WorldWideScience

Sample records for actinium 219

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.

    1977-01-01

    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  4. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.

    1979-01-01

    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  6. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  7. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  8. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W

    1950-06-16

    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  9. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.

    1993-01-01

    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  13. Comment: 219 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Japanese medaka Oryzias latipes Oryzias_latipes_L.png 219.png Taxonomy icon (c) Database Center for Life Sci...ence licensed under CC Attribution2.1 Japan アイコン:メダカ HNI-Ⅱ系統バージョン bando 2010/02/15 15:31:07 2010/02/16 09:53:27 ...

  14. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

    2016-01-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  17. 47 CFR 25.219 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false [Reserved] 25.219 Section 25.219 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.219 [Reserved] ...

  18. 219-S CORROSION STUDY

    International Nuclear Information System (INIS)

    DIVINE, J.R.; PARSONS, G.L.

    2008-01-01

    A minor leak was detected in a drain line for Hood 2B located in the 222-S Laboratory. The line transfers radioactive waste, spent analytical standards, and chemicals used in various analytical procedures. Details are in the report provided by David Comstock, 2B NDE June 2008, work package LAB-WO-07-2012. Including the noted leak, the 222-S Laboratory has experienced two drain line leaks in approximately the last two years of operation. As a consequence, CH2M HILL Hanford Group, Inc. (CH2M HILL) requested the support of ChemMet, Ltd., PC (ChemMet) at the Hanford Site 222-S Laboratory. The corrosion expertise from ChemMet was required prior to preparation of a compatibility assessment for the 222-S Laboratory waste transfer system to assure the expected life of the piping system is extended as much as practicable. The system includes piping within the 222-S Laboratory and the 219-S Waste Storage and Transfer Facility and Operations Process. The ChemMet support was required for an assessment by 222-S staff to analyze what improvements to operational activities may be implemented to extend the tank/piping system life. This assessment will include a summary of the various material types, age, and locations throughout the facility. The assessment will also include a discussion of materials that are safe for drain line disposal on a regular basis, materials that are safe for disposal on a case-by-case basis including specific additional requirements such as flushing, neutralization to a specific pH, and materials prohibited from disposal. The assessment shall include adequate information for 222-S Laboratory personnel to make informed decisions in the future disposal of specific material types by discussing types of compatibility of system materials and potential wastes. The assessment is expected to contain some listing of acceptable waste materials but is not anticipated to be a complete or comprehensive list. Finally the assessment will encompass a brief discussion of

  19. 46 CFR 10.219 - Fees.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Fees. 10.219 Section 10.219 Shipping COAST GUARD... Requirements for All Merchant Mariner Credentials § 10.219 Fees. (a) Use table 10.219(a) of this section to calculate the mandatory fees for MMCs and associated endorsements. Table 10.219(a) Fees If you apply for And...

  20. 15 CFR 280.219 - Settlement.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Settlement. 280.219 Section 280.219... Enforcement § 280.219 Settlement. (a) Cases may be settled before service of a charging letter. In cases in which settlement is reached before service of a charging letter, a proposed charging letter will be...

  1. 49 CFR 21.9 - Compliance information.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Compliance information. 21.9 Section 21.9 Transportation Office of the Secretary of Transportation NONDISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS OF THE DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.9 Compliance information. (a) Cooperation and...

  2. 49 CFR 219.13 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 219.13 Section 219.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.13 Preemptive effect. (a) Under...

  3. 45 CFR 150.219 - Final determination.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Final determination. 150.219 Section 150.219... Are Failing To Substantially Enforce HIPAA Requirements § 150.219 Final determination. If, after... the State a written notice of its final determination. The notice includes the following: (a...

  4. 22 CFR 219.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 219.140 Section 219.140 Foreign... DEVELOPMENT § 219.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  5. 36 CFR 219.2 - Principles.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Principles. 219.2 Section 219... Forest System Land and Resource Management Planning Purpose and Principles § 219.2 Principles. The planning regulations in this subpart are based on the following principles: (a) The first priority for...

  6. 49 CFR 219.17 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Construction. 219.17 Section 219.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.17 Construction. Nothing in this part— (a) Restricts...

  7. 22 CFR 219.160 - Communications.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 219.160 Section 219.160 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... communication with applicants, participants, personnel of other Federal entities, and members of the public. (1...

  8. 37 CFR 1.219 - Early publication.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Early publication. 1.219... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication of Applications § 1.219 Early publication. Applications that will be published under § 1.211 may be published...

  9. 20 CFR 219.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... Annuity), 234 (Lump-Sum Payments), and 222 (Family Relationships), certain requirements must be met before... used as evidence. Part 222 defines and explains family relationships for which evidence requirements... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 219.1 Section 219.1 Employees...

  10. 20 CFR 219.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Definitions. 219.2 Section 219.2 Employees... some other person. Benefit means any employee annuity, spouse annuity, survivor annuity, or lump-sum... proves to the satisfaction of the Board that an individual meets a requirement for eligibility for...

