is one of the most important objectives of rice breeding programs. In this study, the marker-assisted backcrossing strategy was applied to improve the blast resistance of the most popular Malaysian rice variety MR219 by introgressing blast resistance genes from the Pongsu Seribu 2 variety. Two blast resistance genes, Pi-b and Pi-kh, were pyramided into MR219. Foreground selection coupled with stringent phenotypic selection identified 15 plants homozygous for the Pi-b and Pi-kh genes, and background selection revealed more than 95% genome recovery of MR219 in advanced blast resistant lines. Phenotypic screening against blast disease indicated that advanced homozygous blast resistant lines were strongly resistant against pathotype P7.2 in the blast disease endemic areas. The morphological, yield, grain quality, and yield-contributing characteristics were significantly similar to those of MR219. The newly developed blast resistant improved lines will retain the high adoptability of MR219 by farmers. The present results will also play an important role in sustaining the rice production of Malaysia. PMID:26734013

48 CFR 852.219-9 - VA Small business subcontracting plan minimum requirements.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Small business... Provisions and Clauses 852.219-9 VA Small business subcontracting plan minimum requirements. As prescribed in subpart 819.709, insert the following clause: VA Small Business Subcontracting Plan Minimum Requirements...

I219V polymorphism in hMLH1 gene in patients affected with ulcerative colitis.

Science.gov (United States)

Vietri, Maria Teresa; Riegler, Gabriele; De Paola, Marialaura; Simeone, Serena; Boggia, Maria; Improta, Alessia; Parisi, Mariarita; Molinari, Anna Maria; Cioffi, Michele

2009-04-01

hMLH1 gene, lying on chromosome 3p21-23, is a key factor of the mismatch repair (MMR) complex, which amends DNA replication errors. MMR alterations are involved in the development of both hereditary and sporadic forms of colorectal carcinoma related to ulcerative colitis (UC). I219V Polymorphism is located on exon 8 of hMLH1 and provides an aminoacidic substitution of isoleucine to valine, on the protein codon 219. This may affect the speed and fidelity of protein synthesis because of a tRNA paucity or changes in the mRNA secondary structure. Most of the hereditary nonpolyposis colon cancer-associated missense mutations of hMLH1 cause structural changes of the amino- or carboxy-terminal regions, involving the domains that interact with ATP and hPMS2. In this study, we analyzed the hMLH1 I219V polymorphism frequency in colectomized patients with UC. Venous blood from 100 ulcerative patients and 97 apparently healthy subjects has been collected. Out of 100 patients affected with UC, 75 noncolectomized showed an alternating course of disease, while 25 did not respond to the common drugs, and underwent colectomy. Genotyping was performed by polymerase chain reaction and following enzymatic digestion by BccI. No significant differences were found between patients with UC and controls both for genotype and allele frequencies. However, our data show a significant association when colectomized and noncolectomized patients are compared. The frequencies of G homozygosity were 28% in colectomized and 10.7% in noncolectomized patients (p < 0.05, chi(2) = 4.4, Odds ratio = 3.3). The allele frequencies of allele A were 52% in colectomized and 68% in noncolectomized patients; while those of allele G were 48% and 32%, respectively. I219V polymorphism in hMLH1 could influence the clinical course of the disease and lead to resistance to therapy.

48 CFR 52.219-20 - Notice of Emerging Small Business Set-Aside.

Science.gov (United States)

2010-10-01

... Clauses 52.219-20 Notice of Emerging Small Business Set-Aside. As prescribed in 19.1008(b), insert the following provision: Notice of Emerging Small Business Set-Aside (JAN 1991) Offers or quotations under this acquisition are solicited from emerging small business concerns only. Offers that are not from an emerging...

48 CFR 52.219-7 - Notice of Partial Small Business Set-Aside.

Science.gov (United States)

2010-10-01

... Clauses 52.219-7 Notice of Partial Small Business Set-Aside. As prescribed in 19.508(d), insert the following clause: Notice of Partial Small Business Set-Aside (JUN 2003) (a) Definitions. Small business..., and qualified as a small business under the size standards in this solicitation. (b) General. (1) A...

48 CFR 52.219-6 - Notice of Total Small Business Set-Aside.

Science.gov (United States)

2010-10-01

... Clauses 52.219-6 Notice of Total Small Business Set-Aside. As prescribed in 19.508(c), insert the following clause: Notice of Total Small Business Set-Aside (JUN 2003) (a) Definition. Small business concern... qualified as a small business under the size standards in this solicitation. (b) General. (1) Offers are...

48 CFR 1852.219-77 - NASA Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA Mentor-ProtégÃ... and Clauses 1852.219-77 NASA Mentor-Protégé Program. As prescribed in 1819.7215, insert the following clause: NASA Mentor-Protégé Program (MAY 2009) (a) Prime contractors are encouraged to participate in the...

48 CFR 752.219-70 - USAID Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false USAID Mentor-ProtégÃ....219-70 USAID Mentor-Protégé Program. As prescribed in 719.273-11(a), insert the following provision: USAID Mentor-Protégé Program (July 13, 2007) (a) Large and small business are encouraged to participate...

48 CFR 552.219-75 - GSA Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false GSA Mentor-ProtégÃ....219-75 GSA Mentor-Protégé Program. As prescribed in 519.7017(a), insert the following clause: GSA Mentor-ProtéGé Program (SEP 2009) (a) Prime contractors, including small businesses, are encouraged to...

48 CFR 852.219-71 - VA mentor-protégé program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA mentor-protégÃ....219-71 VA mentor-protégé program. As prescribed in 819.7115(a), insert the following clause: VA Mentor-Protégé Program (DEC 2009) (a) Large businesses are encouraged to participate in the VA Mentor-Protégé...

48 CFR 3052.219-71 - DHS mentor-protégé program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false DHS mentor-protégÃ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.219-71 DHS mentor-protégé program. As prescribed in (HSAR) 48 CFR 3019.708-70(b), insert the following clause: DHS Mentor-Protégé Program (JUN 2006) (a...

48 CFR 352.219-71 - Mentor-protégé program reporting requirements.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Clauses 352.219-71 Mentor-protégé program reporting requirements. As prescribed in 319.270-1(b), the Contracting Officer shall insert the following clause: Mentor-Protégé Program Reporting Requirements (January...

Occurrence of rhyolytic tuffs at deep sea drilling project site 219 on the Laccadive Ridge

Digital Repository Service at National Institute of Oceanography (India)

Siddiquie, H.N.; Sukheswala, R.N.

A study of thin sections from the lower and middle parts of Unit 5 (Paleocene) from Site 219 shows that these largely consist of acidic or rhyolitic tuffs. The overlying limestones in Unit 5 (Paleocene) and Unit 4 (Lower Eocene) also contain...

48 CFR 652.219-72 - Department of State Mentor-Protégé Program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Department of State Mentor....219-72 Department of State Mentor-Protégé Program. As prescribed in 619.202-70(o)(1), insert the following provision: Department of State Mentor-Protégé Program (APR 2004) (a) Large and small businesses...

Evaluation of 3 Inch SN-219 Failure and S and SX Tank Farm Saltwell Piping

International Nuclear Information System (INIS)

ELSEN, J.J.

2000-01-01

Evaluation of direct buried piping currently in use or designated for future Saltwell pumping in S and SX Farms. Documented evaluation of failed S-103 saltwell pumping transfer line 3 inch SN-219. This evaluation is intended to reflect current status of Saltwell piping, when taken in context with referenced documents

29 CFR 779.219 - Unified operation may be achieved without common control or common ownership.

Science.gov (United States)

2010-07-01

... Act May Apply; Enterprise Coverage Unified Operation Or Common Control § 779.219 Unified operation may... through “unified operation.” It is clear from the definition that if the described activities are performed through unified operation they will be part of the enterprise whether they are performed by one...

Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

International Nuclear Information System (INIS)

Khazrouni, S.

1985-06-01

Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr

75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside

Science.gov (United States)

2010-05-10

... Small Business Set-Aside AGENCY: Defense Logistics Agency, DoD. ACTION: Notice. SUMMARY: This is to...) regarding partial small business set-asides for Defense Logistics Agency (DLA), Defense Energy Support..., DESC is requesting a class deviation from FAR Clause 52.219-7, Notice of Partial Small Business Set...

219-S CORROSION STUDY

International Nuclear Information System (INIS)

DIVINE, J.R.; PARSONS, G.L.

2008-01-01

A minor leak was detected in a drain line for Hood 2B located in the 222-S Laboratory. The line transfers radioactive waste, spent analytical standards, and chemicals used in various analytical procedures. Details are in the report provided by David Comstock, 2B NDE June 2008, work package LAB-WO-07-2012. Including the noted leak, the 222-S Laboratory has experienced two drain line leaks in approximately the last two years of operation. As a consequence, CH2M HILL Hanford Group, Inc. (CH2M HILL) requested the support of ChemMet, Ltd., PC (ChemMet) at the Hanford Site 222-S Laboratory. The corrosion expertise from ChemMet was required prior to preparation of a compatibility assessment for the 222-S Laboratory waste transfer system to assure the expected life of the piping system is extended as much as practicable. The system includes piping within the 222-S Laboratory and the 219-S Waste Storage and Transfer Facility and Operations Process. The ChemMet support was required for an assessment by 222-S staff to analyze what improvements to operational activities may be implemented to extend the tank/piping system life. This assessment will include a summary of the various material types, age, and locations throughout the facility. The assessment will also include a discussion of materials that are safe for drain line disposal on a regular basis, materials that are safe for disposal on a case-by-case basis including specific additional requirements such as flushing, neutralization to a specific pH, and materials prohibited from disposal. The assessment shall include adequate information for 222-S Laboratory personnel to make informed decisions in the future disposal of specific material types by discussing types of compatibility of system materials and potential wastes. The assessment is expected to contain some listing of acceptable waste materials but is not anticipated to be a complete or comprehensive list. Finally the assessment will encompass a brief discussion of

VizieR Online Data Catalog: K2-19b light curve (Armstrong+, 2015)

Science.gov (United States)

Armstrong, D. J.; Santerne, A.; Veras, D.; Barros, S. C. C.; Demangeon, O.; Lillo-Box, J.; McCormac, J.; Osborn, H. P.; Tsantaki, M.; Almenara, J.-M.; Barrado, D.; Boisse, I.; Bonomo, A. S.; Brown, D. J. A.; Bruno, G.; Rey Cerda, J.; Courcol, B.; Deleuil, M.; Diaz, R. F.; Doyle, A. P.; Hebrard, G.; Kirk, J.; Lam, K. W. F.; Pollacco, D. L.; Rajpurohit, A.; Spake, J.; Walker, S. R.

2015-08-01

The Near Infrared Transiting ExoplanetS (NITES) Telescope is a semi-robotic 0.4m (f/10) Meade LX200GPS Schmidt-Cassegrain telescope installed at the ORM, La Palma. One transit of K2-19b was observed on 2015 Feb 28. The telescope was defocused slightly to 3.3 FWHM and 814 images of 20s exposure time were obtained with 5s dead time between each. Observations were obtained without a filter. The table presents data taken with the NITES telescope shown in Figure 1 of the publication. (1 data file).

Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 104

International Nuclear Information System (INIS)

Ross, G.A.

1998-01-01

A sample of solids was obtained from tank 104 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprenel tubing (Phthalate free). The sample obtained in a glass jar with Teflon 2 lid, was analyzed for PCBs as Aroclor mixtures. A soxhlet extraction procedure was used to extract the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). The extraction method closely follows SW-846 method 3540C and the analysis follows SW-846 method

Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 101

International Nuclear Information System (INIS)

Diaz, L.A.

1998-01-01

One waste sample that was obtained with solids from tank 101 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprene tubing (Phthalate free) was obtained in a glass jar with teflon lid was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Results are presented

Investigation of the origin of elements of the uranium-235 family noticed in excess around the EL4 experimental nuclear reactor during its dismantling. Site of the Monts d'Arree - Brennilis (29) power plant. Years 2007-2008. Report and appendices with results

International Nuclear Information System (INIS)

2009-02-01

The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods

ECNJEFI. A JEFI based 219-group neutron cross-section library: User's manual

International Nuclear Information System (INIS)

Stad, R.C.L. van der; Gruppelaar, H.

1992-07-01

This manual describes the contents of the ECNJEF1 library. The ECNJEF1 library is a JEF1.1 based 219-group AMPX-Master library for reactor calculations with the AMPX/SCALE-system, e.g. the PASC-3 system as implemented at the Netherlands Energy Research Foundation in Petten, Netherlands. The group cross-section data were generated with NJOY and NPTXS/XLACS-2 from the AMPX system. The data on the ECNJEF1 library allows resolved-resonance treatment by NITAWL and/or unresolved resonance self-shielding by BONAMI. These codes are based upon the Nordheim and Bondarenko methods, respectively. (author). 10 refs., 7 tabs

Identification of Three Types of α-Thalassemia Deletion, -α21.9, -α2.4, and - -THAI, and Their Frequencies, in One Family in the Population of Southern Guangxi Zhuang Autonomous Region, People's Republic of China.

Science.gov (United States)

Pang, Wanrong; Long, Ju; Weng, Xunjin; Fan, Qiongying; Sun, Lei; Pan, Zhijian; Fan, Zuqian

2018-01-01

Different types of deletional α-thalassemia (α-thal) have been reported by researchers in China. This study describes one family carrying -α 21.9 (NG_000006.1: g.14373_36299delinsGGGAAGGGTGGGTGGGAATAACAGCTTTT), -α 2.4 (NG_000006.1: g.36860_39251del) and - - THAI (Thailand) (NG_000006.1: g.10664_44164del) alleles in Guangxi Zhuang Autonomous Region, People's Republic of China (PRC), and reports the frequencies of these types in the population of this region. The proband was a 4-year-old girl, who screened positive for thalassemia, although the thalassemia genotype results were normal when screened using the routine kits. Samples of the proband's parents were also collected to perform further analyses. Two real-time gap-polymerase chain reaction (gap-PCR) systems were designed for separate detection of - - THAI and screening for -α 21.9 and -α 2.4 . The genotype of the proband was -α 21.9 /-α 2.4 , and the two variants were inherited from her parents. In the frequency study, five - - THAI , four -α 21.9 and 11 -α 2.4 positive individuals were detected in the 3410 random samples. Thus, allele frequencies of -α 21.9 , - - THAI and -α 2.4 in the population of southern Guangxi were determined as 0.059, 0.073 and 0.161%, respectively. This is the first report of an individual carrying the -α 21.9 /-α 2.4 genotype, and the first report of the detection of -α 21.9 , -α 2.4 and - - THAI in a single family. The total frequency for these alleles was 0.293% in southern Guangxi, suggesting that the thalassemia clinical center in this region should utilize a screening kit that allows detection of these types of deletions for a more comprehensive evaluation of thalassemia risk.

Review on transactinium isotope build-up and decay in reactor fuel and related sensitivities to cross section changes and results and main conclusions of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data, held at Karlsruhe, November 1975

International Nuclear Information System (INIS)

Kuesters, H.; Lalovic, M.

1976-04-01

In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de

Project specific quality assurance plan for Project W-178, 219-S secondary containment

International Nuclear Information System (INIS)

Buckles, D.I.

1994-01-01

The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation

Characterization Problem (Troubleshooting) for IR219 Irradiator, JS10000 in Mintec-SINAGAMA: The Partnership

International Nuclear Information System (INIS)

Shahidan Yob; Nor Ishadi Ismail; Kamarudin Buyong

2015-01-01

Control of the fuel-efficient plant operations are key to gamma irradiation service in MINTec-Sinagama. Without an efficient operation, irradiation services will be disrupted and lead to customer product failed to be completed in a set time. Additionally, downtime each time operation is also important to monitor to ensure that the fuel-efficient plant exceeded 85% in each month. In this paper MINTec plant operations data collection-Sinagama made during the year 2011-2015. Analysis carried out against downtime, the extent of damage and the action according to the classification of plant problems. This data collection is important for pattern characterization solution that can be made to the irradiator IR219, JS10000 in MINTec-Sinagama. (author)

Comparative in vitro activities of trovafloxacin (CP-99,219) against 445 gram-positive isolates from patients with endocarditis and those with other bloodstream infections

NARCIS (Netherlands)

H.P. Endtz (Hubert); J.W. Mouton (Johan); J.G. den Hollander (Jan); N.P.W.C.J. van den Braak (Nicole); H.A. Verbrugh (Henri)

1997-01-01

textabstractThe in vitro activity of trovafloxacin (CP-99,219), a new fluoroquinolone, was compared with the in vitro activities of other commonly used quinolones and other antimicrobial agents against 445 gram-positive microorganisms isolated between 1986 and 1995 from

Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

International Nuclear Information System (INIS)

Moulin, J.

2008-06-01

Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions

International Nuclear Information System (INIS)

2007-01-01

This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

Sorption studies of radioelements on geological materials

International Nuclear Information System (INIS)

Berry, John A.; Yui, Mikazu; Kitamura, Akira

2007-11-01

Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

Flexible synthetic routes to poison-frog alkaloids of the 5,8-disubstituted indolizidine-class I: synthesis of common lactam chiral building blocks and application to the synthesis of (--203A, (--205A, and (--219F

Directory of Open Access Journals (Sweden)

Spande Thomas F

2007-09-01

Full Text Available Abstract Background The 5,8-disubstituted indolizidines are the largest class of poison-frog alkaloids found in anuran skin, and are of considerable interest because of their inhibitory effects on the neuronal nicotinic acetylcholine receptors. Many synthetic strategies for the construction of this nucleus have been reported: however, a flexible route has not been reported to date. Results Synthesis of lactam chiral building blocks for the flexible synthesis of the title alkaloids has been achieved using a Michael-type conjugate addition reaction to a chiral cyclic enamine ester as the key step in constructing the trisubstituted piperidine ring system. To demonstrate the usefulness of these chiral building blocks, syntheses of (--203A, (--205A from 1, and (--219F from 2 have been achieved. Conclusion The total synthesis of (--203A, (--205A, and (--219F was achieved, and the absolute stereochemistry of natural 203A was determined to be 5S, 8R, 9S. In addition, the relative stereochemistry of natural 219F was determined.

Actinide metals

Energy Technology Data Exchange (ETDEWEB)

Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

2016-07-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Status of liquid metal reactor development in the United States of America

International Nuclear Information System (INIS)

Griffith, J.D.; Horton, K.E.

1991-01-01

An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

Actinide metals

International Nuclear Information System (INIS)

Brown, Paul L.; Ekberg, Christian

2016-01-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

The generation, validation and testing of a coupled 219-group neutron 36-group gamma ray AMPX-II library

International Nuclear Information System (INIS)

Panini, G.C.; Siciliano, F.; Lioi, A.

1987-01-01

The main characteristics of a P 3 coupled 219-group neutron 36-group gamma-ray library in the AMPX-II Master Interface Format obtained processing ENDF/B-IV data by means of various AMPX-II System modules are presented in this note both for the more reprocessing aspects and features of the generated component files-neutrons, photon and secondary gamma-ray production cross sections. As far as the neutron data are concerned there is the avaibility of 186 data sets regarding most significant fission products. Results of the additional validation of the neutron data pertaining to eighteen benchmark experiments are also given. Some calculational tests on both neutron and coupled data emphasize the important role of the secondary gamma-ray data in nuclear criticality safety calculations

Primary and secondary cutaneous CD30(+) lymphoproliferative disorders : a report from the Dutch Cutaneous Lymphoma Group on the long-term follow-up data of 219 patients and guidelines for diagnosis and treatment

NARCIS (Netherlands)

Bekkenk, MW; Geelen, FAMJ; Vader, PCV; Heule, F; Geerts, ML; van Vloten, WA; Meijer, CJLM; Willemze, R

2000-01-01

To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lympho proliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with

Primary and secondary cutaneous CD30(+) lymphoproliferative disorders: a report from the Dutch Cutaneous Lymphoma Group on the long-term follow-up data of 219 patients and guidelines for diagnosis and treatment

NARCIS (Netherlands)

Bekkenk, M. W.; Geelen, F. A.; van Voorst Vader, P. C.; Heule, F.; Geerts, M. L.; van Vloten, W. A.; Meijer, C. J.; Willemze, R.

2000-01-01

To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lymphoproliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

Energy Technology Data Exchange (ETDEWEB)

P. Bernot

2005-07-13

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

International Nuclear Information System (INIS)

P. Bernot

2005-01-01

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

Yield Traits, Physico-chemical Characteristics and Nutritional Composition of MR219 M3 Generation and its Effect on Glycemic Index and Responses in Animal Model

International Nuclear Information System (INIS)

Asma Ilyani Kadar; Sobri Hussein; Abdul Rahim Harun; Fazliana Mohd Saaya

2014-01-01

Mutation technique is a conventional breeding technique and it is very effective in improving of main crop characteristics such as yield traits, resistance to diseases and pests and nutritional qualities. In this study, MR219 seeds were treated with Carbon ion radiation (60 Gy) by AVF-Cyclotron at the Japan Atomic Energy Research Institute (JAERI), Takasaki, Japan and were planted at the Malaysian Nuclear Agency up to third mutant generation (M3). Thirty one M3 mutant lines (ML1 to ML31) were evaluated on morphological, yield and yield components, and were compared to the parental variety, MR219. Analysis of variance revealed that there was a significant difference among mutant lines in culm height, days to flowering, number of tillers, number of panicles, 1000 grain weight, total grain weight, total of dry matter, alkaline spreading value, gel consistency, amylose content, ash, crude protein, fat, dietary fibre, carbohydrate and energy. Mutant line ML21 had the best performance in majority of yield components and vegetative traits as compared to others mutant lines and parental variety. For nutritional composition, mutant lines namely ML31, ML21, ML10, ML19 were improved in crude protein content, dietary fibre and carbohydrate content. The estimation of glycemic index revealed that two mutant lines namely ML3 and ML30 can be consumed by diabetics. (author)

Kinetics of radioisotope exchange between brine and rock in a geothermal system

International Nuclear Information System (INIS)

Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku

1988-01-01

A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours

Incidence and predictors of difficult laryngoscopy in 11,219 pediatric anesthesia procedures.