  11. 49 CFR 219.207 - Fatality.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Post-Accident Toxicological Testing § 219.207 Fatality. (a) In the..., United States Code (but not the agent of the Secretary for purposes of the Federal Tort Claims Act...

  12. Radiological risk of actinon (/sup 219/Rn)

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, D.J.

    1981-12-01

    The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the /sup 219/Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of /sup 219/Rn on determinations of the concentration of the /sup 222/Rn decay chain and/or its precursors.

  13. Radiological risk of actinon (219Rn)

    International Nuclear Information System (INIS)

    Crawford, D.J.

    1981-12-01

    The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the 219 Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of 219 Rn on determinations of the concentration of the 222 Rn decay chain and/or its precursors

  14. 36 CFR 219.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... System Land and Resource Management Planning Purpose and Principles § 219.1 Purpose. (a) Land and... management of these lands. (3) Sustainability, composed of interdependent ecological, social, and economic elements, embodies the principles of multiple-use and sustained-yield without impairment to the...

  15. 48 CFR 219.702 - Statutory requirements.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 219.702 Statutory requirements. (1) Section 834 of Public Law 101-189, as amended (15 U.S.C. 637... on a corporate, division, or plant-wide basis will reduce administrative burdens while enhancing...

  16. 49 CFR 219.800 - Annual reports.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Annual Report § 219.800 Annual reports. (a) Each... also use the electronic version of the MIS form provided by the DOT. The Administrator may designate... submission to FRA. For information on where to submit MIS forms and for the electronic version of the form...

  17. 12 CFR 219.6 - Payment procedures.

    Science.gov (United States)

    2010-01-01

    ... obtain payment of costs incurred prior to the time the financial institution receives this notice. [Reg... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.6 Payment procedures. (a) Notice...

  18. 36 CFR 219.36 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Forest System Land and Resource Management Planning Definitions § 219.36 Definitions. Definitions of the... vision for a specific area of land or type of land within the plan area. Statements of desired conditions... species of plants or animals which are not indigenous to an area but valued for their contribution to...

  19. 49 CFR 219.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.5 Definitions. As used in this part— Accident or... alcohol) that has known mind- or function-altering effects on a human subject, specifically including any... ownership or control of the railroad and not operated or staffed by a salaried officer or employee of the...

  20. 36 CFR 219.20 - Ecological sustainability.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Ecological sustainability... Sustainability § 219.20 Ecological sustainability. To achieve ecological sustainability, the responsible official... diversity and species diversity are components of ecological sustainability. The planning process must...

  1. 48 CFR 219.800 - General.

    Science.gov (United States)

    2010-10-01

    ... (Acquisition, Technology, and Logistics) its authority under paragraph 8(a)(1)(A) of the Small Business Act (15... DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.800 General. (a) By Partnership Agreement (PA) between the Small Business...

  2. 36 CFR 219.17 - Interaction with private landowners.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with private landowners. 219.17 Section 219.17 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Sustainability § 219.17 Interaction with private landowners. The responsible official must seek to collaborate...

  3. 48 CFR 1353.219 - Small business programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business programs. 1353.219 Section 1353.219 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS FORMS Prescription of Forms 1353.219 Small business programs. Use Form CD-570, Small Business Set...

  4. 48 CFR 653.219 - Small business programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business programs. 653.219 Section 653.219 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES AND FORMS FORMS Prescription of Forms 653.219 Small business programs. ...

  5. 48 CFR 52.219-22 - Small Disadvantaged Business Status.

    Science.gov (United States)

    2010-10-01

    .... Status as a small business and status as a small disadvantaged business for general statistical purposes... Business Status. 52.219-22 Section 52.219-22 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.219-22 Small Disadvantaged Business Status. As prescribed in 19.308(b), insert the following...

  6. 49 CFR 1542.219 - Supplementing law enforcement personnel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Supplementing law enforcement personnel. 1542.219 Section 1542.219 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.219 Supplementing law...

  7. 20 CFR 219.23 - Evidence to prove death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...

  8. 36 CFR 219.19 - Ecological, social, and economic sustainability.

    Science.gov (United States)

    2010-07-01

    ... economic sustainability. 219.19 Section 219.19 Parks, Forests, and Public Property FOREST SERVICE..., Social, and Economic Sustainability § 219.19 Ecological, social, and economic sustainability. Sustainability, composed of interdependent ecological, social, and economic elements, embodies the Multiple-Use...

  9. 7 CFR 58.219 - High pressure pumps and lines.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false High pressure pumps and lines. 58.219 Section 58.219....219 High pressure pumps and lines. High pressure lines may be cleaned-in-place and shall be of such construction that dead ends, valves and the high pressure pumps can be disassembled for hand cleaning. The high...

  10. Configurations and level structure of 219Rn

    International Nuclear Information System (INIS)

    Sheline, R.K.; Liang, C.F.; Paris, P.