Science.gov (United States)

Heinrich, Sebastian; Birkholz, Torsten; Ihmsen, Harald; Irouschek, Andrea; Ackermann, Andreas; Schmidt, Joachim

2012-08-01

Difficult laryngoscopy in pediatric patients undergoing anesthesia. This retrospective analysis was conducted to investigate incidence and predictors of difficult laryngoscopy in a large cohort of pediatric patients receiving general anesthesia with endotracheal intubation. Young age and craniofacial dysmorphy are predictors for the difficult pediatric airway and difficult laryngoscopy. For difficult laryngoscopy, other general predictors are not yet described. Retrospectively, from a 5-year period, data from 11.219 general anesthesia procedures in pediatric patients with endotracheal intubation using age-adapted Macintosh blades in a single center (university hospital) were analyzed statistically. The overall incidence of difficult laryngoscopy [Cormack and Lehane (CML) grade III and IV] was 1.35%. In patients younger than 1 year, the incidence of CML III or IV was significantly higher than in the older patients (4.7% vs 0.7%). ASA Physical Status III and IV, a higher Mallampati Score (III and IV) and a low BMI were all associated (P pediatric anesthesia is lower than in adults. Our results show that the risk of difficult laryngoscopy is much higher in patients below 1 year of age, in underweight patients and in ASA III and IV patients. The underlying disease might also contribute to the risk. If the Mallampati score could be obtained, prediction of difficult laryngoscopy seems to be reliable. Our data support the existing recommendations for a specialized anesthesiological team to provide safe anesthesia for infants and neonates. © 2012 Blackwell Publishing Ltd.

Association between ε2/3/4, Promoter Polymorphism (−491A/T, −427T/C, and −219T/G at the Apolipoprotein E Gene, and Mental Retardation in Children from an Iodine Deficiency Area, China

Directory of Open Access Journals (Sweden)

Jun Li

2014-01-01

Full Text Available Background. Several common single-nucleotide polymorphisms (SNPs at apolipoprotein E (ApoE have been linked with late onset sporadic Alzheimer’s disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n=130, borderline MR (n=124, and controls (n=334 from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ2 test (P>0.05. However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004, indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4 and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.

CHARACTERIZATION OF THE K2-19 MULTIPLE-TRANSITING PLANETARY SYSTEM VIA HIGH-DISPERSION SPECTROSCOPY, AO IMAGING, AND TRANSIT TIMING VARIATIONS

Energy Technology Data Exchange (ETDEWEB)

Narita, Norio; Hori, Yasunori; Kusakabe, Nobuhiko; Takeda, Yoichi; Tamura, Motohide [Astrobiology Center, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Hirano, Teruyuki [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan); Fukui, Akihiko; Yanagisawa, Kenshi [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, Asakuchi, Okayama 719-0232 (Japan); Sanchis-Ojeda, Roberto [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); Winn, Joshua N. [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Ryu, Tsuguru; Onitsuka, Masahiro [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Kudo, Tomoyuki [Subaru Telescope, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Delrez, Laetitia; Gillon, Michael; Jehin, Emmanuel [Institut d’Astrophysique et de Géophysique, Université de Liège, Allée du 6 Août 17, Bat. B5C, B-4000 Liège (Belgium); McCormac, James [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom); Holman, Matthew [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Izumiura, Hideyuki, E-mail: norio.narita@nao.ac.jp [SOKENDAI (The Graduate University for Advanced Studies), 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan)

2015-12-10

K2-19 (EPIC201505350) is an interesting planetary system in which two transiting planets with radii ∼7 R{sub ⊕} (inner planet b) and ∼4 R{sub ⊕} (outer planet c) have orbits that are nearly in a 3:2 mean-motion resonance. Here, we present results of ground-based follow-up observations for the K2-19 planetary system. We have performed high-dispersion spectroscopy and high-contrast adaptive-optics imaging of the host star with the HDS and HiCIAO on the Subaru 8.2 m telescope. We find that the host star is a relatively old (≥8 Gyr) late G-type star (T{sub eff} ∼ 5350 K, M{sub s} ∼ 0.9 M{sub ⊙}, and R{sub s} ∼ 0.9 R{sub ⊙}). We do not find any contaminating faint objects near the host star that could be responsible for (or dilute) the transit signals. We have also conducted transit follow-up photometry for the inner planet with KeplerCam on the FLWO 1.2 m telescope, TRAPPISTCAM on the TRAPPIST 0.6 m telescope, and MuSCAT on the OAO 1.88 m telescope. We confirm the presence of transit timing variations (TTVs), as previously reported by Armstrong and coworkers. We model the observed TTVs of the inner planet using the synodic chopping formulae given by Deck and Agol. We find two statistically indistinguishable solutions for which the period ratios (P{sub c}/P{sub b}) are located slightly above and below the exact 3:2 commensurability. Despite the degeneracy, we derive the orbital period of the inner planet P{sub b} ∼ 7.921 days and the mass of the outer planet M{sub c} ∼ 20 M{sub ⊕}. Additional transit photometry (especially for the outer planet) as well as precise radial-velocity measurements would be helpful to break the degeneracy and to determine the mass of the inner planet.

Folding model analysis of 58Ni + 64Ni elastic and inelastic scattering at Elab=203.8 and 219.2 MeV

International Nuclear Information System (INIS)

Ruiz, J.A.; Ferrero, J.L.; Bilwes, B.; Bilwes, R.

1992-01-01

Angular distributions of elastic scattering of 58 Ni by 64 Ni and inelastic scattering leading to the first 2 + state in 58 Ni or in 64 Ni were measured at E lab =203.8 and 219.2 MeV. The data were analyzed in the frame of the folding model. A renormalization N of the folding potential consistently lower than unity (N∼0.65) is needed to reproduce the elastic scattering data. Coupled-channel calculations including the main inelastic channels explain partly this discrepancy. They reproduce the elastic and inelastic scattering data with a renormalization of N∼0.8 at both energies. Interference between Coulomb and nuclear excitation is shown to play an important role in the repulsive character of the polarization potential. (author) 38 refs.; 6 figs.; 1 tab

LASL experience in decontamination of the environment

International Nuclear Information System (INIS)

Ahlquist, A.J.

1981-01-01

This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

Determination of radionuclides in discharged water from gold ...

African Journals Online (AJOL)

Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

The unusually strong hydrogen bond between the carbonyl of Q(A) and His M219 in the Rhodobacter sphaeroides reaction center is not essential for efficient electron transfer from Q(A)(-) to Q(B).

Science.gov (United States)

Breton, Jacques; Lavergne, Jérôme; Wakeham, Marion C; Nabedryk, Eliane; Jones, Michael R

2007-06-05

In native reaction centers (RCs) from photosynthetic purple bacteria the primary quinone (QA) and the secondary quinone (QB) are interconnected via a specific His-Fe-His bridge. In Rhodobacter sphaeroides RCs the C4=O carbonyl of QA forms a very strong hydrogen bond with the protonated Npi of His M219, and the Ntau of this residue is in turn coordinated to the non-heme iron atom. The second carbonyl of QA is engaged in a much weaker hydrogen bond with the backbone N-H of Ala M260. In previous work, a Trp side chain was introduced by site-directed mutagenesis at the M260 position in the RC of Rb. sphaeroides, resulting in a complex that is completely devoid of QA and therefore nonfunctional. A photochemically competent derivative of the AM260W mutant was isolated that contains a Cys side chain at the M260 position (denoted AM260(W-->C)). In the present work, the interactions between the carbonyl groups of QA and the protein in the AM260(W-->C) suppressor mutant have been characterized by light-induced FTIR difference spectroscopy of the photoreduction of QA. The QA-/QA difference spectrum demonstrates that the strong interaction between the C4=O carbonyl of QA and His M219 is lost in the mutant, and the coupled CO and CC modes of the QA- semiquinone are also strongly perturbed. In parallel, a band assigned to the perturbation of the C5-Ntau mode of His M219 upon QA- formation in the native RC is lacking in the spectrum of the mutant. Furthermore, a positive band between 2900 and 2400 cm-1 that is related to protons fluctuating within a network of highly polarizable hydrogen bonds in the native RC is reduced in amplitude in the mutant. On the other hand, the QB-/QB FTIR difference spectrum is essentially the same as for the native RC. The kinetics of electron transfer from QA- to QB were measured by the flash-induced absorption changes at 780 nm. Compared to native RCs the absorption transients are slowed by a factor of about 2 for both the slow phase (in the

An aerial radiological survey of the Sandia National Laboratories and surrounding area

International Nuclear Information System (INIS)

Riedhauser, S.R.

1994-06-01

A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

Morphology and magnetism of Fe monolayers and small Fen clusters (n 2-19) supported on the Ni(111) surface

International Nuclear Information System (INIS)

Longo, R C; MartInez, E; Dieguez, O; Vega, A; Gallego, L J

2007-01-01

Using the modified embedded atom model in conjunction with a self-consistent tight-binding method, we investigated the lowest-energy structures of Fe monolayers and isolated Fe n clusters (n = 2-19) supported on the Ni(111) surface. In keeping with experimental findings, our calculations predict that the atoms of the monolayer occupy face-centred cubic (fcc) rather than hexagonal close-packed (hcp) sites. Likewise in agreement with experiment we found that Fe layers stack with a pseudomorphic fcc structure up to two monolayers, beyond which they stack as bcc(110). The structures of supported Fe clusters are predicted to be two-dimensional islands maximizing the number of nearest-neighbour bonds among the adsorbed Fe atoms, and their average magnetic moments per atom decrease towards that of the supported Fe monolayer almost monotonically as n increases. Finally, a pair of Fe 3 clusters on Ni(111) were found to exhibit virtually no interaction with each other even when separated by only one atomic row, i.e. so long as they do not coalesce they retain their individual magnetic properties

Contribution of weight status to asthma prevalence racial disparities, 2-19 year olds, 1988-2014.

Science.gov (United States)

Akinbami, Lara J; Rossen, Lauren M; Fakhouri, Tala H I; Simon, Alan E; Kit, Brian K

2017-08-01

Racial disparities in childhood asthma prevalence increased after the 1990s. Obesity, which also varies by race/ethnicity, is an asthma risk factor but its contribution to asthma prevalence disparities is unknown. We analyzed nationally representative National Health Examination and Nutrition Survey data for 2-19 year olds with logistic regression and decomposition analyses to assess the contributions of weight status to racial disparities in asthma prevalence, controlling for sex, age, and income status. From 1988-1994 to 2011-2014, asthma prevalence increased more among non-Hispanic black (NHB) (8.4% to 18.0%) than non-Hispanic white (NHW) youth (7.2% to 10.3%). Logistic regression showed that obesity was an asthma risk factor for all groups but that a three-way "weight status-race/ethnicity-time" interaction was not significant. That is, weight status did not modify the race/ethnicity association with asthma over time. In decomposition analyses, weight status had a small contribution to NHB/NHW asthma prevalence disparities but most of the disparity remained unexplained by weight status or other asthma risk factors (sex, age and income status). NHB youth had a greater asthma prevalence increase from 1988-1994 to 2011-2014 than NHW youth. Most of the racial disparity in asthma prevalence remained unexplained after considering weight status and other characteristics. Published by Elsevier Inc.

FERREIRA, Maria Alice Araújo; SOUZA, Germana Henriques Pereira de; GOROVITZ, Sabine (Org. Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. (Org.. Brasília: Editora da UnB, 2014. 219 p.

Directory of Open Access Journals (Sweden)

Marie Hélène C. Torres

2014-12-01

Full Text Available Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.

Association between in-hospital mortality and renal dysfunction in 186,219 patients hospitalized for acute stroke in the Emilia-Romagna region of Italy.

Science.gov (United States)

Fabbian, Fabio; Gallerani, Massimo; Pala, Marco; De Giorgi, Alfredo; Salmi, Raffaella; Dentali, Francesco; Ageno, Walter; Manfredini, Roberto

2014-11-01

Using a regional Italian database, we evaluated the relationship between renal dysfunction and in-hospital mortality (IHM) in patients with acute stroke (ischemic/hemorrhagic). Patients were classified on the basis of renal damage: without renal dysfunction, with chronic kidney disease (CKD), and with end-stage renal disease (ESRD). Of a total of 186,219 patients with a first episode of stroke, 1626 (0.9%) had CKD and 819 (0.4%) had ESRD. Stroke-related IHM (total cases) was independently associated with CKD, ESRD, atrial fibrillation (AF), age, and Charlson comorbidity index (CCI). In patients with ischemic stroke (n=154,026), IHM remained independently associated with CKD, ESRD, AF, and CCI. In patients with hemorrhagic stroke (n=32,189), variables that were independently associated with IHM were CKD, ESRD, and AF. Renal dysfunction is associated with IHM related to stroke, both ischemic and hemorrhagic, with even higher odds ratios than those of other established risk factors, such as age, comorbidities, and AF. © The Author(s) 2013.

Clinical Management and Follow-up of Hypercholesterolemia Among Perinatally HIV-Infected Children Enrolled in the PACTG 219C Study

Science.gov (United States)

Jacobson, Denise L.; Williams, Paige; Tassiopoulos, Katherine; Melvin, Ann; Hazra, Rohan; Farley, John

2011-01-01

Background Hypercholesterolemia is common in perinatally HIV-infected (HIV+) children, but little is known about the clinical course and management in this population. Methods We studied HIV+ children in a multisite prospective cohort study (PACTG 219C) and considered follow-up for two years after development of hypercholesterolemia. We estimated the time to and factors associated with resolution of hypercholesterolemia and described changes in ARV regimen and use of lipid-lowering medications. We defined incident hypercholesterolemia as entry total cholesterol (cholesterol) hypercholesterolemia as two consecutive cholesterol hypercholesterolemia. Results Among 240 incident hypercholesterolemia cases, 81 (34%) had resolution to normal cholesterol within two years of follow-up (median follow-up = 1.9 years). The median age of cases was 10.3 years with 54% Non-Hispanic black and 53% male. Resolution to normal cholesterol was more likely in children who changed ARV regimen (adjusted Hazard Ratio (aHR) = 2.37, 95%CI 1.45, 3.88) and who were ≥ 13 years old (aHR=2.39, 95%CI 1.33, 4.27). Types of regimen changes varied greatly and 15 children began statins. Conclusions The majority of children who develop hypercholesterolemia maintain elevated levels over time, potentially placing them at risk for premature cardiovascular morbidity. PMID:21602698

Radiometric determination of {sup 226}, {sup 228}Ac and {sup 40}K in fly ashes and building materials

Energy Technology Data Exchange (ETDEWEB)

Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science

1996-12-31

In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.

Tank 103, 219-S Facility at 222-S Laboratory, analytical results for the final report

International Nuclear Information System (INIS)

Fuller, R.K.

1998-01-01

This is the final report for the polychlorinated biphenyls analysis of Tank-103 (TK-103) in the 219-S Facility at 222-S Laboratory. Twenty 1-liter bottles (Sample numbers S98SO00074 through S98SO00093) were received from TK-103 during two sampling events, on May 5 and May 7, 1998. The samples were centrifuged to separate the solids and liquids. The centrifuged sludge was analyzed for PCBs as Aroclor mixtures. The results are discussed on page 6. The sample breakdown diagram (Page 114) provides a cross-reference of sample identification of the bulk samples to the laboratory identification number for the solids. The request for sample analysis (RSA) form is provided as Page 117. The raw data is presented on Page 43. Sample Description, Handling, and Preparation Twenty samples were received in the laboratory in 1-Liter bottles. The first 8 samples were received on May 5, 1998. There were insufficient solids to perform the requested PCB analysis and 12 additional samples were collected and received on May 7, 1998. Breakdown and sub sampling was performed on May 8, 1998. Sample number S98SO00084 was lost due to a broken bottle. Nineteen samples were centrifuged and the solids were collected in 8 centrifuge cones. After the last sample was processed, the solids were consolidated into 2 centrifuge cones. The first cone contained 9.7 grams of solid and 13.0 grams was collected in the second cone. The wet sludge from the first centrifuge cone was submitted to the laboratory for PCB analysis (sample number S98SO00102). The other sample portion (S98SO00103) was retained for possible additional analyses

A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

International Nuclear Information System (INIS)

Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

2017-01-01

The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

Purification of cerium, neodymium and gadolinium for low background experiments

Directory of Open Access Journals (Sweden)

Boiko R.S.

2014-01-01

Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

'Masurium' and the 'early transuranium elements' or how discovery of nuclear fission was not clearly seen

International Nuclear Information System (INIS)

Keller, C.

1988-01-01

Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de

FERREIRA, Maria Alice Araújo; SOUZA, Germana Henriques Pereira de; GOROVITZ, Sabine (Org. Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. (Org.. Brasília: Editora da UnB, 2014. 219 p.

Directory of Open Access Journals (Sweden)

Marie Hélène C. Torres

2014-12-01

Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.

FERREIRA, Maria Alice Araújo; SOUZA, Germana Henriques Pereira de; GOROVITZ, Sabine (Org.) Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. (Org.). Brasília: Editora da UnB, 2014. 219 p.

OpenAIRE

Torres, Marie Hélène C.

2014-01-01

http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org.), Brasília: Editora da UnB, 2014. 219 p.

Germination Response of MR 219 Rice Variety to Different Exposure Times and Periods of 2450 MHz Microwave Frequency

Directory of Open Access Journals (Sweden)

Daryush Talei

2013-01-01

Full Text Available Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR, germination percentage (GP, and mean germination time (MGT were analyzed by exposing its seeds to 2450 MHz of microwave frequency for one, four, seven, and ten hours. It was revealed that exposing the seeds to the microwave frequency for 10 hours resulted in the highest GP. This treatment led to 100% of germination after three days with a mean germination time of 2.1 days. Although the other exposure times of microwave frequency caused the moderate effects on germination with a GPa3 ranged from 93% to 98%, they failed to reduce the MGTa3. The results showed that ten-hour exposure times of microwave frequency for six days significantly facilitated and improved the germination indices (primary shoot and root length. Therefore, the technique is expected to benefit the improvement of rice seed germination considering its simplicity and efficacy in increasing the germination percentage and rate as well as the primary shoot and root length without causing any environmental toxicity.

Actinides

International Nuclear Information System (INIS)

Martinot, L.; Fuger, J.

1985-01-01

The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

Calculation of entropy of liquid metals using acoustic measurements in the framework of the rigid sphere model

International Nuclear Information System (INIS)

Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.

2001-01-01

For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru

Status of the lanthanides and actinides in the periodic table

International Nuclear Information System (INIS)

Holden, N.E.

1985-01-01

In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

Assessment of soil contamination by potentially toxic trace elements (PTSD) (As, Cd, Cu, Hg, Pb, Zn) in a lower plain of the Hron River according to Law no. 219/2008 Coll., by geo-accumulation index, anthropogenic factor and Tomlinson index; Zhodnotenie kontaminacie pod potencialne toxickymi stopovymi prvkami (PTSP) (As, Cd, Cu, Hg, Pb, Zn) v dolnej casti nivy Hrona podla zakona c. 219/2008 Z.z., indexu geoakumulacie, antropogenneho faktora a Tomlinsonovho indexu

Energy Technology Data Exchange (ETDEWEB)

Hlodak, M [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Ustav laboratorneho vyskumu geomaterialov, 84215 Bratislava (Slovakia)

2012-04-25

Soil contamination by different PTSD may have different geogenic and anthropogenic origin and occurs in all countries of the world. The aim of this paper is to evaluate the soils contamination of a lower plain of the Hron River. This paper used the results of the thesis Soil contamination of the Hron River floodplain by trace elements (As, Cd, Cu, Hg, Pb, Zn) [1]. Soil contamination was evaluated by: Act. 219/2008 Coll. on the protection and use of agricultural land, by anthropogenic factor (AF), geo-accumulation index (IgeoE) and Tomlinson index - the index of the pollution load (PLI). (author)

Value of neutrophil-to-lymphocyte ratio for predicting lung cancer prognosis: A meta-analysis of 7,219 patients.

Science.gov (United States)

Yu, Yu; Qian, Lei; Cui, Jiuwei

2017-09-01

Current evidence suggests that the neutrophil-to-lymphocyte ratio (NLR) may be a biomarker for poor prognosis in lung cancer, although this association remains controversial. Therefore, a meta-analysis was performed to evaluate the association between NLR and lung cancer outcome. A systematic literature search was performed through the PubMed, Embase and Cochrane Library databases (until July 30, 2016), to identify studies evaluating the association between NLR and overall survival (OS) and/or progression-free survival (PFS) among patients with lung cancer. Based on the results of this search, data from 18 studies involving 7,219 patients with lung cancer were evaluated. The pooled hazard ratio (HR) suggested that elevated pretreatment NLR predicted poor OS [HR=1.46, 95% confidence interval (CI): 1.30-1.64] and poor PFS (HR=1.42, 95% CI: 1.15-1.75) among patients with lung cancer. Subgroup analysis revealed that the prognostic value of NLR for predicting poor OS increased among patients who underwent surgery (HR=1.50, 95% CI: 1.21-1.84) or patients with early-stage disease (HR=1.64, 95% CI: 1.37-1.97). An NLR cut-off value of ≥4 significantly predicted poor OS (HR=1.56, 95% CI: 1.31-1.85) and PFS (HR=1.54, 95% CI: 1.13-1.82), particularly in the cases of small-cell lung cancer. Thus, the results of the present meta-analysis suggested that an elevated pretreatment NLR (e.g., ≥4) may be considered as a biomarker for poor prognosis in patients with lung cancer.

A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

International Nuclear Information System (INIS)

Payne, T.E.

1991-01-01

One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

International Nuclear Information System (INIS)

Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

2017-01-01

The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

Energy Technology Data Exchange (ETDEWEB)

Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

2017-11-13

The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Journal of Naval Science. Volume 2. Number 3. July 1976

Science.gov (United States)

1976-07-01

supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10

In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

Directory of Open Access Journals (Sweden)

D. A. Fink

2015-02-01

Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

Energy Technology Data Exchange (ETDEWEB)

Marx, Sebastian Markus

2014-09-23

The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

International Nuclear Information System (INIS)

2006-01-01

In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

Phosphorylations of Serines 21/9 in Glycogen Synthase Kinase 3α/β Are Not Required for Cell Lineage Commitment or WNT Signaling in the Normal Mouse Intestine.

Directory of Open Access Journals (Sweden)

Fiona Hey

Full Text Available The WNT signalling pathway controls many developmental processes and plays a key role in maintenance of intestine renewal and homeostasis. Glycogen Synthase Kinase 3 (GSK3 is an important component of the WNT pathway and is involved in regulating β-catenin stability and expression of WNT target genes. The mechanisms underpinning GSK3 regulation in this context are not completely understood, with some evidence suggesting this occurs through inhibitory N-terminal serine phosphorylation in a similar way to GSK3 inactivation in insulin signaling. To investigate this in a physiologically relevant context, we have analysed the intestinal phenotype of GSK3 knockin mice in which N-terminal serines 21/9 of GSK3α/β have been mutated to non-phosphorylatable alanine residues. We show that these knockin mutations have very little effect on overall intestinal integrity, cell lineage commitment, β-catenin localization or WNT target gene expression although a small increase in apoptosis at villi tips is observed. Our results provide in vivo evidence that GSK3 is regulated through mechanisms independent of N-terminal serine phosphorylation in order for β-catenin to be stabilised.

78 FR 48152 - Advisory Committee on Student Financial Assistance; Meeting

Science.gov (United States)

2013-08-07

..., 80 F Street NW., Suite 413, Washington DC 20202-7582, (202) 219- 2099. SUPPLEMENTARY INFORMATION: The... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The..., August 21, 2013 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected

75 FR 29739 - Advisory Committee on Student Financial Assistance: Hearing

Science.gov (United States)

2010-05-27

..., Capitol Place, 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. Individuals who use... (202) 219-2099 or via e-mail at [email protected] . We will attempt to meet requests after this... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The...

Radionuclide interactions with marine sediments

International Nuclear Information System (INIS)

Higgo, J.J.W.

1987-09-01

A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

Calculation technique of free and impurity ion electronic structures

International Nuclear Information System (INIS)

Kulagin, N.A.; Sviridov, D.T.

1986-01-01

The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix

JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

International Nuclear Information System (INIS)

Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

2010-01-01

Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

Energy Technology Data Exchange (ETDEWEB)

None

1979-09-01

Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

Potential population-level nutritional impact of replacing whole and reduced-fat milk with low-fat and skim milk among US children aged 2-19 years.

Science.gov (United States)

Rehm, Colin D; Drewnowski, Adam; Monsivais, Pablo

2015-01-01

Dietary guidance emphasizes plain low-fat and skim milk over whole, reduced-fat, and flavored milk (milk eligible for replacement [MER]). The objective of this study was to evaluate the population-level impact of such a change on energy, macronutrient and nutrient intakes, and diet cost. Cross-sectional modeling study. Data from the 2001-2002 and 2003-2004 National Health and Nutrition Examination Survey. A total of 8,112 children aged 2-19 years. Energy, macronutrient, and micronutrient intake before and after replacement of MER with low-fat or skim milk. Survey-weighted linear regression models. Milk eligible for replacement accounted for 46% of dairy servings. Among MER consumers, replacement with skim or low-fat milk would lead to a projected reduction in energy of 113 (95% confidence interval [CI], 107-119) and 77 (95% CI, 73-82) kcal/d and percent energy from saturated fat by an absolute value of 2.5% of total energy (95% CI, 2.4-2.6) and 1.4% (95% CI, 1.3-1.5), respectively. Replacement of MER does not change diet costs or calcium and potassium intake. Substitution of MER has the potential to reduce energy and total and saturated fat intake with no impact on diet costs or micronutrient density. The feasibility of such replacement has not been examined and there may be negative consequences if replacement is done with non-nutrient-rich beverages. Copyright © 2015. Published by Elsevier Inc.

Dissolved Concentration Limits of Radioactive Elements

Energy Technology Data Exchange (ETDEWEB)

Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

2003-06-20

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

Dissolved Concentration Limits of Radioactive Elements

International Nuclear Information System (INIS)

Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

2003-01-01

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

48 CFR 1819.7302 - NASA contract clauses.

Science.gov (United States)

2010-10-01

... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...

How fission was discovered

International Nuclear Information System (INIS)

Fluegge, S.

1989-01-01

After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission

New method for large scale production of medically applicable Actinium-225 and Radium-223

International Nuclear Information System (INIS)

Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

2014-01-01

Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

International Nuclear Information System (INIS)

Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

1990-01-01

227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

75 FR 55314 - Advisory Committee on Student Financial Assistance: Meeting

Science.gov (United States)

2010-09-10

... later than Monday, September 20, 2010 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION.... You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

76 FR 7551 - Advisory Committee on Student Financial Assistance: Hearing

Science.gov (United States)

2011-02-10

...-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TDD) may call the.... Tracy Jones at (202) 219-2099 or via email at [email protected] . We will attempt to meet...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

77 FR 42490 - Advisory Committee on Student Financial Assistance: Meeting

Science.gov (United States)

2012-07-19

..., 80 F Street NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION: The...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration..., 2012 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected] . We...

76 FR 52943 - Advisory Committee on Student Financial Assistance: Meeting

Science.gov (United States)

2011-08-24

... later than Monday, September 5, 2011 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., Washington DC 20202-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TTY...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

76 FR 44317 - Advisory Committee on Student Financial Assistance: Meeting

Science.gov (United States)

2011-07-25

... later than Monday, August 1, 2011 by contacting Ms. Tracy Jones at (202) 219-2099 or via e-mail at tracy..., 80 F Street, NW., Suite 413, Washington DC 20202-7582, (202) 219-2099. Individuals who use a...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

Process for radioisotope recovery and system for implementing same

Science.gov (United States)

Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

2009-10-06

A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

Nitrogen Dynamic Study on Rice Mutant Lines Using 15N Isotope Techniques

International Nuclear Information System (INIS)

Ahmad Nazrul Abd Wahid; Shyful Azizi Abdul Rahman; Abdul Rahim Harun

2015-01-01

Malaysian Nuclear Agency in collaboration with UPM and MARDI has produced two types of rice mutant lines of MR219, viz. MR219-4 and MR219-9 developed under rice radiation mutagenenesis programme for adaptability to aerobic conditions. Aerobic cultivating is rice cultivation system on well drained soil and using minimal water input. At Malaysian Nuclear Agency, a nitrogen fertilization study in aerobic condition for the rice mutant lines was carried out in the shade house and field. The study is intended to examine and assess the dynamics of nitrogen by rice mutant lines through the different soil water management and nitrogen levels. Direct 15 N isotopic tracer method was used in this study, whereby the 15 N labeled urea fertilizer was utilized as a tracer for nitrogen nutrient uptake by the test crops. This paper is intended to highlight the progress that has been made in the study of the nitrogen dynamics on MR219-4 and MR219-9 rice mutant lines. (author)

12 CFR 219.2 - Definitions.

Science.gov (United States)

2010-01-01

... institution means any office of a bank, savings bank, card issuer as defined in section 103 of the Consumers Credit Protection Act (15 U.S.C. 1602(n)), industrial loan company, trust company, savings association, building and loan, or homestead association (including cooperative banks), credit union, or consumer...

22 CFR 219.103 - Definitions.

Science.gov (United States)

2010-04-01

..., emotional or mental illness, and specific learning disabilities. The term “physical or mental impairment... person means any person who has a physical or mental impairment that substantially limits one or more.... As used in this definition, the phrase: (1) Physical or mental impairment includes— (i) Any...

49 CFR 107.219 - Processing.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS AND OIL TRANSPORTATION HAZARDOUS MATERIALS PROGRAM... with the disposition of previous applications for waiver of preemption determinations. [Amdt. 107-3, 41...

12 CFR 219.4 - Exceptions.

Science.gov (United States)

2010-01-01

... financial records or information related to: (a) Security interests, bankruptcy claims, debt collection. Any... loan insurance program. (c) Nonidentifiable information. Financial records that are not identified with.... (f) Federally required reports. Financial records required to be reported in accordance with any...

Probabilistic risk assessment: Number 219

International Nuclear Information System (INIS)

Bari, R.A.

1985-01-01

This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)

36 CFR 219.3 - Overview.

Science.gov (United States)

2010-07-01

... planning framework. Land and resource management planning is a flexible process for fitting solutions to... responsible for national planning. National planning includes the Forest Service national strategic plan... Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest...

48 CFR 219.1005 - Applicability.

Science.gov (United States)

2010-10-01

... objects, which otherwise meet criteria in FAR subpart 19.10. (b) The targeted industry categories for DoD are: North American Industry Classification System (NAICS) Description NAICS Code (1) Pharmaceutical... Navigation System and Instrument Manufacturing 334511 (10) (i) Cellular and Other Wireless Telecommunications...

Isolation and characterization of a novel endoglucanase from a Bursaphelenchus xylophilus metagenomic library.

Directory of Open Access Journals (Sweden)

Lin Zhang

Full Text Available A novel gene (designated as cen219 encoding endoglucanase was isolated from a Bursaphelenchus xylophilus metagenomic library by functional screening. Sequence analysis revealed that cen219 encoded a protein of 367 amino acids. SDS-PAGE analysis of purified endoglucanase suggested that Cen219 was a monomeric enzyme with a molecular mass of 40 kDa. The optimum temperature and pH for endoglucanase activity of Cen219 was separately 50 °C and 6.0. It was stable from 30 to 50 °C, and from pH 4.0 to 7.0. The activity was significantly enhanced by Mn(2+ and dramatically reduced by detergent SDS and metals Fe(3+, Cu(2+ or Hg(2+. The enzyme hydrolyzed a wide range of β-1, 3-, and β-1, 4-linked polysaccharides, with varying activities. Activities towards microcrystalline cellulose and filter paper were relatively high, while the highest activity was towards oat gum. The Km and Vmax of Cen219 towards CMC was 17.37 mg/ml and 333.33 U/mg, respectively. The findings have an insight into understanding the molecular basis of host-parasite interactions in B. xylophilus species. The properties also make Cen219 an interesting enzyme for biotechnological application.

The chemistry of the actinide elements. Volume I

International Nuclear Information System (INIS)

Katz, J.J.; Seaborg, G.T.; Morss, L.R.

1986-01-01

The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

A neutron source of variable fluence

International Nuclear Information System (INIS)

Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.

1975-01-01

The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr

Effect of the male factor on the clinical outcome of intracytoplasmic sperm injection combined with preimplantation aneuploidy testing: observational longitudinal cohort study of 1,219 consecutive cycles.

Science.gov (United States)

Mazzilli, Rossella; Cimadomo, Danilo; Vaiarelli, Alberto; Capalbo, Antonio; Dovere, Lisa; Alviggi, Erminia; Dusi, Ludovica; Foresta, Carlo; Lombardo, Francesco; Lenzi, Andrea; Tournaye, Herman; Alviggi, Carlo; Rienzi, Laura; Ubaldi, Filippo Maria

2017-12-01

To evaluate the impact of the male factor on the outcomes of intracytoplasmic sperm injection (ICSI) cycles combined with preimplantation genetic testing for aneuploidies (PGT-A). Observational longitudinal cohort study. Private in vitro fertilization (IVF) center. A total of 1,219 oocyte retrievals divided into five study groups according to sperm parameters: normozoospermia (N), moderate male factor (MMF), severe oligoasthenoteratozoospermia (OAT-S), obstructive azoospermia (OA), and nonobstructive azoospermia (NOA). ICSI with ejaculated/surgically retrieved sperm, blastocyst culture, trophectoderm-based quantitative polymerase chain reaction PGT-A, and frozen-warmed euploid embryo transfer (ET). The primary outcome measures were fertilization, blastocyst development, and euploidy rates; the secondary outcome measures were live birth and miscarriage rates. Perinatal and obstetrical outcomes were monitored as well. A total of 9,042 metaphase II oocytes were inseminated. The fertilization rate was significantly reduced in MMF, OAT-S, OA, and NOA compared with N (74.8%, 68.7%, 67.3%, and 53.1% vs. 77.2%). The blastocyst rate per fertilized oocyte was significantly reduced in MMF and NOA compared with N (48.6% and 40.6% vs. 49.3%). The timing of blastocyst development also was affected in OA and NOA. Logistic regression analysis adjusted for confounders highlighted NOA as a negative predictor of obtaining an euploid blastocyst per OPU (odds ratio 0.5). When the analysis was performed per obtained blastocyst, however, no correlation between male factor and euploidy rate was observed. Embryo transfers also resulted in similar live birth and miscarriage rates. No impact of sperm factor on obstetrical/perinatal outcomes was observed. Severe male factor impairs early embryonic competence in terms of fertilization rate and developmental potential. However, the euploidy rate and implantation potential of the obtained blastocysts are independent from sperm quality

Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

International Nuclear Information System (INIS)

Marx, Sebastian Markus

2014-01-01

The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

International Nuclear Information System (INIS)

Ragavan, Anpalaki J.

2006-01-01

Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

Development of ion beam sputtering techniques for actinide target preparation

International Nuclear Information System (INIS)

Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

1985-01-01

Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

Development of ion beam sputtering techniques for actinide target preparation

Science.gov (United States)

Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

1985-06-01

Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

International Nuclear Information System (INIS)

Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

1979-01-01

Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

48 CFR 1319.811-3 - Contract clauses.

Science.gov (United States)

2010-10-01

... shall insert the clause 1352.219-71, Notification to Delay Performance (Deviation), in solicitations and...) Direct Award (Deviation), in direct contracts and purchase orders processed under the Partnership... 1352.219-72, Notification of Competition Limited to Eligible 8(a) Concerns, Alternate III (Deviation...

Resposta de plantas micropropagadas de abacaxizeiro à inoculação de bactérias diazotróficas em casa de vegetação Response of pineapple plantlets to inoculation with diazotrophic bacteria in greenhouse

Directory of Open Access Journals (Sweden)

Olmar Baller Weber

2003-12-01

Full Text Available O objetivo deste trabalho foi selecionar e avaliar bactérias diazotróficas isoladas de abacaxizeiro (Ananas comosus (L. Merril no desenvolvimento de cultivares micropropagadas da mesma espécie em casa de vegetação. Plantas da cultivar Perolera foram submetidas à inoculação com Asaia bogorensis (AB219 e cultivadas em tubetes, durante 145 dias, com as misturas: casca de arroz carbonizada, folha de carnaubeira triturada e vermicomposto; casca de arroz carbonizada, pó da casca do coco maduro e vermicomposto; casca de arroz carbonizada, vermiculita e vermicomposto. Plantas da cultivar Primavera receberam inóculos com o AB219 e bactérias relacionadas a Burkholderia cepacia (AB202 e AB213, enquanto plantas das cultivares Pérola e Smooth Cayenne receberam AB219 e AB213, sendo cultivadas, por 140 dias, em tubetes com a mistura de vermicomposto e vermiculita. A colonização dos abacaxizeiros pelas bactérias diazotróficas foi confirmada. As plantas da cultivar Perolera cresceram melhor em casca de arroz carbonizada, vermiculita e vermicomposto e responderam positivamente ao AB219. Já as plantas da cultivar Primavera não apresentaram resposta significativa à inoculação com AB219, AB202 e AB213. Houve incremento de 23,1% a 38,5% na matéria seca de raízes das plantas da cultivar Pérola na presença de AB213 e AB219, respectivamente. A presença de AB213 incrementou em 15,2% a matéria seca da parte aérea das plantas da cultivar Smooth Cayenne. Os resultados revelam a eficiência de bactérias diazotróficas na promoção do crescimento de abacaxizeiros.The objective of this work was to select and to evaluate isolates of diazotrophic bacteria associated to pineapple (Ananas comosus (L. Merril plants in the development of micropropagated plantlets of cultivars pineapple in greenhouse. Plantlets from the Perolera cultivar have been submitted to inoculation with Asaia bogorensis (AB219 and were cultivated during 145 days on the following

The inhibition of IGF-1 signaling promotes proteostasis by enhancing protein aggregation and deposition.

Science.gov (United States)

Moll, Lorna; Ben-Gedalya, Tziona; Reuveni, Hadas; Cohen, Ehud

2016-04-01

The discovery that the alteration of aging by reducing the activity of the insulin/IGF-1 signaling (IIS) cascade protects nematodes and mice from neurodegeneration-linked, toxic protein aggregation (proteotoxicity) raises the prospect that IIS inhibitors bear therapeutic potential to counter neurodegenerative diseases. Recently, we reported that NT219, a highly efficient IGF-1 signaling inhibitor, protects model worms from the aggregation of amyloid β peptide and polyglutamine peptides that are linked to the manifestation of Alzheimer's and Huntington's diseases, respectively. Here, we employed cultured cell systems to investigate whether NT219 promotes protein homeostasis (proteostasis) in mammalian cells and to explore its underlying mechanisms. We found that NT219 enhances the aggregation of misfolded prion protein and promotes its deposition in quality control compartments known as "aggresomes." NT219 also elevates the levels of certain molecular chaperones but, surprisingly, reduces proteasome activity and impairs autophagy. Our findings show that IGF-1 signaling inhibitors in general and NT219 in particular can promote proteostasis in mammalian cells by hyperaggregating hazardous proteins, thereby bearing the potential to postpone the onset and slow the progression of neurodegenerative illnesses in the elderly.-Moll, L., Ben-Gedalya, T., Reuveni, H., Cohen, E. The inhibition of IGF-1 signaling promotes proteostasis by enhancing protein aggregation and deposition. © FASEB.

28 CFR 2.19 - Information considered.

Science.gov (United States)

2010-07-01

... is imprisoned about the financial, social, psychological, and emotional harm done to, or loss... Commission with specific facts and reasoning relevant to the statutory criteria for parole (18 U.S.C. 4206..., to be most helpful, a recommendation should state its underlying factual basis and reasoning. However...

12 CFR 219.3 - Cost reimbursement.

Science.gov (United States)

2010-01-01

... that the financial institution use programming or other higher level technical services of a computer... (private sector) set out in the Employment Cost Trends section of the National Compensation Survey (http... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S...

12 CFR 219.24 - Retention period.

Science.gov (United States)

2010-01-01

... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S... period of time, taking into consideration the nature of the record and the amount of time that has...

Publications | Page 219 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... (restricted access). Conventional energy generation is a fundamental cause for competing demands on natural resources of both water and energy sectors, and is a significant contributor to anthropogenic climate change. This research seeks to identify barriers to wide-scale penetration of renewable energy technologies.

Publications | Page 219 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Using Technology to Document Violations: Enabling Sex Worker Communities to Document Violence Against Them in India and Cambodia (open access). The project achieved the following; a significant shift in advocacy strategies from reactive to proactive strategies with a potential impact on the lives and wellbeing of ...

49 CFR 219.23 - Railroad policies.

Science.gov (United States)

2010-10-01

... approved forms for mandatory post-accident toxicological testing under subpart C of this part provides the... start of alcohol testing under the railroad's alcohol misuse prevention program and to each person... the work day the covered employee is required to be in compliance with this part is that period when...

Publications | Page 219 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Science-policy dialogues for water security : addressing vulnerability and adaptation to global change in the arid Americas (restricted access) ... Impact of maternal and child health private expenditure on poverty and inequity in Bangladesh : out-of-pocket payments by patients at Ministry of Health and Family Welfare ...

32 CFR 219.107 - IRB membership.

Science.gov (United States)

2010-07-01

... counsel in safeguarding the rights and welfare of human subjects. In addition to possessing the... subjects, such as children, prisoners, pregnant women, or handicapped or mentally disabled persons... IRB consists entirely of men or entirely of women, including the institution's consideration of...

77 FR 21161 - National Forest System Land Management Planning

Science.gov (United States)

2012-04-09

... 219 National Forest System Land Management Planning; Final Rule #0;#0;Federal Register / Vol. 77 , No... Forest Service 36 CFR Part 219 RIN 0596-AD02 National Forest System Land Management Planning AGENCY... Agriculture is adopting a new National Forest System land management planning rule (planning rule). The new...

Interdisciplinary Workshop on the Physical-Chemical-Biological Processes Affecting Archeological Sites Held in College Station, Texas on May 27-29, 1987

Science.gov (United States)

1989-01-01

8217The Nature and Status of Ethnobotany," Chronica Botanica , Vol 6, pp 219-221. Jones, Volney H. 1957. "Botany," The Identification of Non- artifactual...Chronica Botanica , Vol. 6, pp. 219-221. CULTURAL Ethnobotany, general JONES, VOLNEY H., 1957, Botany. In Taylor, W., (editor), The Identification of Non

76 FR 76318 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

Science.gov (United States)

2011-12-07

... Defense Business Transformation Agency Contracting Office. PART 204--ADMINISTRATIVE MATTERS 204.402...) * * * (iii) For special notices for small business events, follow the procedures at PGI 205.207(d)(ii). PART... Economy Act order. PART 219--SMALL BUSINESS PROGRAMS 0 22. Section 219.202-1 is added to read as follows...