    1998-01-01

    The level structure of 219 Rn has been studied using the alpha decay of 223 Ra and coincident gamma rays. While only modest changes are required in the level structure, and only above 342.8 keV, severe changes are required throughout the level scheme in the spin assigments. These changes allow the assignment of two sets of anomalous bands with K=5/2 ± and K=3/2 ± . The K=5/2 ± bands have configurations intermediate between the reflection asymmetric configuration and the g 9/2 shell model configuration, while the K=3/2 ± bands have configurations intermediate between the mixed reflection asymmetric configuration and the i 11/2 shell model configuration. Comparison of the systematics of 219 Rn with neighboring isotones, isobars, and isotopes shows clearly the collapse of the quadrupole-octupole-type configurations into the less degenerate shell model configurations. copyright 1998 The American Physical Society

  11. 14 CFR 21.9 - Replacement and modification articles.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Replacement and modification articles. 21.9... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.9 Replacement and modification articles. (a) If a person knows, or should know, that a replacement or modification article is reasonably likely to be...

  12. 20 CFR 219.24 - Evidence of presumed death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of presumed death. 219.24 Section... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.24 Evidence of presumed death. When a person cannot be proven dead but evidence of death is needed, the Board may presume he or she died at a certain...

  13. 12 CFR 219.1 - Authority, purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Authority, purpose and scope. 219.1 Section 219.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM REIMBURSEMENT FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS...

  14. 43 CFR 2.19 - When will bureaus waive fees?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false When will bureaus waive fees? 2.19 Section... OF INFORMATION ACT Requests for Records under the FOIA § 2.19 When will bureaus waive fees? (a) Fees... section and appendix D to this part. The burden is on you to justify entitlement to a fee waiver. Requests...

  15. 40 CFR 86.219-94 - CVS calibration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false CVS calibration. 86.219-94 Section 86.219-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  16. 20 CFR 219.43 - Evidence of child's dependency.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of child's dependency. 219.43... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.43 Evidence of child's dependency. (a) When the dependency requirement must be met. Usually the dependency requirement must be met at one of the...

  17. 30 CFR 219.102 - Method of payment.

    Science.gov (United States)

    2010-07-01

    ... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...

  18. 48 CFR 1852.219-73 - Small business subcontracting plan.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 1852.219-73 Small business subcontracting plan. As prescribed in 1819.708-70(a), insert the following provision: Small Business Subcontracting Plan (MAY 1999) (a) This provision is not... contain FAR clause 52.219-9, “Small Business Subcontracting Plan.” The apparent low bidder must submit the...

  19. 49 CFR 173.219 - Life-saving appliances.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Life-saving appliances. 173.219 Section 173.219... Life-saving appliances. (a) A life-saving appliance, self-inflating or non-self-inflating, containing small quantities of hazardous materials that are required as part of the life-saving appliance must...

  20. 36 CFR 219.18 - Role of advisory committees.

    Science.gov (United States)

    2010-07-01

    ... PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for... variety of public purposes, particularly those groups organized to develop landscape goals (§ 219.12(b...

  1. 48 CFR 52.219-1 - Small Business Program Representations.

    Science.gov (United States)

    2010-10-01

    ... section 8(a), 8(d), 9, or 15 of the Small Business Act or any other provision of Federal law that... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Program....219-1 Small Business Program Representations. As prescribed in 19.308(a)(1), insert the following...

  2. 21 CFR 2.19 - Methods of analysis.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ADMINISTRATIVE RULINGS AND DECISIONS General Provisions § 2.19 Methods of analysis. Where the method of analysis... issues of the “Journal of the Association of Official Analytical Chemists”), which are incorporated by...

  3. 26 CFR 1.219-2 - Definition of active participant.

    Science.gov (United States)

    2010-04-01

    ... individuals whose compensation exceeds a certain amount accrue benefits under the plan. An individual whose... participant. However, any benefit that may vary with future compensation of an individual provides additional... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of active participant. 1.219-2...

  4. 9 CFR 93.219 - Declaration for poultry.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Declaration for poultry. 93.219... AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS...

  5. 48 CFR 53.219 - Small Business Programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Programs... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.219 Small Business Programs. (a) The following form may be used in reporting small disadvantaged business contracting data: OF 312 (10/00), Small...

  6. 48 CFR 52.219-2 - Equal Low Bids.

    Science.gov (United States)

    2010-10-01

    .... If the bidder is awarded a contract as a result of receiving priority consideration under this... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.219-2 Equal...) amount to more than 50 percent of the contract price. (c) Failure to identify the labor surplus areas as...

  7. 12 CFR 219.23 - Recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-01-01

    ... Funds § 219.23 Recordkeeping and reporting requirements. (a) Domestic and international funds transfers... recordkeeping and reporting requirements for domestic and international funds transfers by insured depository... usefulness in criminal, tax, or regulatory investigations or proceedings. These regulations are codified at...

  8. 12 CFR 219.5 - Conditions for payment.

    Science.gov (United States)

    2010-01-01

    ... financial records prior to the time the financial institution is notified of such event. (c) Itemized bill... FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.5 Conditions for...

  9. 36 CFR 219.4 - Identification and consideration of issues.

    Science.gov (United States)

    2010-07-01

    ... capabilities and available resources, including current and likely Forest Service budgets; (iv) The scientific... restore ecological conditions that are similar to the biological and physical range of expected variability (§ 219.20(b)(1)); and (vii) Opportunities to contribute to knowledge about and preservation of...

  10. 48 CFR 552.219-76 - Mentor Requirements and Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and....219-76 Mentor Requirements and Evaluation. As prescribed in 519.7017(b), insert the following clause: Mentor Requirements and Evaluation (SEP 2009) (a) The purpose of the GSA Mentor-Protégé Program is for a...

  11. 48 CFR 752.219-71 - Mentor requirements and evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor requirements and....219-71 Mentor requirements and evaluation. As prescribed in AIDAR 719.273-11(b), insert the following clause: Mentor Requirements and Evaluation (July 13, 2007) (a) Mentor and Protégé firms shall submit an...

  12. 48 CFR 1852.219-79 - Mentor requirements and evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor requirements and... and Clauses 1852.219-79 Mentor requirements and evaluation. As prescribed in 1819.7215, insert the following clause: Mentor Requirements and Evaluation (MAY 2009) (a) The purpose of the NASA Mentor-Protégé...

  13. 33 CFR 135.219 - Notification of changes affecting certification.

    Science.gov (United States)

    2010-07-01

    ... SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.219 Notification of changes affecting... Fund Administrator in writing when any changes occur which prevent the owner, operator, or guarantor...

  14. 20 CFR 725.219 - Duration of entitlement; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Duration of entitlement; child. 725.219... of entitlement; child. (a) An individual is entitled to benefits as a child for each month beginning... month in which any one of the following events first occurs: (1) The child dies; (2) The child marries...

  15. 48 CFR 52.219-9 - Small business subcontracting plan.

    Science.gov (United States)

    2010-10-01

    ... Clauses 52.219-9 Small business subcontracting plan. As prescribed in 19.708(b), insert the following clause: Small Business Subcontracting Plan (OCT 2010) (a) This clause does not apply to small business... business, and women-owned small business concerns. If the offeror is submitting an individual contract plan...

  16. Morphological differentiation of Streptomyces viridochromogenes E-219 on solid culture

    International Nuclear Information System (INIS)

    Liang Xinle; Zhu Jing; Jin Yingyan

    2012-01-01

    The Streptomyces viridochromogenes E-219 was derived from Streptomyces viridochromogenes CGMCC4.1119 treated with 60 Co γ-rays irradiation and protoplast fusion. With the help of fluorescent probes, fluorescence microscope and electron microscopy, the morphology and development of E-219 on solid surface culture were investigated in this study. The effect of agarslant culture time on the production of Avilamycin was also studied to provide theoretical basis for industrial fermentation of selecting the appropriate seed to culture on the agarslant culture medium. The results implied that the development of colonies of Streptomyces viridochromogenes accompanied the intermittent hyhae apoptosis, and the production of spores was from the active mycelium. The colonial morphology of strain E-219 was significantly different from the original strain CGMCC4h1119. There were variegated hyphae formation in the stage of spore germination and initial hyphae development (10 h) with the live and dead segments alternated in a highly regular fashion within the same hypha. After the early single colony formation, the third phase was followed by profuse growth of the live segments derived from the variegated hypha, then the second apoptosis of the mycelia (48 h) was occurred with another quick growth, and sporulation was occurred at 96 h. Strain CGMCC4.1119 had spiral sporotrichial and round conidiophores with spike, whereas strain E-219 had linear sporotrichial, smooth and dylindrical conidiophore. The results of shake flask experiments indicated that the spores of E-219 had that highest activity when cultured on agarslant culture medium and incubated for 106 h with the production of avilamycin up to 1200 mg/L. (authors)

  17. 36 CFR 219.15 - Interaction with American Indian tribes and Alaska Natives.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with American Indian tribes and Alaska Natives. 219.15 Section 219.15 Parks, Forests, and Public Property FOREST... Collaborative Planning for Sustainability § 219.15 Interaction with American Indian tribes and Alaska Natives...

  18. 36 CFR 219.12 - Collaboration and cooperatively developed landscape goals.

    Science.gov (United States)

    2010-07-01

    ... cooperatively developed landscape goals. 219.12 Section 219.12 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for Sustainability § 219.12 Collaboration and cooperatively developed landscape goals. (a...

  19. 48 CFR 752.219-8 - Utilization of small business concerns and small disadvantaged business concerns.

    Science.gov (United States)

    2010-10-01

    ... business concerns and small disadvantaged business concerns. 752.219-8 Section 752.219-8 Federal... AND CONTRACT CLAUSES Texts of Provisions and Clauses 752.219-8 Utilization of small business concerns and small disadvantaged business concerns. The Foreign Assistance Act calls for USAID to give small...

  20. 48 CFR 1352.219-71 - Notification to delay performance (Deviation).

    Science.gov (United States)

    2010-10-01

    ... performance (Deviation). 1352.219-71 Section 1352.219-71 Federal Acquisition Regulations System DEPARTMENT OF....219-71 Notification to delay performance (Deviation). As prescribed in 48 CFR 1319.811-3(b), insert the following clause: Notification To Delay Performance (Deviation) (APR 2010) The contractor shall...