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...

Browse Title Index

African Journals Online (AJOL)

Items 201 - 219 of 219 ... Vol 5 (2014), Understanding the legal fundamentals of project finance contracts, Abstract PDF. Grace Chinyere Young. Vol 7 (2016), Unfair dismissal in Nigeria: Imperative for a departure from the common law, Abstract PDF. Emmanuel OC Obidimma, MI Anushiem, UMJ Ekeneme. Vol 6 (2015), United ...

78 FR 9407 - Notice of Submission of Proposed Information Collection to OMB HOME Investment Partnerships Program

Science.gov (United States)

2013-02-08

... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... below has been submitted to the Office of Management and Budget (OMB) for review, as required by the...

Why Innovations in Agriculture are Necessary?

Indian Academy of Sciences (India)

... of people living below poverty line (21.9%, 2011-12). Ensuring food security for increasing population and for millions of people living below poverty line (21.9%, 2011-12). Major source of livelihood (about 54.5% workers are engaged in agriculture). Major demand driver for the growth of other sectors of the economy.

AcEST: BP912238 [AcEST

Lifescience Database Archive (English)

Full Text Available za... 219 1e-55 tr|A6N1H0|A6N1H0_ORYSI Magnesium-protoporphyrin ix monomethyl es... 219 1e-55 tr|Q40093|Q40093_IPONI PNIL34...LAEFEPQLVY 429 Y M P++SGSVD AEFEPQLVY Sbjct: 134 AYLMPPIESGSVDFAEFEPQLVY 156 >tr|Q40093|Q40093_IPONI PNIL34

Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

International Nuclear Information System (INIS)

Shiotsuki, Masao; Miyahara, Kaname

2003-01-01

The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

International Nuclear Information System (INIS)

Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.

2011-01-01

South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)

Soil nuclide distribution coefficients and their statistical distributions

International Nuclear Information System (INIS)

Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

1984-12-01

Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3

International Nuclear Information System (INIS)

McVey, C.B.

1994-01-01

This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms

Prevalence of mutations and functional analyses of melanocortin 4 receptor variants identified among 750 men with juvenile-onset obesity

DEFF Research Database (Denmark)

Larsen, Lesli H; Echwald, Søren Morgenthaler; Sørensen, Thorkild I A

2005-01-01

)) for mutations in MC4R. A total of 14 different mutations were identified of which two, Ala219Val and Leu325Phe, were novel variants. The variant receptor, Leu325Phe, was unable to bind [Nle4,d-Phe7]-alphaMSH, whereas the Ala219Val variant showed a significantly impaired melanotan II induction of cAMP, compared...

Establishment and biological characteristics of Piedmontese cattle ...

African Journals Online (AJOL)

use

2011-12-12

Dec 12, 2011 ... 2.30 ± 0.48. T. 12. 3.25 ± 0.17. T. 27. 2.19 ± 0.13. T. 13. 3.25 ± 0.29. T. 28. 2.19 ± 0.33. T. 14 .... technique has been used for many years and is still being used today, practice .... tissue culture and the nude mouse. Tissue Cell.

PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH

Directory of Open Access Journals (Sweden)

Sa'roni Sa'roni

2012-10-01

Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi

78 FR 54152 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines

Science.gov (United States)

2013-09-03

... Airworthiness Directives; Rolls-Royce plc Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT...; -535C-37; -535E4-37; - 535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211-524G2-19; - 524G3-19; -524H2-19; and -524H-36 turbofan engines. This AD requires a one-time inspection of the front combustion...

78 FR 20505 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines

Science.gov (United States)

2013-04-05

... Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking...; - 535E4-37; -535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211- 524G2-19; -524G3-19; -524H2-19; and -524H-36 turbofan engines. This proposed AD was prompted by the discovery of a cracked and...

Longitudinal view of the psychological correlates and antecedents of subjectively assessed psychosomatic problems

Czech Academy of Sciences Publication Activity Database

Slezáčková, Alena; Blatný, Marek; Millová, Katarína; Jelínek, Martin

2011-01-01

Roč. 26, č. 2 (2011), s. 219-219 ISSN 0887-0446. [European Health Psychology Conference: Engaging with Other Health Professions: Challenges and Perspectives /25./. 20.09.2011-24.09.2011, Hersonissos, Kréta] R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : psychosomatic problems * middle adulthood * subjectively assessed health Subject RIV: AN - Psychology

49 CFR 219.9 - Responsibility for compliance.

Science.gov (United States)

2010-10-01

..., or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed; and... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations; where a grossly...

219-IJBCS-Article-Dr R N -Nwaoguikpe

African Journals Online (AJOL)

RHUMSIKI

The mechanism of action of the drug is based on its ability to ... ml of distilled water were mixed with each extract, then ... for 48 hours. The two–liquid phase layers were then separated ... gravitational force of 1500 x g for 15 minutes using the ...

24 CFR 200.219 - Content of certification.

Science.gov (United States)

2010-04-01

... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Participation and Compliance Requirements... as a result of HUD audits, management reviews or other governmental investigations; (iv) There has... Federal Government or of a State Government from doing business with such Department or Agency; (vii) The...

219 ORIGINAL ARTICLE SEROPREVALENCE OF HEPATITIS C ...

African Journals Online (AJOL)

boaz

ABSTRACT. Background: Hepatitis C virus (HCV) infection is a major public health concern. The aim of this study was to ascertain the seroprevalence and risk factors of HCV antibodies among pregnant women in Anyigba, Kogi State North Central Nigeria. Materials and methods:Blood samples (5mls) were collected from ...

49 CFR 219.403 - Voluntary referral policy.

Science.gov (United States)

2010-10-01

... section, the railroad treats the referral and subsequent handling, including counseling and treatment, as confidential. (3) The railroad will, to the extent necessary for treatment and rehabilitation, grant the employee a leave of absence from the railroad for the period necessary to complete primary treatment and...

48 CFR 219.704 - Subcontracting plan requirements.

Science.gov (United States)

2010-10-01

... business firms specifically identified in the subcontracting plan. Notifications shall be in writing and... SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business... business concerns shall include subcontracts with historically black colleges and universities and minority...

49 CFR 219.213 - Unlawful refusals; consequences.

Science.gov (United States)

2010-10-01

... inconsistent with the employee's health, whether such refusal was made in good faith and based on medical..., as appropriate, also consider the following: (1) Whether the railroad made a good faith determination...

48 CFR 1052.219-71 - Subcontracting Plan.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Subcontracting Plan. 1052... Subcontracting Plan. As prescribed in DTAR 1019.708-70(b), insert the following provision: Subcontracting Plan (MAR 2002) As part of its initial proposal, each large business offeror must submit a contracting plan...

TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

International Nuclear Information System (INIS)

Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

2004-01-01

As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

Veterinary Laboratory Services Study - 1976.

Science.gov (United States)

1976-09-01

years. Many tests , such as ;uman pregnancy testing , Mycobacterium tuberculosis isolation and :iers have been converted to in—vitro procedures. Sheep...assignment in laboratories and worked in chemistry , mic robiology , or diagnostic areas can be directly uti l ized with little additional orientation. They...Chorionic Gonadotropin 475 730 17 1,222 UCG or Human Pregnancy 147 42 189 Tularemia 332 332 OX—19 211 211 Salmonella 219 219 Trichinella 17 17 Venipuncture

Několik poznámek k problematice ochrany duševního vlastnictví

Czech Academy of Sciences Publication Activity Database

Krejčí, Jindřich

2011-01-01

Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf

The Enemies List: The Foreign Terrorist Organization List and Its Role in Defining Terrorism

Science.gov (United States)

2014-03-01

seven days before the designation is published in the Federal Register, as section 219 of the Immigration and Nationality Act requires. Upon the...Organizations.” 38 Antiterrorism and Effective Death Penalty Act of 1996, 110 Stat. 1214 (amends § 219 of the Immigration and Nationality Act (Public Law...and the Israeli-occupied territories, Chile , Iran, and Cambodia. Table 1 reflects the list of communist FTOs designated prior to 9/11, and a

Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

International Nuclear Information System (INIS)

Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

2013-01-01

The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

A Rules-Based Algorithm to Prioritize Poor Prognosis Cancer Patients in Need of Advance Care Planning.

Science.gov (United States)

Bestvina, Christine M; Wroblewski, Kristen E; Daly, Bobby; Beach, Brittany; Chow, Selina; Hantel, Andrew; Malec, Monica; Huber, Michael T; Polite, Blase N

2018-03-13

Accurate understanding of the prognosis of an advanced cancer patient can lead to decreased aggressive care at the end of life and earlier hospice enrollment. Our goal was to determine the association between high-risk clinical events identified by a simple, rules-based algorithm and decreased overall survival, to target poor prognosis cancer patients who would urgently benefit from advanced care planning. A retrospective analysis was performed on outpatient oncology patients with an index visit from April 1, 2015, through June 30, 2015. We examined a three-month window for "high-risk events," defined as (1) change in chemotherapy, (2) emergency department (ED) visit, and (3) hospitalization. Patients were followed until January 31, 2017. A total of 219 patients receiving palliative chemotherapy at the University of Chicago Medicine with a prognosis of ≤12 months were included. The main outcome was overall survival, and each "high-risk event" was treated as a time-varying covariate in a Cox proportional hazards regression model to calculate a hazard ratio (HR) of death. A change in chemotherapy regimen, ED visit, hospitalization, and at least one high-risk event occurred in 54% (118/219), 10% (22/219), 26% (57/219), and 67% (146/219) of patients, respectively. The adjusted HR of death for patients with a high-risk event was 1.72 (95% confidence interval [CI] 1.19-2.46, p = 0.003), with hospitalization reaching significance (HR 2.74, 95% CI 1.84-4.09, p rules-based algorithm identified those with the greatest risk of death among a poor prognosis patient group. Implementation of this algorithm in the electronic health record can identify patients with increased urgency to address goals of care.

The protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation and increases sarcoplasmic/endoplasmic reticulum calcium ATPase 2 levels

International Nuclear Information System (INIS)

King, Taj D.; Gandy, Johanna C.; Bijur, Gautam N.

2006-01-01

The ubiquitously expressed protein glycogen synthase kinase-3 (GSK3) is constitutively active, however its activity is markedly diminished following phosphorylation of Ser21 of GSK3α and Ser9 of GSK3β. Although several kinases are known to phosphorylate Ser21/9 of GSK3, for example Akt, relatively much less is known about the mechanisms that cause the dephosphorylation of GSK3 at Ser21/9. In the present study KCl-induced plasma membrane depolarization of SH-SY5Y cells, which increases intracellular calcium concentrations caused a transient decrease in the phosphorylation of Akt at Thr308 and Ser473, and GSK3 at Ser21/9. Overexpression of the selective protein phosphatase-1 inhibitor protein, inhibitor-2, increased basal GSK3 phosphorylation at Ser21/9 and significantly blocked the KCl-induced dephosphorylation of GSK3β, but not GSK3α. The phosphorylation of Akt was not affected by the overexpression of inhibitor-2. GSK3 activity is known to affect sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) levels. Overexpression of inhibitor-2 or treatment of cells with the GSK3 inhibitors lithium and SB216763 increased the levels of SERCA2. These results indicate that the protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation induced by KCl and that GSK3 activity regulates SERCA2 levels

Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

Energy Technology Data Exchange (ETDEWEB)

Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

2011-03-15

Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

International Nuclear Information System (INIS)

Kulagin, N.A.

2011-01-01

Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.

Review of radionuclide source terms used for performance-assessment analyses

International Nuclear Information System (INIS)

Barnard, R.W.

1993-06-01

Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

Multi-Energy Processing for Novel Coating Technologies

Science.gov (United States)

2014-12-18

shape bounced back with increased inner flame lengths and reduced diameters. At 10.532 ^m, the length of the inner flame was the shortest, 3 mm, with a...brighter and shorter. At 10.22 ^m, the inner flame length was the shortest, 4 mm with 2 m expansion in diameter, indicating accelerated combustion...absorption rates less than 1/3 of that at 9 219 um the lame length shrank further and became brighter. With a laser irradiation at 9.219 ^m the flame

Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

Energy Technology Data Exchange (ETDEWEB)

Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

2011-02-07

Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

International Nuclear Information System (INIS)

Koyama, Mutsuo

1989-01-01

Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

The Shift of the Intestinal Microbiome in the Innate Immunity-Deficient Mutant rde-1 Strain of C. elegans upon Orsay Virus Infection.

Science.gov (United States)

Guo, Yuanyuan; Xun, Zhe; Coffman, Stephanie R; Chen, Feng

2017-01-01

The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host-virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 ( ne219 ) strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 ( ne219 ) mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 ( ne219 ) mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.

The Shift of the Intestinal Microbiome in the Innate Immunity-Deficient Mutant rde-1 Strain of C. elegans upon Orsay Virus Infection

Directory of Open Access Journals (Sweden)

Yuanyuan Guo

2017-05-01

Full Text Available The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host–virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 (ne219 strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 (ne219 mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 (ne219 mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.

49 CFR 219.300 - Mandatory reasonable suspicion testing.

Science.gov (United States)

2010-10-01

... or body odors of the employee. (2) A railroad must require a covered employee to submit to a drug... body odors of the employee. Such observations may include indications of the chronic and withdrawal...

36 CFR 219.21 - Social and economic sustainability.

Science.gov (United States)

2010-07-01

... AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Ecological, Social, and... national, regional, and local scales. Social analyses address human life-styles, cultures, attitudes... management on the well-being of communities and regions, and the net benefit of uses, values, products, or...

Dicty_cDB: SHE219 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available KXSRTLPFELIIALDXSLQAXGQLXLDD GESIQTYVDNKYSFIQFDVVSSPSSSAYKLQSTIXNNNYNGTASLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIX...SLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIXLK Frame B: knin*n*kknetfvfinyffcyciilxcwiiisiim*isr...fixvvvisfqlnqpphmlhqlmvfqlplkxlelyhln*llpwixhykqxvnyxwmm vnqfkpmliintlsfnsmlxphhlhlptnynqpxsitiimvpll*slilsk

29 CFR 1910.219 - Mechanical power-transmission apparatus.

Science.gov (United States)

2010-07-01

... dimensions specified in this paragraph shall apply to all guards, except horizontal overhead belts, rope... drives of twenty (20) inch centers or under shall be not less than one-fourth inch from the nearest... one-fourth (11/4) inches inside diameter, or larger. If made of metal shapes or bars, their section...

12 CFR 219.21 - Authority, purpose and scope.

Science.gov (United States)

2010-01-01

... amended by the Annunzio-Wylie Anti-Money Laundering Act of 1992 (Pub. L. 102-550, Title XV; 106 Stat. 3672... recordkeeping and reporting requirements will assist in the prosecution of money laundering activities and are...

1935 15' Quad #219 Aerial Photo Mosaic Index

Data.gov (United States)

Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

49 CFR 397.219 - Waiver determination and order.

Science.gov (United States)

2010-10-01

... rational basis; (3) Whether the highway routing designation of the State, political subdivision thereof, or... readily identifiable by the Administrator as one who may be affected by the order. A copy of each order is... with § 397.223, an order issued under this section constitutes the final agency decision regarding...

48 CFR 1552.219-70 - Mentor-Protege Program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor-Protege Program... Mentor-Protege Program. As prescribed in 1519.203(a), insert the following clause: Mentor-Protege Program OCT 2000 (a) The Contractor has been approved to participate in the EPA Mentor-Protege program. The...

49 CFR 219.405 - Co-worker report policy.

Science.gov (United States)

2010-10-01

... dependence on alcohol or a drug or by another identifiable and treatable mental or physical disorder... and treatable mental or physical disorder— (1) The railroad must return the employee to service within... effects of alcohol and drugs on occupational or transportation safety. (f) Follow-up tests. A railroad may...

47 CFR 90.219 - Use of signal boosters.

Science.gov (United States)

2010-10-01

... to operate radio systems in the frequency bands above 150 MHz may employ signal boosters at fixed... fill in only weak signal areas and cannot extend the system's normal signal coverage area. (b) Class A... effective radiated power (ERP) of the unit to a maximum of 5 watts under all conditions. Class B broadband...

49 CFR 1544.219 - Carriage of accessible weapons.

Science.gov (United States)

2010-10-01

...) Flights for which screening is conducted. The provisions of § 1544.201(d), with respect to accessible weapons, do not apply to a law enforcement officer (LEO) aboard a flight for which screening is required..., county, or state law enforcement officer who is a direct employee of a government agency. (ii) Be sworn...

Dicty_cDB: VHD219 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available igf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtsp...lihligf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtspeng*r*qwmvdaqslkeviillt

Monolithic Hybrid and Passive Mode-Locked 40GHz Quantum Dot Laser Diodes

DEFF Research Database (Denmark)

Thompson, M. G.; Larsson, David; Rae, A. R.

2006-01-01

For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs.......For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs....

A Study of Selected Isozymes in Capsicum baccatum, Capsicum eximium, Capsicum cardenasii and Two Interspecific F1 Hybrids in Capsicum Species

OpenAIRE

ONUS, Ahmet Naci

2014-01-01

Selected isozymes were investigated in plants of Capsicum baccatum L. ( Solanaceae) accessions SA219 (P.G.Smith), Hawkes 6489 (P.G.Smith), Capsicum cardenasii Heiser and Smith accession SA268 (P.G.Smith), Capsicum eximium A.T.Hunz accession Hawkes 3860 (J.G.Hawkes) and two interspecific F1 hybrids, C. baccatum SA219 x C. eximium Hawkes 3860 and C. baccatum Hawkes 6489 x C. cardenasii SA 268. The standard technique of horizontal gel electrophoresis was employed. The gel was cut into severa...

ORF Alignment: NC_002696 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 219 ... Query: 38 ... RVLLFQPFTIPSASMEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI 97 ... RVLLFQPFTIPSAS...MEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI Sbjct: 1 ... RVLLFQPFTIPSASMEPNLYQGDYI

Quantifying Unnecessary Normal Tissue Complication Risks due to Suboptimal Planning: A Secondary Study of RTOG 0126

International Nuclear Information System (INIS)

Moore, Kevin L.; Schmidt, Rachel; Moiseenko, Vitali; Olsen, Lindsey A.; Tan, Jun; Xiao, Ying; Galvin, James; Pugh, Stephanie; Seider, Michael J.; Dicker, Adam P.; Bosch, Walter; Michalski, Jeff; Mutic, Sasa

2015-01-01

Purpose: The purpose of this study was to quantify the frequency and clinical severity of quality deficiencies in intensity modulated radiation therapy (IMRT) planning in the Radiation Therapy Oncology Group 0126 protocol. Methods and Materials: A total of 219 IMRT patients from the high-dose arm (79.2 Gy) of RTOG 0126 were analyzed. To quantify plan quality, we used established knowledge-based methods for patient-specific dose-volume histogram (DVH) prediction of organs at risk and a Lyman-Kutcher-Burman (LKB) model for grade ≥2 rectal complications to convert DVHs into normal tissue complication probabilities (NTCPs). The LKB model was validated by fitting dose-response parameters relative to observed toxicities. The 90th percentile (22 of 219) of plans with the lowest excess risk (difference between clinical and model-predicted NTCP) were used to create a model for the presumed best practices in the protocol (pDVH 0126,top10% ). Applying the resultant model to the entire sample enabled comparisons between DVHs that patients could have received to DVHs they actually received. Excess risk quantified the clinical impact of suboptimal planning. Accuracy of pDVH predictions was validated by replanning 30 of 219 patients (13.7%), including equal numbers of presumed “high-quality,” “low-quality,” and randomly sampled plans. NTCP-predicted toxicities were compared to adverse events on protocol. Results: Existing models showed that bladder-sparing variations were less prevalent than rectum quality variations and that increased rectal sparing was not correlated with target metrics (dose received by 98% and 2% of the PTV, respectively). Observed toxicities were consistent with current LKB parameters. Converting DVH and pDVH 0126,top10% to rectal NTCPs, we observed 94 of 219 patients (42.9%) with ≥5% excess risk, 20 of 219 patients (9.1%) with ≥10% excess risk, and 2 of 219 patients (0.9%) with ≥15% excess risk. Replanning demonstrated the predicted NTCP

Quantifying Unnecessary Normal Tissue Complication Risks due to Suboptimal Planning: A Secondary Study of RTOG 0126.

Science.gov (United States)

Moore, Kevin L; Schmidt, Rachel; Moiseenko, Vitali; Olsen, Lindsey A; Tan, Jun; Xiao, Ying; Galvin, James; Pugh, Stephanie; Seider, Michael J; Dicker, Adam P; Bosch, Walter; Michalski, Jeff; Mutic, Sasa

2015-06-01

The purpose of this study was to quantify the frequency and clinical severity of quality deficiencies in intensity modulated radiation therapy (IMRT) planning in the Radiation Therapy Oncology Group 0126 protocol. A total of 219 IMRT patients from the high-dose arm (79.2 Gy) of RTOG 0126 were analyzed. To quantify plan quality, we used established knowledge-based methods for patient-specific dose-volume histogram (DVH) prediction of organs at risk and a Lyman-Kutcher-Burman (LKB) model for grade ≥2 rectal complications to convert DVHs into normal tissue complication probabilities (NTCPs). The LKB model was validated by fitting dose-response parameters relative to observed toxicities. The 90th percentile (22 of 219) of plans with the lowest excess risk (difference between clinical and model-predicted NTCP) were used to create a model for the presumed best practices in the protocol (pDVH0126,top10%). Applying the resultant model to the entire sample enabled comparisons between DVHs that patients could have received to DVHs they actually received. Excess risk quantified the clinical impact of suboptimal planning. Accuracy of pDVH predictions was validated by replanning 30 of 219 patients (13.7%), including equal numbers of presumed "high-quality," "low-quality," and randomly sampled plans. NTCP-predicted toxicities were compared to adverse events on protocol. Existing models showed that bladder-sparing variations were less prevalent than rectum quality variations and that increased rectal sparing was not correlated with target metrics (dose received by 98% and 2% of the PTV, respectively). Observed toxicities were consistent with current LKB parameters. Converting DVH and pDVH0126,top10% to rectal NTCPs, we observed 94 of 219 patients (42.9%) with ≥5% excess risk, 20 of 219 patients (9.1%) with ≥10% excess risk, and 2 of 219 patients (0.9%) with ≥15% excess risk. Replanning demonstrated the predicted NTCP reductions while maintaining the volume of the PTV

Association of ATP-Binding Cassette Transporter A1 Gene Polymorphisms in Type 2 Diabetes Mellitus among Malaysians

Directory of Open Access Journals (Sweden)

Polin Haghvirdizadeh

2015-01-01

Full Text Available Background. Type 2 diabetes mellitus (T2DM is a complex polygenic disorder characterized by impaired insulin resistance, insulin secretion, and dysregulation of lipid and protein metabolism with environmental and genetic factors. ATP-binding cassette transporter A1 (ABCA1 gene polymorphisms are reported as the one of the genetic risk factors for T2DM in various populations with conflicting results. This study was conducted based on PCR-HRM to determine the frequency of ABCA1 gene by rs2230806 (R219K, rs1800977 (C69T, and rs9282541 (R230C polymorphisms Malaysian subjects. Methods. A total of 164 T2DM and 165 controls were recruited and their genotypes for ABCA1 gene polymorphisms were determined based on the real time high resolution melting analysis. Results. There was a significant difference between the subjects in terms of age, BMI, FPG, HbA1c, HDL, LDL, and TG P<0.05. There was a significant association between HOM of R219K P=0.005, among Malaysian subjects; moreover, allele frequency revealed the significant difference in A allele of R219K P=0.003. But, there was no significant difference in genotypic and allelic frequencies of C69T and R230C polymorphism. Conclusion. R219K polymorphism of ABCA1 gene can be considered as a genetic risk factor for T2DM subjects among Malaysians.

ORF Alignment: NC_006582 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ] ... Length = 219 ... Query: 8 ... WNDVIGGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH 67 ... WNDVI...GGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH Sbjct: 1 ... WNDVI

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 109 ... Query: 219 ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 27...8 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA Sbjct: 1 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 60 ...

ORF Alignment: NC_004061 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 84 ... Query: 160 IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVI...FFKINF 219 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF Sbjct: 1 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF 60 ...

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 70 ... Query: 219 DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 278 ... DKLKRALEAERSFTANSAHEL...RTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR Sbjct: 1 ... DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 60 ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41

Laser spectroscopy of francium isotopes at the borders of the region of reflection asymmetry

CERN Document Server

Budinčević, I; Bissell, M L; Cocolios, T E; de Groote, R P; De Schepper, S; Fedosseev, V N; Flanagan, K T; Franchoo, S; Garcia Ruiz, R F; Heylen, H; Lynch, K M; Marsh, B A; Neyens, G; Procter, T J; Rossel, R E; Rothe, S; Strashnov, I; Stroke, H H; Wendt, K D A

2014-01-01

The magnetic dipole moments and changes in mean-square charge radii of the neutron-rich $^{218m,219,229,231}\\text{Fr}$ isotopes were measured with the newly-installed Collinear Resonance Ionization Spectroscopy (CRIS) beam line at ISOLDE, CERN, probing the $7s~^{2}S_{1/2}$ to $8p~^{2}P_{3/2}$ atomic transition. The $\\delta\\langle r^{2}\\rangle^{A,221}$ values for $^{218m,219}\\text{Fr}$ and $^{229,231}\\text{Fr}$ follow the observed increasing slope of the charge radii beyond $N~=~126$. The charge radii odd-even staggering in this neutron-rich region is discussed, showing that $^{220}\\text{Fr}$ has a weakly inverted odd-even staggering while $^{228}\\text{Fr}$ has normal staggering. This suggests that both isotopes reside at the borders of a region of inverted staggering, which has been associated with reflection-asymmetric shapes. The $g(^{219}\\text{Fr}) = +0.69(1)$ value supports a $\\pi 1h_{9/2}$ shell model configuration for the ground state. The $g(^{229,231}\\text{Fr})$ values support the tentative $I^{\\pi}(^...

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 0000004359 [Cryptosporidium hominis] ... Length = 172 ... Query: 219 DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDK...NQQDCIDINECQENSGLGPCEFGCK 278 ... DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCK Sbjct: 1 ... DIDECKEGSHSCSHICVNTR

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ASSNQLSALPELPV Sbjct: 1 ... SETSLDLSCLGLRSLPRLPDNLDEINVSNNQLSMLPELPRALKELNASSNQLSALPELPV 60 ... Query: 180 RDDHIIRIFWLNQNRITAIPE...SILGLSSDSVVNLRENQLS 219 ... RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS Sbjct: 121 RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS 160

ORF Alignment: NC_004347 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available -1] ... Length = 219 ... Query: 21 ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 80 ... ... ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK Sbjct: 1 ... AA...EPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 60 ... Query: 141 YTYPTDFMDNTKITRFEAKSDAQILEMLVRGRVD

Emanations and 'induced' radioactivity: from mystery to (mis)use

International Nuclear Information System (INIS)

Kolar, Z.I.

1999-01-01

The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

International Nuclear Information System (INIS)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung

2014-01-01

The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

Energy Technology Data Exchange (ETDEWEB)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

2014-05-15

The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.

30 CFR 219.410 - What does this subpart contain?

Science.gov (United States)

2010-07-01

... GOMESA revenues are reserved for the following purposes: (1) Projects and activities for the purposes of... projects. (5) Planning assistance and administrative costs not-to-exceed 3 percent of the amounts received... Center, Building 85; MS-350B1; Denver, CO 80225-0165, or at (303) 231-3429. ...

34 CFR 685.219 - Public Service Loan Forgiveness Program.

Science.gov (United States)

2010-07-01

... duty for training or attendance at a service school. For civilians, “Military service” means service on... Revenue Code; (4) A Tribal college or university; or (5) A private organization that— (i) Provides the following public services: Emergency management, military service, public safety, law enforcement, public...

48 CFR 52.219-16 - Liquidated Damages-Subcontracting Plan.

Science.gov (United States)

2010-10-01

... following clause: Liquidated Damages—Subcontracting Plan (JAN 1999) (a) Failure to make a good faith effort... has failed to make such good faith effort, the Contracting Officer shall give the Contractor written notice specifying the failure and permitting the Contractor to demonstrate what good faith efforts have...

37 CFR 2.19 - Revocation or withdrawal of attorney.

Science.gov (United States)

2010-07-01

...., a corporate officer or general partner of a partnership). In the case of joint applicants or joint... a trademark case may withdraw upon application to and approval by the Director or, when applicable..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized...

49 CFR 219.101 - Alcohol and drug use prohibited.

Science.gov (United States)

2010-10-01

...) Under the influence of or impaired by alcohol; (ii) Having .04 or more alcohol concentration in the breath or blood; or (iii) Under the influence of or impaired by any controlled substance. (3) No employee... distribution is through documented over the counter sales (Schedule V only). (c) Railroad rules. Nothing in...

49 CFR 219.203 - Responsibilities of railroads and employees.

Science.gov (United States)

2010-10-01

... duty tour. An employee who has been transported to receive medical care is not released from duty for... testing does not excuse such refusal by the employee timely to provide the required specimens. (c) Place...

32 CFR 219.116 - General requirements for informed consent.

Science.gov (United States)

2010-07-01

... statement that participation is voluntary, refusal to participate will involve no penalty or loss of...) Nothing in this policy is intended to limit the authority of a physician to provide emergency medical care...

48 CFR 652.219-73 - Mentor Requirements and Evaluation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in 619.202-70(o)(2), insert the following clause: Mentor Requirements and Evaluation (APR 2004) (a) Mentor and protégé firms shall submit an evaluation to...

48 CFR 1052.219-75 - Mentor Requirements and Evaluation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in DTAR 1019.202-70, insert the following clause: Mentor Requirements and Evaluation (JAN 2000) (a) Mentor and protégé firms shall submit an evaluation to...

All projects related to | Page 219 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Integrated Approach to Address Food and Nutrition Security in the ... Could integrated garden and nutrition programs at schools help address the problem? .... LABOUR POLICY, GENDER EQUALITY, ECONOMIC ANALYSIS, LABOUR ...

Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs).

Science.gov (United States)

Haslach, Erica M; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G; Giulianotti, Marc A; Pinilla, Clemencia; Appel, Jon R; Doering, Skye R; Walters, Michael A; Houghten, Richard A; Haskell-Luevano, Carrie

2014-06-12

Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseases symptoms associated with obesity including type 2 diabetes. Several hMC4 SNP receptors have been pharmacologically characterized in vitro to have a decreased, or a lack of response, to endogenous agonists such as α-, β-, and γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin hormone (ACTH). Herein we report the use of a mixture based positional scanning combinatorial tetrapeptide library to discover molecules with nM full agonist potency and efficacy to the L106P, I69T, I102S, A219V, C271Y, and C271R hMC4Rs. The most potent compounds at all these hMC4R SNPs include Ac-His-(pI)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Arg-(pI)Phe-NH2, and Ac-Arg-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, revealing new ligand pharmacophore models for melanocortin receptor drug design strategies.

Fungal and plant gene expression during the colonization of cacao seedlings by endophytic isolates of four Trichoderma species.

Science.gov (United States)

Bailey, B A; Bae, H; Strem, M D; Roberts, D P; Thomas, S E; Crozier, J; Samuels, G J; Choi, Ik-Young; Holmes, K A

2006-11-01

Endophytic isolates of Trichoderma species are being considered as biocontrol agents for diseases of Theobroma cacao (cacao). Gene expression was studied during the interaction between cacao seedlings and four endophytic Trichoderma isolates, T. ovalisporum-DIS 70a, T. hamatum-DIS 219b, T. harzianum-DIS 219f, and Trichoderma sp.-DIS 172ai. Isolates DIS 70a, DIS 219b, and DIS 219f were mycoparasitic on the pathogen Moniliophthora roreri, and DIS 172ai produced metabolites that inhibited growth of M. roreri in culture. ESTs (116) responsive to endophytic colonization of cacao were identified using differential display and their expression analyzed using macroarrays. Nineteen cacao ESTs and 17 Trichoderma ESTs were chosen for real-time quantitative PCR analysis. Seven cacao ESTs were induced during colonization by the Trichoderma isolates. These included putative genes for ornithine decarboxylase (P1), GST-like proteins (P4), zinc finger protein (P13), wound-induced protein (P26), EF-calcium-binding protein (P29), carbohydrate oxidase (P59), and an unknown protein (U4). Two plant ESTs, extensin-like protein (P12) and major intrinsic protein (P31), were repressed due to colonization. The plant gene expression profile was dependent on the Trichoderma isolate colonizing the cacao seedling. The fungal ESTs induced in colonized cacao seedlings also varied with the Trichoderma isolate used. The most highly induced fungal ESTs were putative glucosyl hydrolase family 2 (F3), glucosyl hydrolase family 7 (F7), serine protease (F11), and alcohol oxidase (F19). The pattern of altered gene expression suggests a complex system of genetic cross talk occurs between the cacao tree and Trichoderma isolates during the establishment of the endophytic association.

DIFFERENTIAL RESPONSE OF CLONES OF EUCALYPT TO GLYPHOSATE1

Directory of Open Access Journals (Sweden)

Leonardo Bianco de Carvalho

2015-02-01

Full Text Available Weed control is commonly performed by the inter-row mechanical weeding associated to intrarow glyphosate directed spraying, causing a risk for drift or accidental herbicide application, that can affect the crop of interest. The objective was to evaluate the response of clones C219, GG100, I144, and I224 of eucalypt (Eucalyptus grandis x E. urophylla to glyphosate doses of 0, 18, 36, 72, 180, 360, and 720 g of acid equivalent per hectare. The clones showed different growth patterns with regard to height, leaf number, stem dry weight, relative growth rate, net assimilation rate, and relative leaf growth rate. The clones I144 and GG100 were more susceptible to glyphosate, showing the doses required to reduce dry weight by 50% of 113.4 and 119.6 g acid equivalent per hectare, respectively. The clones C219 and I224 were less susceptible to glyphosate, showing the doses required to reduce dry weight by 50% of 237.5 and 313.5 g acid equivalent per hectare, respectively. Eucalyptus clones respond differently to glyphosate exposure, so that among I224, C219, GG100, and I144, the susceptibility to the herbicide is increasing.

Fifth international symposium on the natural radiation environment (NRE - V). Book of abstracts

International Nuclear Information System (INIS)

1991-01-01

Most of the 219 contributions Are on radon (to a much lesser extent: thoron) and its daughter products in dwellings and in the environment; on corresponding measuring instruments and - methods; on measurements done; and on radiation doses to professional workers and to the public. The section heading give a fairly good account of the subject matters treated. Measurement Techniques and Metrology (Nrs 1-33); Exposure to Natural Radiation in Non-Domestic Environments (34-56); Natural Radionuclides and Transfer Pathways (57-107); Radioactivity and Radiation in the Human Environment (108-183); Health Effects of Natural Radiation (184-205); Industrially Modified Levels of Radiation Exposure (206-219). (Quittner)

ORF Alignment: EHA1 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG

ORF Alignment: EHA1 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV

Ultralow-dose CT of the craniofacial bone for navigated surgery using adaptive statistical iterative reconstruction and model-based iterative reconstruction: 2D and 3D image quality.

Science.gov (United States)

Widmann, Gerlig; Schullian, Peter; Gassner, Eva-Maria; Hoermann, Romed; Bale, Reto; Puelacher, Wolfgang

2015-03-01

OBJECTIVE. The purpose of this article is to evaluate 2D and 3D image quality of high-resolution ultralow-dose CT images of the craniofacial bone for navigated surgery using adaptive statistical iterative reconstruction (ASIR) and model-based iterative reconstruction (MBIR) in comparison with standard filtered backprojection (FBP). MATERIALS AND METHODS. A formalin-fixed human cadaver head was scanned using a clinical reference protocol at a CT dose index volume of 30.48 mGy and a series of five ultralow-dose protocols at 3.48, 2.19, 0.82, 0.44, and 0.22 mGy using FBP and ASIR at 50% (ASIR-50), ASIR at 100% (ASIR-100), and MBIR. Blinded 2D axial and 3D volume-rendered images were compared with each other by three readers using top-down scoring. Scores were analyzed per protocol or dose and reconstruction. All images were compared with the FBP reference at 30.48 mGy. A nonparametric Mann-Whitney U test was used. Statistical significance was set at p ASIR-100 at 3.48 mGy, ASIR-100 at 2.19 mGy, and MBIR at 0.82 mGy. MBIR at 2.19 and 3.48 mGy scored statistically significantly better than the FBP reference (p = 0.032 and 0.001, respectively). For 3D images, the FBP reference at 30.48 mGy did not statistically significantly differ from all reconstructions at 3.48 mGy; FBP and ASIR-100 at 2.19 mGy; FBP, ASIR-100, and MBIR at 0.82 mGy; MBIR at 0.44 mGy; and MBIR at 0.22 mGy. CONCLUSION. MBIR (2D and 3D) and ASIR-100 (2D) may significantly improve subjective image quality of ultralow-dose images and may allow more than 90% dose reductions.

Fracture risk by HIV infection status in perinatally HIV-exposed children.

Science.gov (United States)

Siberry, George K; Li, Hong; Jacobson, Denise

2012-03-01

The objective of this study was to examine the incidence of fractures in HIV-infected children and comparable HIV-exposed, uninfected (HEU) children in a multicenter, prospective cohort study (PACTG 219/219C) in the United States. The main outcome was first fracture during the risk period. Nine fractures occurred in 7 of 1326 HIV-infected and 2 of 649 HEU children, corresponding to incidence rates of 1.2 per 1000 person-years and 1.1 per 1000 person-years, respectively. The incidence rate ratio was 1.1 (95% CI 0.2, 5.5). There was no evidence of a substantially increased risk of fracture in HIV-infected compared to HEU children.

Kvartérní geologická stavba historického jádra města Brna: aplikace poznatků ze stavby kolektorů

Czech Academy of Sciences Publication Activity Database

Lisá, Lenka; Zapletalová, D.; Pecka, M.; Zůbek, A.; Mroczek, P.

2006-01-01

Roč. 91, - (2006), s. 219-226 ISSN 1211-8796 Institutional research plan: CEZ:AV0Z30130516 Keywords : collector channels * sedimentology * micromorphology * Quaternary Subject RIV: DB - Geology ; Mineralogy

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

Energy Technology Data Exchange (ETDEWEB)

NA

2004-11-22

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

Generalized phase diagram for the rare-earth elements: Calculations and correlations of bulk properties

International Nuclear Information System (INIS)

Johansson, B.; Rosengren, A.

1975-01-01

A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K

Setkání bulharistů - Třetí mezinárodní kongres bulharistiky

Czech Academy of Sciences Publication Activity Database

Havlíková, Lubomíra

2014-01-01

Roč. 100, č. 1 (2014), s. 219-221 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian studies * International Congresses * history * philology * Cyrillo-Methodian studies Subject RIV: AB - History

Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP

OpenAIRE

Alvarez von Zerboni di Sposetti, Manuel

2003-01-01

Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP / von Manuel Alvarez und Stefan Wotschofsky. - 2., neubearb. und erw. Aufl. - Berlin : Erich Schmidt, 2003. - XX, 219 S. [1. Aufl. 2000

48 CFR 52.219-12 - Special 8(a) Subcontract Conditions.

Science.gov (United States)

2010-10-01

... all of the requirements of Contract No. __ [insert number of contract] for the consideration stated... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... into Contract No. __ [insert number of contract] with the __ [insert name of contracting agency] to...

People and things. CERN Courier, November 1981, v. 21(9)

International Nuclear Information System (INIS)

Anon.

1981-01-01

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. At the end of August a circulating electron beam was achieved for the first time in the VUV (vacuum ultraviolet) ring of the US National Synchrotron Light Source at Brookhaven. Commissioning of the X-ray ring of the NSLS is imminent. From 11-14 January, an International Colloquium on Baryon Nonconservation (ICOBAN) will be held at the Tata Institute of Fundamental Research, Bombay.From 17-23 February an International Conference on Instrumentation for Colliding Beam Physics will be held at the Stanford Linear Accelerator Center. A Europhysics Conference on 'Computing in Accelerator Design and Operation' will be held in Warsaw from 21-24 September 1982. A team at Los Alamos, led by Charles Brau, has demonstrated the principle of a high efficiency free electron laser. Work has started on a prototype magnet to confirm the design of a 2 GeV electron microtron under study at Argonne for use in nuclear and particle physics research. On 2 October a new ion source and injector system, known as ABEL, was inaugurated at Berkeley. The X-ray synchrotron radiation produced by electron storage rings could provide improved diagnosis in conditions such as coronary artery disease. Fermilab is proposing to set up an on-site Latin America Center for Fundamental Physics and Technology to assist scientists and engineers from developing countries

48 CFR 552.219-74 - Section 8(a) Direct Award.

Science.gov (United States)

2010-10-01

... contracting activity shall give advance notice to SBA before it issues a final notice terminating performance... prior to processing any advance payments or novation agreements. The contracting activity may assign contract administration functions to a contract administration office. (c) The Contractor agrees: (1) To...

75 FR 219 - Availability of Funds and Collection of Checks

Science.gov (United States)

2010-01-05

...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0.... FOR FURTHER INFORMATION CONTACT: Jeffrey S. H. Yeganeh, Financial Services Manager (202/728-5801), or...

Fission in Empire-II version 2.19 beta1, Lodi

International Nuclear Information System (INIS)

Sin, M.

2003-01-01

This is a description of the fission model implemented presently in EMPIRE-II. This package offers two ways to calculate the fission probability selected by parameters in the optional input. Fission barriers, fission transmission coefficients, fission cross sections and fission files are calculated

Evaluation report on SCTF Core-II test S2-19

International Nuclear Information System (INIS)

Ohnuki, Akira; Iwamura, Takamichi; Iguchi, Tadashi; Abe, Yutaka; Murao, Yoshio; Adachi, Hiromichi.