  1. 48 CFR 552.219-72 - Preparation, Submission, and Negotiation of Subcontracting Plans.

    Science.gov (United States)

    2010-10-01

    ..., and Negotiation of Subcontracting Plans. 552.219-72 Section 552.219-72 Federal Acquisition Regulations... Text of Provisions and Clauses 552.219-72 Preparation, Submission, and Negotiation of Subcontracting... Negotiation of Subcontracting Plans (JUN 2005) (a) An offeror, other than a small business concern, submitting...

  2. 48 CFR 1552.219-71 - Procedures for Participation in the EPA Mentor-Protege Program.

    Science.gov (United States)

    2010-10-01

    ... Participation in the EPA Mentor-Protege Program. 1552.219-71 Section 1552.219-71 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.219-71 Procedures for Participation in the EPA Mentor-Protege... EPA Mentor-Protege Program (OCT 2000) (a) This provision sets forth the procedures for participation...

  3. 27 CFR 28.219 - Return of wine withdrawn for export with benefit of drawback.

    Science.gov (United States)

    2010-04-01

    ... Exportation of Wine With Benefit of Drawback § 28.219 Return of wine withdrawn for export with benefit of... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Return of wine withdrawn for export with benefit of drawback. 28.219 Section 28.219 Alcohol, Tobacco Products and Firearms...

  4. Zinc finger protein 219-like (ZNF219L) and Sox9a regulate synuclein-γ2 (sncgb) expression in the developing notochord of zebrafish.

    Science.gov (United States)

    Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Liao, Yung-Feng; Han, Yu-San; Huang, Chang-Jen

    2013-12-13

    Zebrafish synuclein-γ2 (sncgb) has been reported to be expressed specifically in the notochord. However, the mechanism by which the sncgb gene promoter is regulated has not been described. In this paper, we demonstrate that Zinc finger protein 219-like (ZNF219L) and sox9a are involved in the regulation of sncgb gene expression. Furthermore, we observed that over-expression of both ZNF219L and Sox9a resulted in increased sncgb expression. In addition, ZNF219L is physically associated with Sox9a, and simultaneous morpholino knockdown of znf219L and sox9a caused a synergistic decrease of sncgb expression in the notochord. Taken together, our results reveal that coordination of ZNF219L with Sox9a is involved in the regulation of notochord-specific expression of sncgb. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

  5. Evaluation of Nitrogen Uptake and Growth Performance of Advanced Mutant Lines MR219-4 and MR219-9 Grown Under Aerobic Conditions

    International Nuclear Information System (INIS)

    Shyful Azizi Abdul Rahman; Abdul Rahim Harun; Rusli Ibrahim; Khairuddin Abdul Rahim

    2014-01-01

    Developing a good crop production management package; drought resistance variety, effective water and nutrient management in rice production practices is crucial for global climate change adaptation. A research project under IAEA RAS5065 (Supporting Climate-Proofing Rice Production Systems (CRiPS) Based on Nuclear Applications) was conducted from 2012 to 2013, in collaboration with MARDI. Two advanced mutant lines, MR219-4 and MR219-9 were used in this research project to evaluate growth, yield potential and fertilizer uptake under different water input condition (flooded and aerobic). The advanced mutant line MR219-9 showed comparable growth, yield and nitrogen uptake under both flooded and aerobic conditions. The yield and yield components are not significantly different from the parent variety (MR219) but total N uptake was lower than MR219 regardless of water regime. The field trial showed that MR219-9 has a better total N content which is comparable to the aerobic rice variety (MRIA 1) and this indicates that this advance mutant line MR219-9 is a potential aerobic rice variety. (author)

  6. 25 CFR 166.219 - How do I acquire a permit through negotiation?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How do I acquire a permit through negotiation? 166.219 Section 166.219 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GRAZING PERMITS Permit Requirements Obtaining A Permit § 166.219 How do I acquire a permit through negotiation? (a) Permits may be negotiated and granted by th...

  7. Evaluation and characterization of advanced rice mutant line of rice (Oryza sativa), MR219-4 and MR219-9 under drought condition

    International Nuclear Information System (INIS)

    Abdul Rahim Harun; Zarith Shafika Kamarudin; Abdullah, M.Z.; Anna, L.P.K.; Sobri Hussain; Rusli Ibrahim; Khairuddin abdul Rahim

    2012-01-01

    Two advance rice mutant lines, MR219-4 and MR219-9 derived from mutagenesis of Oryza sativa cv. MR219 with gamma radiation at 300 Gy were evaluated in simulated drought condition in the greenhouse at Malaysian Nuclear Agency. The mutants were evaluated simultaneously with ARN1, a drought resistant variety and MR211 a susceptible cultivar as a check. Randomized complete block design with three replicates was used in the experiment. The evaluation and selection were done based on leaf rolling and leaf drying as well as other agronomic traits, such as, number of tillers per plant, plant height, flag leaf area, grain weight per plant, grain yield per plant, 100-grain weight, harvest index, panicle length and plant biomass. The mutants MR219-4 showed moderate tolerance and MR219-9 showed tolerance to drought respectively as compare to the check variety (ARN1, MR211) and control MR219. Leaf rolling, leaf drying, days to flowering and days to maturity are valuable secondary traits that may provide additional information for selection because of associating with the plant survival under water stress. Further research on expression of drought-tolerant lines under different drought conditions is essential in order to identify particular traits that are associated with drought tolerance and high yield potential. Similarly the importance of secondary traits, relative to other putative traits for drought tolerance, needs to be tested in various environments. (author)