1991-03-01

Experimental studies using Slab Core Test Facility (SCTF) have revealed that the heat transfer enhancement in higher power bundles is mainly governed by the radial power ratio in core during the reflood in PWR-LOCA. As a physical mechanism for the heat transfer enhancement, it can be considered from the experimental evidence that the increase of upward steam flow rate in a higher power bundle which is caused by the higher steam production rate in the bundle gives the higher upward liquid flow rate in the bundle and the increase of the liquid flow rate gives the heat transfer enhancement. In order to develop a mechanistic model for the heat transfer enhancement based on this idea, the following relations should be identified quantitatively: (1) Relation between the steam production rate and the upward liquid flow rate, (2) Cross flow rate above the quench front and (3) Relation between the degree of heat transfer enhancement due to radial power ratio and the amount of increase of upward liquid flow rate. In this report, the above relation (3) was investigated experimentally as a step to develop the mechanistic model using the SCTF where the relation between the radial power ratio and the heat transfer enhancement has been made clear quantitatively. The degree of increase of heat transfer between two forced feed tests with the different flow rate in LPCI period was compared with the degree of heat transfer enhancement under a radial power ratio in the previous SCTF tests. The two forced feed tests were performed under the condition without any significant two-dimensional hydraulic behavior in core. The ratio of the mass flow rate between the two tests was about double. (author)

32 CFR 219.101 - To what does this policy apply?

Science.gov (United States)

2010-07-01

..., such as (i) research on regular and special education instructional strategies, or (ii) research on the effectiveness of or the comparison among instructional techniques, curricula, or classroom management methods... as provided in paragraph (b) of this section, this policy applies to all research involving human...

14 CFR 125.219 - Oxygen for medical use by passengers.

Science.gov (United States)

2010-01-01

... in conformity with the manufacturing, packaging, marking, labeling, and maintenance requirements of... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Instrument and..., maintained under the certificate holder's approved maintenance program; (iii) Free of flammable contaminants...

Cationization of heparin for film applications

Czech Academy of Sciences Publication Activity Database

Šimkovic, I.; Mendichi, R.; Kelnar, Ivan; Filip, J.; Hricovíni, M.

2015-01-01

Roč. 115, 22 January (2015), s. 551-558 ISSN 0144-8617 Institutional support: RVO:61389013 Keywords : heparin * cationization * NMR Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.219, year: 2015

Download this PDF file

African Journals Online (AJOL)

Timothy Ademakinwa

Keywords: Incubator, Biogas, Chicken egg, Temperature, Relative humidity, Hatchability. ABSTRACT. 219 ... hatching results are obtained with normal atmospheric air, which usually ... mixture of animal manures (cow dung, poultry and swine ...

48 CFR 1652.000 - Applicable clauses.

Science.gov (United States)

2010-10-01

.... 52.222-4Contract Work Hours and Safety Standards Act—Overtime Compensation—General. 52.222... Postretirement Benefits Other Than Pensions (PRB). 52.219-8Utilization of Small, Small Disadvantaged and Women...

Varianty Gellnerovy komedie Přístav manželství jako rozcestník jeho tvorby

Czech Academy of Sciences Publication Activity Database

Peisertová, Lucie

2012-01-01

Roč. 44, č. 2012 (2012), s. 201-219 ISSN 0231-5904 Institutional support: RVO:68378068 Keywords : Czech drama * Gellner, František * textual criticism Subject RIV: AJ - Letters, Mass-media, Audiovision

Arbuscular mycorrhizal fungi associating with roots of Alnus and Rubus in Europe and the Middle East

Czech Academy of Sciences Publication Activity Database

Pölme, S.; Öpik, M.; Moora, M.; Zobel, M.; Kohout, Petr; Oja, J.; Köljalg, U.; Tedersoo, L.

2016-01-01

Roč. 24, Part A (2016), s. 27-34 ISSN 1754-5048 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * fungi * biogeography Subject RIV: EH - Ecology, Behaviour Impact factor: 3.219, year: 2016

Clinical effect of Fuzheng quyu therapy in patients undergoing ...

African Journals Online (AJOL)

Tropical Journal of Pharmaceutical Research January 2017; 16 (1): 219-224 ... cervical carcinoma surgery, thus suggesting its potential clinical applications. ..... surgery. However, further clinical investigations before it can be recommended for ...

Antická dramata Jaroslava Vrchlického a jejich dobová recepce

Czech Academy of Sciences Publication Activity Database

Čadková, Daniela

2013-01-01

Roč. 136, 1-2 (2013), s. 189-219 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : J. Vrchlický * drama * National Theatre * classical tradition Subject RIV: AJ - Letters, Mass-media, Audiovision

Investigating the roles of MicroRNAs in biotic stress response induced by Rhizoctonia solani in rice

Energy Technology Data Exchange (ETDEWEB)

Syuhada, O. Nurfarahana; Kalaivani, N. [School of Environmental and Natural Resource Sciences, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)

2014-09-03

Sheath blight disease, caused by Rhizoctonia solani 1802/KB was screened on two rice varieties, Oryza sativaindica cultivar MR219 and Oryza sativa indica cultivar UKMRC9. The disease symptom was severe in MR219 compared to UKMRC9. Total RNA from R. solani 1802/KB, infected rice leaves of MR219 and infected rice leaves of UKMRC9 were extracted using TRIzol reagent, purified and sent for small RNA sequencing. Three miRNA libraries were generated and analyzed. The libraries generated 65 805, 78 512 and 81 325 known miRNAs respectively. The structure of miRNA of these samples was predicted. The up-regulated and down-regulated of miRNAs target gene prediction and its target functions were discovered and were mainly related to the growth and development of metabolism, protein transport, transcriptional regulation, stress response, and hormone signaling and electron transfer. Sheath blight-induced differential expression of known miRNAs tends to targetMYB transcription factor, F-box proteins, NBS-LRR, leucine-rich repeat receptor protein kinases and zinc finger proteins. Detecting new miRNAs and measuring the expression profiles of known miRNAs is an important tasks required for a better understanding of various biological conditions. Therefore, further analysis using Gene Ontology Slim will be conducted to deduce some biological information from the datasets obtained.

Varietal improvement of irrigated rice under minimal water conditions

International Nuclear Information System (INIS)

Abdul Rahim Harun; Marziah Mahmood; Sobri Hussein

2010-01-01

Varietal improvement of irrigated rice under minimal water condition is a research project under Program Research of Sustainable Production of High Yielding Irrigated Rice under Minimal Water Input (IRPA- 01-01-03-0000/ PR0068/ 0504). Several agencies were involved in this project such as Malaysian Nuclear Agency (MNA), Malaysian Agricultural Research and Development Institute (MARDI), Universiti Putra Malaysia (UPM) and Ministry of Agriculture (MOA). The project started in early 2004 with approved IRPA fund of RM 275,000.00 for 3 years. The main objective of the project is to generate superior genotypes for minimal water requirement through induced mutation techniques. A cultivated rice Oryza sativa cv MR219 treated with gamma radiation at 300 and 400 Gray were used in the experiment. Two hundred gm M2 seeds from each dose were screened under minimal water stress in greenhouse at Mardi Seberang Perai. Five hundred panicles with good filled grains were selected for paddy field screening with simulate precise water stress regime. Thirty eight potential lines with required adaptive traits were selected in M3. After several series of selection, 12 promising mutant line were observed tolerance to minimal water stress where two promising mutant lines designated as MR219-4 and MR219-9 were selected for further testing under several stress environments. (author)

On Development of Medical Informatics Education via European Cooperation

Czech Academy of Sciences Publication Activity Database

Zvárová, Jana

1998-01-01

Roč. 50, - (1998), s. 219-223 ISSN 1386-5056 Keywords : information technologies * education * training * medical informatics * medical statistics * epidemiology Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.357, year: 1998

75 FR 13253 - Plan Revision for Lake Tahoe Basin Management Unit, Alpine, El Dorado, and Placer Counties, CA...

Science.gov (United States)

2010-03-19

... approved in 1988, there have been changes in economic, social, and ecological conditions, new policies and... effect. The 2000 Planning Rule's transition provisions (36 CFR 219.35) --amended in 2002 and 2003, and...

77 FR 73516 - Federal Acquisition Regulation; Iran Threat Reduction

Science.gov (United States)

2012-12-10

... information provided. FOR FURTHER INFORMATION CONTACT: Ms. Cecelia L. Davis, Procurement Analyst, at 202-219... sector of Iran and impose sanctions with respect to transport of crude oil from Iran and evasion of...

Cholesterol and fat lowering with hydrophobic polysaccharide derivatives

Czech Academy of Sciences Publication Activity Database

Čopíková, J.; Taubner, T.; Tůma, J.; Synytsya, A.; Dušková, Dagmar; Marounek, Milan

2015-01-01

Roč. 116, č. 1 (2015), s. 207-214 ISSN 0144-8617 Institutional support: RVO:67985904 Keywords : hydrophobically modified polysaccharides * structure * thermal analysis Subject RIV: CE - Biochemistry Impact factor: 4.219, year: 2015

Plant species richness-productivity relationships in a low-productive boreal region

Czech Academy of Sciences Publication Activity Database

Axmanová, I.; Chytrý, M.; Danihelka, Jiří; Lustyk, P.; Kočí, M.; Kubešová, S.; Horsák, M.; Cherosov, M. M.; Gogoleva, P. A.

2013-01-01

Roč. 214, č. 2 (2013), s. 207-219 ISSN 1385-0237 Institutional support: RVO:67985939 Keywords : competitive excluison * forest herb layer * grassland Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013

A complete degradation of organophosphates by microwave-assisted hydrolysis

Czech Academy of Sciences Publication Activity Database

Jansa, Petr; Čechová, Lucie; Janeba, Zlatko

2016-01-01

Roč. 3, č. 3 (2016), s. 219-226 ISSN 2213-3356 R&D Projects: GA MV VG20102015046 Institutional support: RVO:61388963 Keywords : organophosphates * microwave irradiation * hydrolysis Subject RIV: CC - Organic Chemistry

Molecular hematology

National Research Council Canada - National Science Library

Provan, Drew; Gribben, John

2010-01-01

... The molecular basis of hemophilia, 219 Paul LF Giangrande 4 The genetics of acute myeloid leukemias, 42 Carolyn J Owen & Jude Fitzgibbon 19 The molecular basis of von Willebrand disease, 233 Luciano Baronc...

Mutant p97 exhibits species-specific changes of its ATPase activity and compromises the UBXD9-mediated monomerisation of p97 hexamers.

Science.gov (United States)

Rijal, Ramesh; Arhzaouy, Khalid; Strucksberg, Karl-Heinz; Cross, Megan; Hofmann, Andreas; Schröder, Rolf; Clemen, Christoph S; Eichinger, Ludwig

2016-01-01

p97 (VCP) is a homo-hexameric triple-A ATPase that exerts a plethora of cellular processes. Heterozygous missense mutations of p97 cause at least five human neurodegenerative disorders. However, the specific molecular consequences of p97 mutations are hitherto widely unknown. Our in silico structural models of human and Dictyostelium p97 showed that the disease-causing human R93C, R155H, and R155C as well as Dictyostelium R154C, E219K, R154C/E219K p97 mutations constitute variations in surface-exposed locations. In-gel ATPase activity measurements of p97 monomers and hexamers revealed significant mutation- and species-specific differences. While all human p97 mutations led to an increase in ATPase activity, no changes could be detected for the Dictyostelium R154C mutant, which is orthologous to human R155C. The E219K mutation led to an almost complete loss of activity, which was partially recuperated in the R154C/E219K double-mutant indicating p97 inter-domain communication. By means of co-immunoprecipitation experiments we identified an UBX-domain containing Dictyostelium protein as a novel p97 interaction partner. We categorized all UBX-domain containing Dictyostelium proteins and named the interaction partner UBXD9. Pull-down assays and surface plasmon resonance analyses of Dictyostelium UBXD9 or the human orthologue TUG/ASPL/UBXD9 demonstrated direct interactions with p97 as well as species-, mutation- and ATP-dependent differences in the binding affinities. Sucrose density gradient assays revealed that both human and Dictyostelium UBXD9 proteins very efficiently disassembled wild-type, but to a lesser extent mutant p97 hexamers into monomers. Our results are consistent with a scenario in which p97 point mutations lead to differences in enzymatic activities and molecular interactions, which in the long-term result in a late-onset and progressive multisystem disease. Copyright © 2016 The Authors. Published by Elsevier GmbH.. All rights reserved.

Knowledge, attitude and practice of emergency contraceptives ...

African Journals Online (AJOL)

admin

contraceptives among female college students in Arba Minch ... those who mentioned pills as an emergency contraceptive method, 26.4% correctly ... The summary index for knowledge disclosed that 21.9% had good knowledge about EC.

Film growth and alloy enrichment during anodizing AZ31 magnesium alloy in fluoride/glycerol electrolytes of a range of water contents

Czech Academy of Sciences Publication Activity Database

Němcová, A.; Galal, O.; Skeldon, P.; Kuběna, Ivo; Šmíd, Miroslav; Briand, E.; Vickridge, I.; Ganem, J.-J.; Habazaki, H.

2016-01-01

Roč. 219, NOV (2016), s. 28-37 ISSN 0013-4686 Institutional support: RVO:68081723 Keywords : magnesium * anodic film * enrichment Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 4.798, year: 2016

Oceanographic data acquired in support of the June 1980 study of the upwelling center off Point Sur, California (NODC Accession 9000024)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Current, Temperature and Depth (CTD) data were collected by Naval Postgraduate School from Coastal Waters of California between 2-19 June, 1980 using ship...

Comeniana aus dem Nachlass von Dietrich Mahnke. Die Korrespondenz zwischen Dietrich Mahnke und Dmitrij Tschižewskij aus dem Jahre 1935. Beilage: die Korrespondenz

Czech Academy of Sciences Publication Activity Database

Schifferová, Věra

18/42/, - (2004), s. 219-223 ISSN 0231-5955 Institutional research plan: CEZ:AV0Z9009908 Keywords : The interpretation of Comenius * the pupils of Edmund Husserl * rationalism and mysticism Subject RIV: AA - Philosophy ; Religion

Short communication

African Journals Online (AJOL)

Lincoln User

Peer-reviewed paper: 10th World Conference on Animal Production. 219. Improving the quality of wool through the use of gene markers. T.O. Itenge. 1# .... International Wool Textile Organisation (IWTO) standards. Measurements included ...

Evolutionary history of tree squirrels (Rodentia, Sciurini) based on multilocus phylogeny reconstruction

Czech Academy of Sciences Publication Activity Database

Pečnerová, P.; Martínková, Natália

2012-01-01

Roč. 41, č. 3 (2012), s. 211-219 ISSN 0300-3256 Institutional research plan: CEZ:AV0Z60930519 Keywords : phylogeny * Sciurus * biogeography * colonisation Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012

N-acetyl-3,4-dihydroxy-L-phenylalanine, a second identified bioactive metabolite produced by Streptomyces sp 8812

Czech Academy of Sciences Publication Activity Database

Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.

2012-01-01

Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012

Alternative models of entrance exams and access to higher education: the case of the Czech Republic

Czech Academy of Sciences Publication Activity Database

Konečný, Tomáš; Basl, J.; Mysliveček, Jan; Simonová, N.

2012-01-01

Roč. 63, č. 2 (2012), s. 219-235 ISSN 0018-1560 Institutional support: PRVOUK-P23 Keywords : higher education * admission exams * educational equity Subject RIV: AO - Sociology, Demography Impact factor: 0.937, year: 2012

75 FR 18076 - Changes in Flood Elevation Determinations

Science.gov (United States)

2010-04-09

...; Chairman, Coconino (08-09-1418P). Arizona Daily Sun. County Board of Supervisors, 219 East Cherry Avenue... February 13, 2009; The Honorable Paul Biane, June 19, 2009 060270 No: B-1044). of San Bernardino February...

South African Journal for Research in Sport, Physical Education and ...

African Journals Online (AJOL)

Perspective of coaches on LTAD of elite judo athletes: A comparative analysis · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Petrus L. Nolte, Cora Burnett, Wim Hollander, 219-228 ...

49 CFR 212.223 - Operating practices compliance inspector.

Science.gov (United States)

2010-10-01

...) Control of Alcohol and Drug Use (49 CFR part 219); (3) Rear End Marking Device Regulations (49 CFR part... regulations listed in paragraph (a) of this section, including the remedial action required to bring defective...

ORF Alignment: NC_003076 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available DNA-binding protein ... 19) ... Length = 153 ... Query: 160 GCVKGARGASGLCISH...GGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTKSAEGKT 219 ... GC KGAR ASG CISHGGG+RCQKP C KGAE KT +CK H...GGG+RCE+LGCTK AEG T Sbjct: 2 ... GCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGST 61 ... Query: 280 K

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

Fulltext PDF

Indian Academy of Sciences (India)

sriranga

Page 1. 219. RESONANCE │ March 2011. GENERAL │ ARTICLE. Email for Correspondence: ionguha@gmail.com. Science Smiles. Ayan Guha. Your Honor, I have proof that this accused linkage traced that 'bone' graffiti on the painting.

Two new species of the genus Xanthoxerampellia (Orchidaceae, Maxillariinae) from Antioquia, Colombia

Czech Academy of Sciences Publication Activity Database

Szlachetko, D. L.; Kolanowska, Marta

2017-01-01

Roč. 24, - (2017), s. 199-204 ISSN 1561-882X Institutional support: RVO:86652079 Keywords : biodiversity * Maxillariinae * Neotropics * orchids * taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.219, year: 2016

Slovanské kontexty Dvořákovy doby a Dvořákova díla

Czech Academy of Sciences Publication Activity Database

Tyllner, Lubomír

2014-01-01

Roč. 3, 1/2 (2014), s. 219-222 ISSN 1805-3866 Institutional support: RVO:68378076 Keywords : folkmusic * slavonic music * music ology * ethnomusicology * Antonín Dvořák Subject RIV: AC - Archeology, Anthropology, Ethnology

N,3,4-Trisubstituted pyrrolidines by electron transfer-induced oxidative cyclizations of N-allylic beta-amino ester enolates

Czech Academy of Sciences Publication Activity Database

Jahn, Ullrich; Kafka, František; Pohl, Radek; Jones, P.G.

2009-01-01

Roč. 65, č. 52 (2009), s. 10917-10929 ISSN 0040-4020 Institutional research plan: CEZ:AV0Z40550506 Keywords : electron transfer * pyrrolidines * oxidation Subject RIV: CC - Organic Chemistry Impact factor: 3.219, year: 2009

Lordosis - lumbar

Science.gov (United States)

... spine. Much less common causes in children include: Achondroplasia , a disorder of bone growth that causes the ... Carson BS, Rigamonti D, Ahn ES. Achondroplasia and other dwarfisms. ... PA: Elsevier Saunders; 2011:chap 219. Mistovich RJ, Spiegel ...

Optimal Mirrleesean taxation in a Ben-Porath economy

Czech Academy of Sciences Publication Activity Database

Kapička, Marek

2015-01-01

Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015

Formulation and Characterization of Glutaraldehyde Cross-Linked ...

African Journals Online (AJOL)

... drug/polymer ratio, volume of cross linking agent and volume of surfactant were ... The microspheres were characterized for entrapment efficiency, drug loading, ... size distribution (105 – 219 μm) and an entrapment efficiency of up to 73 %.

Analysis of major histocompatibility complex class II gene in water voles using capillary electrophoresis-single stranded conformation polymorphism

Czech Academy of Sciences Publication Activity Database

Bryja, Josef; Galan, M.; Charbonnel, N.; Cosson, J.-F.

2005-01-01

Roč. 5, č. 1 (2005), s. 173-176 ISSN 1471-8278 Institutional research plan: CEZ:AV0Z6093917 Keywords : water vole * population genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.219, year: 2005

Elevation, space and host plant species structure Ericaceae root-associated fungal communities in Papua New Guinea

Czech Academy of Sciences Publication Activity Database

Kohout, Petr; Bahram, M.; Polme, S.; Tedersoo, L.

2017-01-01

Roč. 30, Dec 2017 (2017), s. 112-121 ISSN 1754-5048 Institutional support: RVO:67985939 Keywords : ericoid mycorrhiza * fungal diversity * host effect Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.219, year: 2016

Measurement of dose equivalent distribution on-board commercial jet aircraft

Czech Academy of Sciences Publication Activity Database

Kubančák, Ján; Ambrožová, Iva; Ploc, Ondřej; Pachnerová Brabcová, Kateřina; Štěpán, Václav; Uchihori, Y.

2014-01-01

Roč. 162, č. 3 (2014), s. 215-219 ISSN 0144-8420 Institutional support: RVO:61389005 Keywords : aircrew dosimetry * space weather * CERF Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.913, year: 2014

Septin 9 hypermethylation contributes to migration and resistance to ...

African Journals Online (AJOL)

radiotherapy and chemotherapy are widely used but its outcomes are ... Multiple studies have shown that septin 9 gene spanning a region of 219 kb in the genome and encoding different ... suggested a tumor-suppressor role [10]. Despite.

Groin Exploration for the Nonpalpable Testes: A Single Center ...

African Journals Online (AJOL)

Laparoscopy enables the evaluation of the position, size, and the structural ... presentation, side involved, type of investigation done, mode of management ... 9 (21.9%) required admission for between 1 and 4 days (median. 3 days) either ...

About Military Sexual Trauma

Medline Plus

Full Text Available ... Administration 385,227 views 3:38 Coping With Depression - Duration: 4:50. Veterans Health Administration 7,915 ... Health Administration 1,219 views 1:16 Connected Care 2017 - Duration: 7:19. Veterans Health Administration 1, ...

Meče 11.-13. století z území Moravy

Czech Academy of Sciences Publication Activity Database

Žákovský, P.; Hošek, Jiří; Sedláčková, L.

2013-01-01

Roč. 38, č. 1 (2013), s. 219-270 ISSN 0231-5823 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Middle Ages * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

Clean Hands Count

Medline Plus

Full Text Available ... action today; no cure tomorrow - Duration: 3:10. World Health Organization 75,362 views 3:10 Wash ' ... handwash? With soap and water - Duration: 1:27. World Health Organization 219,427 views 1:27 Hand ...

77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

Science.gov (United States)

2012-12-31

...; List of Subjects in 48 CFR Parts 201, 203, 204, 215, 219, 245, and 252 Government procurement. Manuel... clause 52.203-13, Contractor Code of Business Ethics and Conduct, is the DoD Office of Inspector General...

Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

NARCIS (Netherlands)

Kester, Bernadette

1998-01-01

textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

The Atacama Cosmology Telescope: Beam Measurements and the Microwave Brightness Temperatures of Uranus and Saturn

Science.gov (United States)

Hasselfield, Matthew; Moodley, Kavilan; Bond, J. Richard; Das, Sudeep; Devlin, Mark J.; Dunkley, Joanna; Dunner, Rolando; Fowler, Joseph W.; Gallardo, Patricio; Gralla, Megan B.;

Characterization of Pu-contaminated soils from Nuclear Site 201 at the Nevada Test Site

International Nuclear Information System (INIS)

Lee, S.Y.; Tamura, T.; Larsen, I.L.

1983-01-01

Distribution and characteristics of Pu-bearing radioactive particles throughout five soil profiles from Nuclear Site (NS) 201 were investigated. Concentrations of 239 240 Pu and 241 Am decreased with depth and most of the contamination was contained in the top 5 cm except in profile 4 where it extended to 10 cm. The mean activity ratio of 239 240 Pu to 241 Am and its standard error were 5.8 +- 0.3 (N=42). Most of the total radioactivity of the soils was contributed by 0.25 to 2 mm sand size fraction which comprised 20 to 50% by weight of the soils. The radioactive particles in the 0.25 to 2 mm size fraction occurred as spherical glass particles or as glass coatings on sand particles. The glass coatings had gas voids in the matrix but were not as porous as the radioactive particles from NS 219. After impact grinding the >0.25-mm size fractions for one hour, 85% of the initial activity in a NS 201 sample remained with the particles on the 0.25 mm sieve, whereas in the NS 219 sample only 10% remained. The results show that the radioactive particles from NS 201 were much more stable against the impact grinding force than those from NS 219. Therefore, the NS 201 soils would be expected to have a lower probability of producing respirable-size radioactive particles by saltation during wind erosion. 19 references, 3 figures, 3 tables

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 219 ... Vol 9, No 2 (2018), Domestic amnesty for international crimes and the ... of Nigeria's international obligations in curbing domestic violence, Abstract PDF ... Nigerian copyright laws in the age of social media, Abstract PDF.

Drug: D01798 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available l group: DG00147 ... Treatment of mild-to-moderate phenylketonuria (PKU) ... CAS: 69056-38-8 PubChem: 7848860 ChEBI: 32120 ChEMBL: CHEMBL1201775 LigandBox: D01798 NIKKAJI: J1.219.960K ...

What Are the Common Treatments for Menstrual Irregularities?

Science.gov (United States)

... NICHD Research Information Find a Study More Information Amenorrhea About NICHD Research Information Find a Study More ... Society for Reproductive Medicine. (2008). Current evaluation of amenorrhea. Fertility and Sterility, 90 , S219–S225. Apgar, B. S., ...

Relationship between patient satisfactions with diabetes care and ...

African Journals Online (AJOL)

2013-08-05

Aug 5, 2013 ... Bener, et al.: Patients satisfaction evaluation and management of diabetes care. 219 ... socioeconomic status (SES), females and the elderly.[5‑8] .... the subject was standing bare feet and with normal straight posture. Weight ...

Design and synthesis of bombykol analogues for probing pheromone-binding protein–ligand interactions

Czech Academy of Sciences Publication Activity Database

Mansurova, M.; Klusák, Vojtěch; Nešněrová, P.; Muck, A.; Doubský, J.; Svatoš, Aleš

2009-01-01

Roč. 65, č. 5 (2009), s. 1069-1076 ISSN 0040-4020 Institutional research plan: CEZ:AV0Z40550506 Keywords : bombykol * pheromone * binding protein * nanoLC Subject RIV: CC - Organic Chemistry Impact factor: 3.219, year: 2009

What can be efficiently reduced to the Kolmogorov-random strings?

Czech Academy of Sciences Publication Activity Database

Allender, E.; Buhrman, H.; Koucký, Michal

2006-01-01

Roč. 138, č. 1 (2006), s. 2-19 ISSN 0168-0072 Institutional research plan: CEZ:AV0Z10190503 Keywords : Kolmogorov complexity * Kolmogorov random strings * completeness Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2006

Volcanic activity in Late Variscan Krkonoše Piedmont Basin: petrological and geochemical constraints

Czech Academy of Sciences Publication Activity Database

Ulrych, Jaromír; Štěpánková, Jana; Novák, Jiří Karel; Pivec, Edvín; Prouza, V.

2002-01-01

Roč. 8, 3-4 (2002), s. 219-234 ISSN 1335-096X R&D Projects: GA AV ČR(CZ) IAA3013903 Keywords : Late Palaeozoic volcanism * Krkonoše Piedmont Basin * geochemistry Subject RIV: DB - Geology ; Mineralogy

Sol–gel preparation of selected lanthanide aluminium garnets

Czech Academy of Sciences Publication Activity Database

Dubnikova, N.; Garskaite, E.; Pinkas, J.; Bezdička, Petr; Beganskiene, A.; Kareiva, A.

2010-01-01

Roč. 55, č. 2 (2010), s. 213-219 ISSN 0928-0707 Institutional research plan: CEZ:AV0Z40320502 Keywords : lanthanide aluminium garnets * sol-gel processing Subject RIV: CA - Inorganic Chemistry Impact factor: 1.525, year: 2010

Facing Guilt: Role of Negative Affectivity, Need for Reparation, and Fear of Punishment in Leading to Prosocial Behaviour and Aggression

Czech Academy of Sciences Publication Activity Database

Caprara, G. V.; Barbaranelli, C.; Pastorelli, C.; Čermák, Ivo; Rozsa, S.

2001-01-01

Roč. 15, č. 3 (2001), s. 219-237 ISSN 0890-2070 Institutional research plan: CEZ:AV0Z7025918 Keywords : emotional predictors of aggression * Guilt * Negative Affectivity Subject RIV: AN - Psychology Impact factor: 1.081, year: 2001

Synthesis of Tungsten Diselenide Nanoparticles by Chemical Vapor Condensation Method

Directory of Open Access Journals (Sweden)

Oleg V. Tolochko

2015-09-01

Full Text Available Crystalline tungsten diselenide (WSe2 nanoparticles have been synthesized by a gas phase reaction using tungsten hexacarbonyl and elemental selenium as precursors. The WSe2 nanoparticle morphology varies from the spherical shape to flake-like layered structures. Mean size in smaller dimension are less than 5 nm and the number of layers decreased linearly with decreasing of reaction time and concentration of carbonyl in the gas phase. The mean value of interlayer distance in <0001> direction is comparable with the microscopic values. The selenium-to-tungsten atomic ratios of 2.07, 2.19 and 2.19 were determined respectively, approach to the stoichiometric ratio of 2:1. Main impurities are oxygen and carbon and strongly interrelated with carbonyl concentration in the gas phase.DOI: http://dx.doi.org/10.5755/j01.ms.21.3.7356

Nitrogen use efficiency evaluation of aerobic rice under field capacity water potential using 15N isotopic tracer technique

International Nuclear Information System (INIS)

Wahid, Ahmad Nazrul Abd; Rahim, Sahibin Abd; Rahim, Khairuddin Abdul; Harun, Abdul Rahim

2015-01-01

This study was carried out to evaluate the efficiency use of the nitrogen fertilizer on aerobic rice varieties MR219-4 and MR219-9 which were grown aerobically under field capacity water potential at the controlled environment area or shield house. Direct 15 N isotope tracer method was used in this study, whereby the 15 N isotope was utilized as a tracer for nitrogen nutrient uptake. 15 N isotope presence in the samples is determined by using emission spectrometer analysis and percentage of total nitrogen is determined by using Kjeldahl method. 15 N atom access value contained in the sample will be used in determining the effectiveness of the use of nitrogen in fertilizers through the specific calculation formulas. In this work, the data several data of nitrogen derived from fertilizer (Ndff), total nitrogen, nitrogen uptake and nitrogen use efficiency was obtained

Effect of germination on the physicochemical and antioxidant characteristics of rice flour from three rice varieties from Nigeria.

Science.gov (United States)

Chinma, Chiemela Enyinnaya; Anuonye, Julian Chukwuemeka; Simon, Omotade Comfort; Ohiare, Raliat Ozavize; Danbaba, Nahemiah

2015-10-15

This study determined the effect of germination (48 h) on the physicochemical and antioxidant characteristics of rice flour from three rice varieties from Nigeria. Local rice varieties (Jamila, Jeep and Kwandala) were evaluated and compared to an improved variety (MR 219). Physicochemical and antioxidant properties of flours were determined using standard methods. Protein, magnesium, phosphorus, potassium and antioxidant properties of rice flours increased after germination while phytic acid and total starch contents decreased. Foaming capacity and stability of rice flours increased after germination. Germination resulted to changes in pasting and thermal characteristics of rice flours. Germinated rice flours had better physicochemical and antioxidant properties with reduced phytic acid and starch contents compared to MR 219, which can be utilized as functional ingredients in the preparation of rice-based products. Copyright © 2015 Elsevier Ltd. All rights reserved.

Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

International Nuclear Information System (INIS)

Segre, Nadia; Fagundes, Rosane Correa

2013-01-01

In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

International Nuclear Information System (INIS)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung

2014-01-01

Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex

Alpha-emitting nuclides in the marine environment

Science.gov (United States)

Pentreath, R. J.

1984-06-01

The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.

Determination of radium in water

International Nuclear Information System (INIS)

Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

1995-10-01

These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)

Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

Energy Technology Data Exchange (ETDEWEB)

Segre, Nadia; Fagundes, Rosane Correa, E-mail: nadia.segre@ctmsp.mar.mil.br [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2013-07-01

In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys

International Nuclear Information System (INIS)

Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.

2006-01-01

Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation

Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

Directory of Open Access Journals (Sweden)

Jaspreet Singh Jaggi

2007-03-01

Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

Determination of radium in water

Energy Technology Data Exchange (ETDEWEB)

Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

1995-10-01

These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).

Natural radionuclides in soils of a forest fragment of Atlantic Forest under ecological restoration process

International Nuclear Information System (INIS)

Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.

2017-01-01

The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide

Study of the nickel-fullerene nano-structured thin films

Czech Academy of Sciences Publication Activity Database

Vacík, Jiří; Naramoto, H.; Narumi, K.; Yamamoto, S.; Abe, H.

2004-01-01

Roč. 219, č. 20 (2004), s. 862-866 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nickel * fullerene * magnesium oxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.997, year: 2004

Pöökpuud kuupaisel : [luuletused] / L{u00E1szl̤ Nagy ; tlk. Ly Seppel, Andres Ehin

Index Scriptorium Estoniae

Nagy, L{u00E1szl̤

2004-01-01

Sisu: Pöökpuud kuupaistel ; Härmaehtes maipidu ; Kes kannab siis teisele kaldale armastuse? ; Linna vapp ; Haljas ingel ; Bart̤k ja kiskjad ; Pulmad ; Ümbersünd hõbedasse ; Elagu puud. Eluloolisi andmeid autori kohta lk. 219-220

Baltisakslaste kunstivaramud Poznani Rahvusmuuseumis : peatükk ühe rahvusgrupi ajaloost / Anne Lõugas

Index Scriptorium Estoniae

Lõugas, Anne, 1951-

1998-01-01

Eestiga seotud vanema kunsti kogu on kujunenud välja eri ajaetappidel ja eri allikatest. Käsitletakse 1939-1944 Eestist väljaviidud kunstiteoseid, kirjandust baltisakslaste ümberasumisest. Poznani Rahvusmuuseumis asuvate Eestiga seotud baltisaksa maalide nimekiri lk. 205-219

Comparison of nasopharyngeal aspirate and nasal swab specimens for detection of respiratory syncytial virus in different settings in a developing country

DEFF Research Database (Denmark)

Stensballe, L G; Trautner, S; Kofoed, P-E

2002-01-01

detection was defined as any test being positive. RESULTS: RSV antigen was detected in 84 (13%) children, the prevalence being 19% (41/219) among infants aged 230) in older children. Sensitivity of antigen detection was higher in NPA (92...

The banana (Musa acuminata) genome and the evolution of monocotyledonous plants

Czech Academy of Sciences Publication Activity Database

D´Hont, A.; Denoeud, F.; Aury, J. M.; Baurens, F. Ch.; Carreel, F.; Garsmeur, O.; Noel, B.; Bocs, S.; Droc, G.; Rouard, M.; Da Silva, C.; Jabbari, K.; Cardi, C.; Poulain, J.; Souquet, M.; Labadie, K.; Jourda, C.; Lengellé, J.; Rodier-Goud, M.; Alberti, A.; Bernard, M.; Correa, M.; Ayyampalayam, S.; Mckain, M. R.; Leebens-Mack, J.; Burgess, D.; Freeling, M.; Mbéguié-A-Mbéguié, D.; Chabannes, M.; Wicker, T.; Panaud, O.; Barbosa, J.; Hřibová, Eva; Heslop-Harrison, P.; Habas, R.; Rivallan, R.; Francois, P.; Poiron, C.; Kilian, A.; Burthia, D.; Jenny, Ch.; Bakry, F.; Brown, S.; Guignon, V.; Kema, G.; Dita, M.; Waalwijk, C.; Joseph, S.; Dievart, A.; Jaillon, O.; Leclercq, J.; Argout, X.; Lyons, E.; Almeida, A.; Jeridi, M.; Doležel, Jaroslav; Roux, N.; Risterucci, A. M.; Weissenbach, J.; Ruiz, M.; Glaszmann, J. Ch.; Quétier, F.; Yahiaoui, N.; Wincker, P.

2012-01-01

Roč. 488, č. 7410 (2012), s. 213-219 ISSN 0028-0836 Institutional research plan: CEZ:AV0Z50380511 Keywords : IN-SITU HYBRIDIZATION * SEQUENCE COUNT DATA * DNA-SEQUENCES Subject RIV: ED - Physiology Impact factor: 38.597, year: 2012

Clean Hands Count

Medline Plus

Full Text Available ... 362 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 412,404 ... 219,427 views 1:27 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 25,194 views ...

South African Journal of Philosophy - Vol 22, No 3 (2003)

African Journals Online (AJOL)

Eliminative materialism and the integrity of science · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Michael M. Pitman, 207-219. http://dx.doi.org/10.4314/sajpem.v22i3.31370 ...

Cytochemical study of carp neutrophil granulocytes after acute exposure to cadmium

Czech Academy of Sciences Publication Activity Database

Drastichová, J.; Švestková, E.; Lusková, Věra; Svobodová, Z.

2005-01-01

Roč. 21, č. 3 (2005), s. 215-219 ISSN 0175-8659 Institutional research plan: CEZ:AV0Z60930519 Keywords : peripheral-blood leukocytes * cadmium * common carp Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.563, year: 2005

Sociálně založené nerovnosti ve zdraví: současný vývoj ve světě a stav u nás

Czech Academy of Sciences Publication Activity Database

Šolcová, Iva; Kebza, V.

2002-01-01

Roč. 46, č. 3 (2002), s. 219-224 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : inequalities in health * SES * self-reported health Subject RIV: AN - Psychology Impact factor: 0.190, year: 2002

Životní strategie šídlatek prověřená stovkami milionů let

Czech Academy of Sciences Publication Activity Database

Čtvrtlíková, Martina

2016-01-01

Roč. 64, č. 3 (2016), s. 110-112 ISSN 0044-4812 Grant - others:AV ČR(CZ) StrategieAV21/9 Program:StrategieAV Institutional support: RVO:60077344 Keywords : aquatic plant * Isoetes * stress tolerance Subject RIV: EF - Botanics

Case report

African Journals Online (AJOL)

raoul

. ;17(1): 5026-5027. This article on PubMed. 2. Sukkarieh Troy, Smaldone Marc, Shah Bharat. Multiples foreign bodies in the anterior and posterior urethra.Int Braz J Urol. 2004 May-. Jun;30(3):219-20. . This article on PubMed.

75 FR 27973 - Airworthiness Directives; Rolls-Royce plc RB211-524C2 Series Turbofan Engines

Science.gov (United States)

2010-05-19

... RB211-524C2 Series Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice... Rolls-Royce plc (RR) model RB211-524C2-19 and RB211-524C2-B-19 turbofan engines. These engines are...

Experiment list: SRX188790 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 27983248,67.5,68.3,219 GSM1006655: U2OS.UV.SIRT3; Hom

Dny otevřených dveří se Sbírce vodních a mokřadních rostlin

Czech Academy of Sciences Publication Activity Database

Navrátilová, Jana

2017-01-01

Roč. 25, č. 5 (2017), s. 23-24 Grant - others:AV ČR(CZ) StrategieAV21/9 Program:StrategieAV Institutional support: RVO:67985939 Keywords : open day * collection * plants Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

Economic analysis of Soybean Farming in Northern Nigeria | Ojiako ...

African Journals Online (AJOL)

t=2.39) and own farm-gate price (t=2.19) have positive and significant influence on ... training workshops and Field Days would help to update them on the appropriate use of new technologies and build up their knowledge and experience.

AcEST: DK947606 [AcEST

Lifescience Database Archive (English)

Full Text Available 2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...tschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Da

AcEST: DK944090 [AcEST

Lifescience Database Archive (English)

Full Text Available .2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ltschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and D

AcEST: DK946179 [AcEST

Lifescience Database Archive (English)

Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

AcEST: DK946199 [AcEST

Lifescience Database Archive (English)

Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

pp 219-224 Electrochemistry ... test revealed good protection of base metal by zinc coating obtained from developed electrolyte. ... Titania doped triaxial porcelain: Enhancement of strength by controlled heat treatment .... Nanowires: properties, applications and synthesis via porous anodic aluminium oxide template.

77 FR 16940 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; Volatile Organic...

Science.gov (United States)

2012-03-23

... at the Environmental Protection Agency, Region 5, Air and Radiation Division, 77 West Jackson... reference, Intergovernmental relations, Nitrogen dioxide, Ozone, Reporting and recordkeeping requirements... plant exemption in Subpart TT of Parts 218 and 219 does not apply to industrial wastewater. This...

Supercooling points and heat coma temperatures in four species of oceanic sea skaters of the genus Halobates (Heteroptera: Gerridae: Halobatinae)

Czech Academy of Sciences Publication Activity Database

Harada, T.; Takenaka, S.; Iyota, K.; Shiraki, T.; Moku, M.; Katagiri, C.; Košťál, Vladimír

2013-01-01

Roč. 16, č. 3 (2013), s. 219-222 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : temperature dynamics * distribution * heat tolerance Subject RIV: ED - Physiology Impact factor: 0.875, year: 2013 http://www.sciencedirect.com/science/article/pii/S1226861513000150#

Mechanisms and evolution of deceptive pollination in orchids

Czech Academy of Sciences Publication Activity Database

Jersáková, Jana; Johnson, S.D.; Kindlmann, Pavel

2006-01-01

Roč. 81, - (2006), s. 219-235 ISSN 1464-7931 Institutional research plan: CEZ:AV0Z60870520 Keywords : cross-pollination * floral deception * geitonogamy * inbreeding * nectar * Orchidaceae * pollinaria * reward * self-pollination Subject RIV: EF - Botanics Impact factor: 5.565, year: 2006

Identification of critical time-consuming student support activities in e-learning

NARCIS (Netherlands)

De Vries, Fred; Kester, Liesbeth; Sloep, Peter; Van Rosmalen, Peter; Pannekeet, Kees; Koper, Rob

2005-01-01

Please cite the original publication: De Vries, F., Kester, L., Sloep, P., Van Rosmalen, P., Pannekeet, K., & Koper, R. (2005). Identification of critical time-consuming student support activities in e-learning. Research in Learning Technology (ALT-J), 13(3), 219-229.

Flow-induced vibration of circular cylindrical structures

International Nuclear Information System (INIS)

Chen, S.S.

1985-06-01

This report summarizes the flow-induced vibration of circular cylinders in quiescent fluid, axial flow, and crossflow, and applications of the analytical methods and experimental data in design evaluation of various system components consisting of circular cylinders. 219 figs., 30 tabs

Hydrogenation of 2-ethyl-9,10-anthraquinone on Pd-polyaniline(SiO.sub.2./sub.) composite catalyst. The effect of humidity

Czech Academy of Sciences Publication Activity Database

Drelinkiewicz, A.; Waksmundzka-Góra, A.; Sobczak, J.; Stejskal, Jaroslav

2007-01-01

Roč. 333, č. 2 (2007), s. 219-228 ISSN 0926-860X Institutional research plan: CEZ:AV0Z40500505 Keywords : 2-ethyl-9,10- anthraquinone * polyaniline * palladium catalysts Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.166, year: 2007

Complexation of Eu3+ with a macrocyclic lactam receptor: Experimental and theoretical study

Czech Academy of Sciences Publication Activity Database

Makrlík, E.; Záliš, Stanislav; Sedláková, Zdeňka; Vaňura, P.

2013-01-01

Roč. 1038, APR 2013 (2013), s. 216-219 ISSN 0022-2860 Institutional support: RVO:61388955 ; RVO:61389013 Keywords : europium * macrocyclic lactam receptor * complexation Subject RIV: CF - Physical ; Theoretical Chemistry; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 1.599, year: 2013

A new species of Isospora Schneider, 1881 (Apicomplexa: Eimeriidae) in Ruppell's agama Agama rueppelli (Vaillant) (Sauria: Agamidae) from East Africa, with a review of this genus in agamid lizards

Czech Academy of Sciences Publication Activity Database

Mihalca, A. D.; Jirků, Miloslav; Malonza, P. K.; Modrý, David

2009-01-01

Roč. 74, č. 3 (2009), s. 219-223 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Isospora * Agama * Kenya * coccidium * Apicomplexa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009

Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission

Czech Academy of Sciences Publication Activity Database

Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.