  8. 49 CFR 219.701 - Standards for drug and alcohol testing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Standards for drug and alcohol testing. 219.701... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Drug and Alcohol Testing Procedures § 219.701 Standards for drug and alcohol testing. (a) Drug testing required or authorized by subparts B...

  9. 25 CFR 2.19 - Action by Area Directors and Education Programs officials on appeal.

    Science.gov (United States)

    2010-04-01

    ... Programs officials on appeal. (a) Area Directors, Area Education Programs Administrators, Agency... 25 Indians 1 2010-04-01 2010-04-01 false Action by Area Directors and Education Programs officials on appeal. 2.19 Section 2.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROCEDURES...

  10. 48 CFR 252.219-7004 - Small business subcontracting plan (test program).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7004 Small business subcontracting plan (test program). As prescribed in 219.708(b)(1)(B), use the following clause: Small Business...

  11. 48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan (DoD contracts). As prescribed in 219.708(b)(1)(A), use the following clause: Small Business...

  12. 20 CFR 219.50 - When evidence of “living with” is required.

    Science.gov (United States)

    2010-04-01

    ... with” is required. Evidence of “living with” (see part 222 of this chapter on Family Relationships) is... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of âliving withâ is required. 219.50 Section 219.50 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD...

  13. MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction

    DEFF Research Database (Denmark)

    Kocerha, Jannet; Faghihi, Mohammad Ali; Lopez-Toledano, Miguel A

    2009-01-01

    significantly modulated behavioral responses associated with disrupted NMDA receptor transmission. Furthermore, pretreatment with the antipsychotic drugs haloperidol and clozapine prevented dizocilpine-induced effects on miR-219. Taken together, these data support an integral role for miR-219 in the expression...

  14. 48 CFR 219.7104 - Developmental assistance costs eligible for reimbursement or credit.

    Science.gov (United States)

    2010-10-01

    ... costs eligible for reimbursement or credit. 219.7104 Section 219.7104 Federal Acquisition Regulations... reimbursement or credit. (a) Developmental assistance provided under an approved mentor-protege agreement is... eligible for reimbursement are set forth in appendix I. (b) Before incurring any costs under the Program...

  15. 40 CFR 80.219 - Designation and downstream requirements for GPA gasoline.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Designation and downstream requirements for GPA gasoline. 80.219 Section 80.219 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... sold or dispensed for use in motor vehicles at a retail outlet or wholesale purchaser-consumer facility...

  16. 20 CFR 219.33 - Evidence of a deemed valid marriage.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a deemed valid marriage. 219.33... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.33 Evidence of a deemed valid marriage. (a) Preferred evidence. Preferred evidence of a deemed valid marriage is— (1) Evidence of a ceremonial marriage...

  17. 20 CFR 219.32 - Evidence of a common-law marriage.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes that...

  18. 20 CFR 219.30 - When evidence of marriage is required.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of marriage is required. 219.30... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.30 When evidence of marriage is required. (a) When an application is filed for benefits. Documentary evidence of marriage is required when an...

  19. 20 CFR 219.42 - When evidence of child's dependency is required.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of child's dependency is required. 219.42 Section 219.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... child's dependency is required. Evidence of a child's dependency on the employee is required when— (a...

  20. 48 CFR 2452.219-70 - Small business subcontracting plan compliance.

    Science.gov (United States)

    2010-10-01

    ... of Provisions and Clauses 2452.219-70 Small business subcontracting plan compliance. As prescribed in 2419.708(d), insert the following provision: Small Business Subcontracting Plan Compliance (FEB 2006... the clause at FAR 52.219-9, Small Business Subcontracting Plan. (c) The government will consider...

  1. Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology

    2014-04-01

    The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)

  2. Project management plan for Project W-178, 219-S secondary containment

    International Nuclear Information System (INIS)

    Buckles, D.I.

    1995-01-01

    This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service

  3. 25 CFR 39.219 - What happens if a residential program does not maintain residency levels required by this subpart?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What happens if a residential program does not maintain residency levels required by this subpart? 39.219 Section 39.219 Indians BUREAU OF INDIAN AFFAIRS..., Student Counts, and Verifications Residential Programs § 39.219 What happens if a residential program does...

  4. 48 CFR 1052.219-73 - Department of the Treasury Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... Mentor-Protégé Program. 1052.219-73 Section 1052.219-73 Federal Acquisition Regulations System... and Clauses 1052.219-73 Department of the Treasury Mentor-Protégé Program. As described in DTAR 1019.202-70, insert the following provision: Department of the Treasury Mentor-Protégé Program (JAN 2000...

  5. 5 CFR 591.219 - How does OPM compute shelter price indexes?

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.219 How does OPM compute shelter price indexes? (a) In addition to rental...

  6. 20 CFR 219.35 - Evidence that a marriage has ended.

    Science.gov (United States)

    2010-04-01

    ... divorce or annulment; or (2) Evidence of the death (See § 219.23) of a party to the marriage. (b) Other..., the claimant must explain the reason therefor and submit other convincing evidence that the marriage...

  7. 48 CFR 852.219-72 - Evaluation factor for participation in the VA mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... participation in the VA mentor-protégé program. 852.219-72 Section 852.219-72 Federal Acquisition Regulations... Texts of Provisions and Clauses 852.219-72 Evaluation factor for participation in the VA mentor-protégé... the VA Mentor-Protégé Program (DEC2009) This solicitation contains an evaluation factor or sub-factor...

  8. A novel zinc finger protein 219-like (ZNF219L) is involved in the regulation of collagen type 2 alpha 1a (col2a1a) gene expression in zebrafish notochord.

    Science.gov (United States)

    Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Hung, Chin-Chun; Liao, Wei-Hao; Hwang, Pung-Pung; Han, Yu-San; Huang, Chang-Jen

    2013-01-01

    The notochord is required for body plan patterning in vertebrates, and defects in notochord development during embryogenesis can lead to diseases affecting the adult. It is therefore important to elucidate the gene regulatory mechanism underlying notochord formation. In this study, we cloned the zebrafish zinc finger 219-like (ZNF219L) based on mammalian ZNF219, which contains nine C2H2-type zinc finger domains. Through whole-mount in situ hybridization, we found that znf219L mRNA is mainly expressed in the zebrafish midbrain-hindbrain boundary, hindbrain, and notochord during development. The znf219L morpholino knockdown caused partial abnormal notochord phenotype and reduced expression of endogenous col2a1a in the notochord specifically. In addition, ZNF219L could recognize binding sites with GGGGG motifs and trigger augmented activity of the col2a1a promoter in a luciferase assay. Furthermore, in vitro binding experiments revealed that ZNF219L recognizes the GGGGG motifs in the promoter region of the zebrafish col2a1a gene through its sixth and ninth zinc finger domains. Taken together, our results reveal that ZNF219L is involved in regulating the expression of col2a1a in zebrafish notochord specifically.

  9. 48 CFR 52.219-19 - Small Business Concern Representation for the Small Business Competitiveness Demonstration Program.

    Science.gov (United States)

    2010-10-01

    ... Representation for the Small Business Competitiveness Demonstration Program. 52.219-19 Section 52.219-19 Federal... Representation for the Small Business Competitiveness Demonstration Program. As prescribed in 19.1008(a), insert the following provision: Small Business Concern Representation for the Small Business Competitiveness...

  10. 38 CFR 21.219 - Supplies consisting of clothing, magazines and periodicals, and items which may be personally...

    Science.gov (United States)

    2010-07-01

    ... clothing, magazines and periodicals, and items which may be personally used by the veteran. 21.219 Section....219 Supplies consisting of clothing, magazines and periodicals, and items which may be personally used... will be supplied. (b) Furnishing magazines and periodicals. Appropriate past issues of magazines...

  11. Evaluation of 3 Inch SN-219 Failure and S and SX Tank Farm Saltwell Piping

    International Nuclear Information System (INIS)

    ELSEN, J.J.

    2000-01-01

    Evaluation of direct buried piping currently in use or designated for future Saltwell pumping in S and SX Farms. Documented evaluation of failed S-103 saltwell pumping transfer line 3 inch SN-219. This evaluation is intended to reflect current status of Saltwell piping, when taken in context with referenced documents

  12. 29 CFR 779.219 - Unified operation may be achieved without common control or common ownership.

    Science.gov (United States)

    2010-07-01

    ... Act May Apply; Enterprise Coverage Unified Operation Or Common Control § 779.219 Unified operation may... through “unified operation.” It is clear from the definition that if the described activities are performed through unified operation they will be part of the enterprise whether they are performed by one...

  13. 48 CFR 1852.219-74 - Use of rural area small businesses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Use of rural area small... and Clauses 1852.219-74 Use of rural area small businesses. As prescribed in 1819.7103, insert the following clause: Use of Rural Area Small Business (SEP 1990) (a) Definitions. Rural area means any county...

  14. 48 CFR 52.219-8 - Utilization of small business concerns.

    Science.gov (United States)

    2010-10-01

    ... management and daily business operations of which are controlled by one or more veterans. Women-owned small... Clauses 52.219-8 Utilization of small business concerns. As prescribed in 19.708(a), insert the following clause: Utilization of Small Business Concerns (MAY 2004) (a) It is the policy of the United States that...

  15. 48 CFR 52.219-20 - Notice of Emerging Small Business Set-Aside.