2017-01-01

Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.802, year: 2016

The Collin dynamometer: History of the development of an instrument for measuring physical and mental strength

Czech Academy of Sciences Publication Activity Database

Nicolas, S.; Vobořil, Dalibor

2017-01-01

Roč. 117, č. 2 (2017), s. 173-219 ISSN 0003-5033 Institutional support: RVO:68081740 Keywords : Collin dynamometer * experimental psychology * history of psychology Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations) Impact factor: 0.358, year: 2016

South African Medical Journal - Vol 45, No 2 (1971)

African Journals Online (AJOL)

A new adjunct to the treatment and management of depression: intravenous infusion of ... The use of proteolytic enzymes (chymoral) in sporting injuries · EMAIL FREE FULL TEXT EMAIL ... Simmy Bank, D.G. Burns, I.N. Marks, D Stein, 219-225 ...

219 The Revised Edition of Korean Calendar for Allergenic Pollens

Science.gov (United States)

Oh, Jae-won; Kim, Joo-Hwa; Kim, Seong-Won; Kang, Im-Joo; Kim, Bong-Seong; Kook, Myung-Hee; Park, Kang-Seo; Lee, Ha-Baik; Kim, Kyu Rang; Choi, Young-Jean

2012-01-01

Background The old version of pollen calendar was used until this year in South Korea. That calendar did not reflect current pollen distribution and concentrations that can be influenced by changes in weather and environment. A new pollen calendar of allergenic pollens was made based on the data on pollen concentrations obtained in 8 regions nationwide between 1997 and 2009 in South Korea. Methods The distribution of pollen grains was assessed every day at 8 areas (Seoul, Guri, Busan, Daegu, Jeonju, Kwangju, Kangneung, and Jeju) nationwide for 12 years between July 1, 1997 and June 30, 2009. Pollen were collected by using Burkard 7-day sampler (Burkard manufacturing Co Ltd, Hertfordshire, UK), and the collected pollens were sent every week to Hanyang Guri Hospital. Then pollens were strained with Calberla's fuchsin staining solution and were identified. The number of pollen grains per m3 was calculated. Results Alder, birch and Japanese cedar started to appear in February. Japanese cedar showed a highest pollen concentration in Jeju. Pine became the highest pollen in May, and the pollen concentrations of oak and birch also became high. Common ragweed appeared in the middle of August and showed the highest pollen concentration in the middles of September. Japanese hop showed a high concentration between the middle of August and the end of September, and mugwort appeared in the middles of August and its concentration increased up until early September. Birch appeared earlier in Kangneung, and pine showed a higher pollen concentration than in the other areas. In Daegu, Oriental thuja, alder and juniper produced a large concentration of pollens. Pine produced a large concentration of pollens between the middle of April and the end of May. Weeds showed higher concentrations in September and mugwort appeared earlier than common ragweed. In Busan where is the southeast city, the time of flowering is relatively early, and alder and Oriental thuja appeared earliest among all areas. In Kwangju, Oriental thuja and hazelnut appeared in early February. In Jeju which is the end of southern island, Japanese cedar showed a higher pollen concentration than the other areas Conclusions New information on pollen distributions and concentrations should be provided for the general publics or allergic patients through the website in order to prevent the occurrence of pollinosis.

48 CFR 52.219-28 - Post-Award Small Business Program Rerepresentation.

Science.gov (United States)

2010-10-01

... influence on a national basis in a kind of business activity in which a number of business concerns are... position, ownership or control of materials, processes, patents, license agreements, facilities, sales...

28 CFR 2.219 - Maximum terms of imprisonment and supervised release.

Science.gov (United States)

2010-07-01

... contraband into prison 3 years 2 years. 22-2704 Child prostitution: abducting or harboring 3 years (10 years...) or child sex abuse 3 years (10 years if SOR) 2 years. 22-401, 4502 [22-501, 3202] Assault: with... statute for offense circumstances) 3 years 2 years. 22-1101(a), (c)(1) [22-901] Cruelty to children 1st...

48 CFR 352.219-70 - Mentor-protégé program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Mentor-protégé program. As prescribed in 319.270-1(a), the Contracting Officer shall insert the following provision: Mentor-Protégé Program (January 2010) (a) Large business prime contractors serving as mentors in...

: tous les projets | Page 219 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Sujet: URBAN YOUTH, CRIME PREVENTION, YOUTH UNREST, ORGANIZED CRIME, VIOLENCE, MARGINALISM. Région: Guatemala, North and Central America, Honduras, El Salvador, South America. Programme: Gouvernance et justice. Financement total : CA$ 464,000.00. Prévention de la violence chez les jeunes ...

Clinicopathological study on refractory epilepsy treated by several epilepsy surgeries

Directory of Open Access Journals (Sweden)

Yan LI

2018-04-01

Full Text Available Objective To observe and investigate the clinicopathological features and types of refractory epilepsy treated by several epilepsy surgeries. Methods There were 19 patients with age less than 20 years who underwent 2 (16/19 or 3 (3/19 epilepsy surgeries. After pathological examination, pathological diagnosis and subtype was made according to focal cortical dysplasia (FCD classification proposed by International League Against Epilepsy (ILAE Diagnostic Methods Commission in 2011 and World Health Organization (WHO Classification of Tumors of Central Nervous System in 2007. Results The operation intervals were 1-10 years (average 4.24 years. The pathological diagnoses after first operation were FCDⅠb in 2 cases (2/19, FCDⅡa in 2 cases (2/19, FCDⅢa in one case (1/19, FCDⅢd in one case (1/19, 5 cases of tumor lesions [2 (2/19 of astrocytoma, one (1/19 of oligoastrocytoma, one (1/ 19 of mixed germ cell tumor, one (1/19 of hysembryoplastic neuroepithelial tumor (DNT], one case (1/19 of hamartoma, one case (1/19 of angioma, one case (1/19 of heterotopic gray matter, and 4 cases (4/19 of ulegyria. The last one (1/19 underwent corpus callosal incision. Pathological diagnoses after reoperation were FCDⅢa in 4 cases (4/19, FCDⅢb in 4 cases (4/19, FCDⅢc in one case (1/19, FCDⅢd in 8 cases (8/19, dual pathology (FCDⅢa with oligoastrocytoma and with glial scar and/or ulegyria in 2 cases (2/19. Patients were followed up for 0.50-5.00 years after second or third operation (average 2.34 years, and the results showed Engel Ⅰ in 10 patients (10/19, Engel Ⅱ in 6 patients (6/19 and Engel Ⅲ in 3 patients (3/19. The rate of good prognosis was 84.21%. Conclusions The pathological diagnoses of brain tissue resected from patients accepting several epilepsy surgeries are mainly FCD Ⅲ and dual pathology. It is suggested that the second or third operation would be effective for refractory epilepsy patients who underwent surgery already. DOI: 10

An On-Line Computerized Personnel-Payroll Dream.

Science.gov (United States)

Francis, E. E.

1979-01-01

Niles Township School District 219, Skokie, Illinois, has rebuilt its personnel and payroll program. The new system provides a data bank for storage of any and all information required by both the personnel and payroll departments on each district employee. (Author/MLF)

Biological activity of sugarcane pyroligneous acid against ...

African Journals Online (AJOL)

aghomotsegin

2013-10-23

Oct 23, 2013 ... most used for charcoal production is the Pinus elliottii var. .... de produtos naturais para o controle de Bemisia tabaci biótipo B .... larva. J. Econ. Entomol. 76:219-222. Zandersons J, Gravitis J, Kokorevics A, Zhurinsh A, ...

On satellite lines anomalies in OH excited states

International Nuclear Information System (INIS)

Elitzur, M.

1976-01-01

It is argued that different pumps produce similar distributions of populations in the first two excited states of OH. The pattern observed recently in G 219.3 - 07 by Whiteoak and Gardner can be due either to radiative or collisional pump. (author)

78 FR 40163 - Notice of Availability of the Draft Environmental Impact Statement for the TransWest Express 600...

Science.gov (United States)

2013-07-03

...). The Project would provide the transmission infrastructure and capacity to deliver approximately 3,000... Code of Federal Regulations (CFR) 1610.2(c) and 36 CFR 219.8. The impacts of these potential amendments...-13; 8:45 am] BILLING CODE 4310-22-P ...

The identification of geopolymer affinity in specific cases of clay materials

Czech Academy of Sciences Publication Activity Database

Perná, Ivana; Hanzlíček, Tomáš; Šupová, Monika

2014-01-01

Roč. 102, December (2014), s. 213-219 ISSN 0169-1317 R&D Projects: GA MPO FR-TI2/390 Institutional support: RVO:67985891 Keywords : geopolymer * raw material * infrared spectroscopy * shale Subject RIV: JI - Composite Materials Impact factor: 2.467, year: 2014

1383-IJBCS-Article- Hounnankpan yedohonhon

African Journals Online (AJOL)

KODJIO NORBERT

. Notes de phytopathologie soudanaise. Compt. Rend. Congrès. Africaniste, Dakar, Sénégal, 518-528. Natabou DF. 1987. Des plantes médicinales de la République Populaire du Bénin, p. 219. Parker C, Riches CR. 1993. Parasittic Weeds.

AcEST: DK947103 [AcEST

Lifescience Database Archive (English)

Full Text Available dro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-B...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

Status of the Grid Computing for the ALICE Experiment in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Adamová, Dagmar; Chudoba, Jiří; Kouba, T.; Lorenzo, P.M.; Saiz, P.; Švec, Jan; Hampl, Josef

2010-01-01

Roč. 219, č. 7 (2010), s. 1-9 E-ISSN 1742-6596 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100521 Keywords : accelerators * PARTICLE PHYSICS * computer data analysis Subject RIV: BF - Elementary Particles and High Energy Physics

Comparison of Qinzhou bay wetland landscape information extraction by three methods

Directory of Open Access Journals (Sweden)

X. Chang

2014-04-01

and OO is 219 km2, 193.70 km2, 217.40 km2 respectively. The result indicates that SC is in the f irst place, followed by OO approach, and the third DT method when used to extract Qingzhou Bay coastal wetland.

Fungi associated with decomposing deadwood in a natural beech-dominated forest

Czech Academy of Sciences Publication Activity Database

Baldrian, Petr; Zrůstová, Petra; Tláskal, Vojtěch; Davidová, Anna; Merhautová, Věra; Vrška, T.

2016-01-01

Roč. 23, OCT 2016 (2016), s. 109-122 ISSN 1754-5048 R&D Projects: GA ČR GA13-27454S Institutional support: RVO:61388971 Keywords : Deadwood * Decomposition * White-rot Subject RIV: EE - Microbiology, Virology Impact factor: 3.219, year: 2016

Three anisotropic benchmark problems for adaptive finite element methods

Czech Academy of Sciences Publication Activity Database

Šolín, Pavel; Čertík, O.; Korous, L.

2013-01-01

Roč. 219, č. 13 (2013), s. 7286-7295 ISSN 0096-3003 R&D Projects: GA AV ČR IAA100760702 Institutional support: RVO:61388998 Keywords : benchmark problem * anisotropic solution * boundary layer Subject RIV: BA - General Mathematics Impact factor: 1.600, year: 2013

Host plant quality mediates competition between arbuscular mycorrhizal fungi

Czech Academy of Sciences Publication Activity Database

Knegt, B.; Jansa, Jan; Franken, O.; Engelmoer, D.J.P.; Werner, G.D.A.; Bucking, H.; Kiers, E. T.

2016-01-01

Roč. 20, April (2016), s. 233-240 ISSN 1754-5048 R&D Projects: GA MŠk(CZ) LK11224 Institutional support: RVO:61388971 Keywords : Biological market * Competitive exclusion * Cooperation Mutualism Subject RIV: EE - Microbiology, Virology Impact factor: 3.219, year: 2016

Accurate and inaccurate HIV transmission beliefs, stigmatizing and HIV protection motivation in northern Thailand

NARCIS (Netherlands)

Boer, Hendrik; Emons, P.A.A.; Emons, P.A.A.

2004-01-01

We assessed the relation between accurate beliefs about HIV transmission and inaccurate beliefs about HIV transmission and emotional reactions to people with AIDS (PWA) and AIDS risk groups, stigmatizing attitudes and motivation to protect from HIV. In Chiang Rai, northern Thailand, 219 respondents

75 FR 65439 - Defense Federal Acquisition Regulation Supplement; Electronic Subcontracting Reporting System

Science.gov (United States)

2010-10-25

... Accounting Service or Missile Defense Agency. (2) For DoD, the authority to acknowledge receipt or reject... DEPARTMENT OF DEFENSE Defense Acquisition Regulations System 48 CFR Parts 219 and 252 [DFARS Case 2009-D002] Defense Federal Acquisition Regulation Supplement; Electronic Subcontracting Reporting...

77 FR 17352 - Federal Acquisition Regulation; Women-Owned Small Business (WOSB) Program

Science.gov (United States)

2012-03-26

...-AL97 Federal Acquisition Regulation; Women-Owned Small Business (WOSB) Program Correction In rule...) * * * -- (24) 52.219-29, Notice of Set-Aside for Economically Disadvantaged Women-Owned Small Business (EDWOSB... Disadvantaged Women- Owned Small Business Concerns. * * * * * Notice of Set-Aside for Economically Disadvantaged...

48 CFR 3019.708-70 - Solicitation provision and contract clauses.

Science.gov (United States)

2010-10-01

... HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 3019.708-70 Solicitation provision and contract clauses. (a) The contracting officer shall insert the clause at (HSAR) 48 CFR 3052.219-70, Small Business...

Neutron activation analysis in geochemical characterization of Jurassic-Cretaceous sedimentary rocks from the Nordvik Peninsula

Czech Academy of Sciences Publication Activity Database

Mizera, Jiří; Řanda, Zdeněk; Košťák, M.

2010-01-01

Roč. 284, č. 1 (2010), s. 211-219 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : Jurassic-Cretaceous boundary * Nordvik Peninsula * Iridium anomaly Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.777, year: 2010

76 FR 76156 - Grand Coulee Project Hydroelectric Authority; Notice of Preliminary Permit Application Accepted...

Science.gov (United States)

2011-12-06

... Project Hydroelectric Authority; Notice of Preliminary Permit Application Accepted for Filing and... Federal Power Act (FPA), proposing to study the feasibility of the Scooteney Outlet Drop Hydroelectric..., Grand Coulee Project Hydroelectric Authority, P.O. Box 219, Ephrata, WA 98823; phone: (509) 754-2227...

Increased expression of chemokine receptors CCR1 and CCR3 in nasal polyps: molecular basis for recruitment of the granulocyte infiltrate

Czech Academy of Sciences Publication Activity Database

Fundová, Petra; Funda, David P.; Kovář, D.; Holý, R.; Navara, M.; Tlaskalová-Hogenová, Helena

2013-01-01

Roč. 58, č. 3 (2013), s. 219-224 ISSN 0015-5632 R&D Projects: GA MZd NS10054 Institutional support: RVO:61388971 Keywords : INTESTINAL EPITHELIAL-CELLS * GM- CSF * TOLL-LIKE RECEPTORS Subject RIV: EE - Microbiology, Virology Impact factor: 1.145, year: 2013

Dense Alternating Sign Matrices and Extensions

Czech Academy of Sciences Publication Activity Database

Fiedler, Miroslav; Hall, F.J.; Stroev, M.

2014-01-01

Roč. 444, 1 March (2014), s. 219-226 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : alternating sign matrix * dense matrix * totally unimodular matrix * combined matrix * generalized complementary basic matrix Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

Regenerative Medicine for Battlefield Injuries

Science.gov (United States)

2014-10-01

Manual of Experimental Embryology . University of Chicago Press, Chicago. Harris JS, Bemenderfer TB, Wessel AR, Kacena MA (2013) A review of mouse...proliferation and apoptosis . Dev Dynam 219:237-247. Patterson TE, Kumagal K, Griffith L, Muschler GF (2008) Cellular strategies for enhancement

Sequence similarities of protein kinase substrates and inhibitors with immunoglobulins and model immunoglobulin homologue: cell adhesion molecule from the living fossil sponge Geodia cydonium. Mapping of coherent database similarities and implications for evolution of CDR1 and hypermutation

Czech Academy of Sciences Publication Activity Database

Kubrycht, J.; Borecký, Jiří; Souček, P.; Ježek, Petr

2004-01-01

Roč. 49, č. 3 (2004), s. 219-246 ISSN 0015-5632 R&D Projects: GA MZd NJ6747 Institutional research plan: CEZ:AV0Z5011922 Keywords : CDR1 * immunoglobulin Subject RIV: EE - Microbiology, Virology Impact factor: 1.034, year: 2004

Biochemical and Physicochemical Background of Mammalian Androgen Activity in Winter Wheat Exposed to Low Temperature

Czech Academy of Sciences Publication Activity Database

Janeczko, A.; Biesaga-Koscielniak, J.; Dziurka, M.; Filek, M.; Hura, K.; Jurczyk, B.; Kula, M.; Oklešťková, Jana; Novák, Ondřej; Rudolphi-Skórska, E.; Skoczowski, A.

2018-01-01

Roč. 37, č. 1 (2018), s. 199-219 ISSN 0721-7595 Institutional support: RVO:61389030 Keywords : Androstenedione * Frost resistance * Langmuir analysis * Phytohormones * Soluble sugars * Winter wheat Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.073, year: 2016

Improving Alcohol Screening for College Students: Screening for Alcohol Misuse amongst College Students with a Simple Modification to the CAGE Questionnaire

Science.gov (United States)

Taylor, Purcell; El-Sabawi, Taleed; Cangin, Causenge

2016-01-01

Objective: To improve the CAGE (Cut down, Annoyed, Guilty, Eye opener) questionnaire's predictive accuracy in screening college students. Participants: The sample consisted of 219 midwestern university students who self-administered a confidential survey. Methods: Exploratory factor analysis, confirmatory factor analysis, receiver operating…

No effect of ploidy level in plant response to competition in a common garden experiment

Czech Academy of Sciences Publication Activity Database

Münzbergová, Zuzana

2007-01-01

Roč. 92, - (2007), s. 211-219 ISSN 0024-4066 R&D Projects: GA AV ČR KJB6111303 Institutional research plan: CEZ:AV0Z60050516 Keywords : adaptation * Asteraceae * Bromus erectus Subject RIV: EF - Botanics Impact factor: 2.368, year: 2007

Nitrogen use efficiency evaluation of aerobic rice under field capacity water potential using {sup 15}N isotopic tracer technique

Energy Technology Data Exchange (ETDEWEB)

Wahid, Ahmad Nazrul Abd, E-mail: a-nazrul@nuclearmalaysia.gov.my [Faculty of Science and Technology, Universiti Kebangsaan Malaysia, Bangi, 43600, Selangor (Malaysia); Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia); Rahim, Sahibin Abd, E-mail: haiyan@ukm.edu.my [Faculty of Science and Technology, Universiti Kebangsaan Malaysia, Bangi, 43600, Selangor (Malaysia); Rahim, Khairuddin Abdul; Harun, Abdul Rahim [Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)

2015-09-25

This study was carried out to evaluate the efficiency use of the nitrogen fertilizer on aerobic rice varieties MR219-4 and MR219-9 which were grown aerobically under field capacity water potential at the controlled environment area or shield house. Direct {sup 15}N isotope tracer method was used in this study, whereby the {sup 15}N isotope was utilized as a tracer for nitrogen nutrient uptake. {sup 15}N isotope presence in the samples is determined by using emission spectrometer analysis and percentage of total nitrogen is determined by using Kjeldahl method. {sup 15}N atom access value contained in the sample will be used in determining the effectiveness of the use of nitrogen in fertilizers through the specific calculation formulas. In this work, the data several data of nitrogen derived from fertilizer (Ndff), total nitrogen, nitrogen uptake and nitrogen use efficiency was obtained.

Breastfeeding practices in a public health field practice area in Sri Lanka: a survival analysis

Directory of Open Access Journals (Sweden)

Agampodi Thilini C

2007-10-01

Full Text Available Abstract Background Exclusive breastfeeding up to the completion of the sixth month of age is the national infant feeding recommendation for Sri Lanka. The objective of the present study was to collect data on exclusive breastfeeding up to six months and to describe the association between exclusive breastfeeding and selected socio-demographic factors. Methods A clinic based cross-sectional study was conducted in the Medical Officer of Health area, Beruwala, Sri Lanka in June 2006. Mothers with infants aged 4 to 12 months, attending the 19 child welfare clinics in the area were included in the study. Infants with specific feeding problems (cleft lip and palate and primary lactose intolerance were excluded. Cluster sampling technique was used and consecutive infants fulfilling the inclusion criteria were enrolled. A total of 219 mothers participated in the study. The statistical tests used were survival analysis (Kaplan-Meier survival curves and Cox proportional Hazard model. Results All 219 mothers had initiated breastfeeding. The median duration of exclusive breastfeeding was four months (95% CI 3.75, 4.25. The rates of exclusive breastfeeding at 4 and 6 months were 61.6% (135/219 and 15.5% (24/155 respectively. Bivariate analysis showed that the Muslim ethnicity (p = 0.004, lower levels of parental education (p Conclusion The rate of breastfeeding initiation and exclusive breastfeeding up to the fourth month is very high in Medical Officer of Health area, Beruwala, Sri Lanka. However exclusive breastfeeding up to six months is still low and the prevalence of inappropriate feeding practices is high.