    Science.gov (United States)

    2010-10-01

    ... Clauses 52.219-20 Notice of Emerging Small Business Set-Aside. As prescribed in 19.1008(b), insert the following provision: Notice of Emerging Small Business Set-Aside (JAN 1991) Offers or quotations under this acquisition are solicited from emerging small business concerns only. Offers that are not from an emerging...

  16. 48 CFR 52.219-6 - Notice of Total Small Business Set-Aside.

    Science.gov (United States)

    2010-10-01

    ... Clauses 52.219-6 Notice of Total Small Business Set-Aside. As prescribed in 19.508(c), insert the following clause: Notice of Total Small Business Set-Aside (JUN 2003) (a) Definition. Small business concern... qualified as a small business under the size standards in this solicitation. (b) General. (1) Offers are...

  17. 48 CFR 852.219-9 - VA Small business subcontracting plan minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Small business... Provisions and Clauses 852.219-9 VA Small business subcontracting plan minimum requirements. As prescribed in subpart 819.709, insert the following clause: VA Small Business Subcontracting Plan Minimum Requirements...

  18. 48 CFR 52.219-7 - Notice of Partial Small Business Set-Aside.

    Science.gov (United States)

    2010-10-01

    ... Clauses 52.219-7 Notice of Partial Small Business Set-Aside. As prescribed in 19.508(d), insert the following clause: Notice of Partial Small Business Set-Aside (JUN 2003) (a) Definitions. Small business..., and qualified as a small business under the size standards in this solicitation. (b) General. (1) A...

  19. 36 CFR 223.219 - Sustainable harvest of special forest products.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sustainable harvest of....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total...

  20. 18 CFR 367.2190 - Account 219, Accumulated other comprehensive income.

    Science.gov (United States)

    2010-04-01

    ... COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2190 Account 219...

  1. 50 CFR 216.219 - Renewal and modifications of Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.219 Renewal and modifications of Letters of Authorization. (a) A Letter of...

  2. Code Assessment of SPACE 2.19 using LSTF Steam Generator Tube Rupture Test

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)

    2016-10-15

    The SPACE is a best estimated two-phase three-field thermal-hydraulic analysis code used to analyze the safety and performance of pressurized water reactors. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. The present work is on the line of expanding the work by Kim et al. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run LSTF SB-SG-06 experiment simulating a Steam Generator Tube Rupture (SGTR) transient. In order to identify the predictability of SPACE 2.19, the LSTF steam generator tube rupture test was simulated. To evaluate the computed results, LSTF SB-SG-06 test data simulating the SGTR and the RELAP5/ MOD3.1 are used. The calculation results indicate that the SPACE 2.19 code predicted well the sequence of events and the major phenomena during the transient, such as the asymmetric loop behavior, reactor coolant system cooldown and heat transfer by natural circulation, the primary and secondary system depressurization by the pressurizer auxiliary spray and the steam dump using the intact loop steam generator relief valve.

  3. Code Assessment of SPACE 2.19 using LSTF 10% Main Steam-Line-Break Test

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)

    2016-10-15

    The Safety and Performance Analysis Code for Nuclear Power Plants (SPACE) has been developed in recent years by the Korea Hydro and Nuclear Power Co. through collaborative works with other Korean nuclear industries and research institutes. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run SBSL- 01 for a 10% main steam line break transient in a pressurized water reactor. The LSTF 10% main steam line break test were simulated using the SPACE 2.19 for code V and V work. The overall comparisons between the SPACE 2.19 code prediction and the LSTF Test Run SB-SL-01 experimental data are reasonably satisfactory. The comparisons were conducted in terms of the variations of mass flow rate, void fraction, pressure, collapsed liquid level, temperature, and system flow rate for the transient. In addition, the input model was modified for simulation accuracy of PZR pressure based on the calculated results. The correction of PORV setpoint affects to simulate the PORV open and close phenomena similarly with experiments. From the modification, the computed results show a reasonable agreement with experimental data in overall transient time.

  4. Occurrence of rhyolytic tuffs at deep sea drilling project site 219 on the Laccadive Ridge

    Digital Repository Service at National Institute of Oceanography (India)

    Siddiquie, H.N.; Sukheswala, R.N.

    A study of thin sections from the lower and middle parts of Unit 5 (Paleocene) from Site 219 shows that these largely consist of acidic or rhyolitic tuffs. The overlying limestones in Unit 5 (Paleocene) and Unit 4 (Lower Eocene) also contain...

  5. 48 CFR 352.219-71 - Mentor-protégé program reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Clauses 352.219-71 Mentor-protégé program reporting requirements. As prescribed in 319.270-1(b), the Contracting Officer shall insert the following clause: Mentor-Protégé Program Reporting Requirements (January...

  6. 48 CFR 652.219-72 - Department of State Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Department of State Mentor....219-72 Department of State Mentor-Protégé Program. As prescribed in 619.202-70(o)(1), insert the following provision: Department of State Mentor-Protégé Program (APR 2004) (a) Large and small businesses...

  7. 48 CFR 552.219-75 - GSA Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false GSA Mentor-ProtégÃ....219-75 GSA Mentor-Protégé Program. As prescribed in 519.7017(a), insert the following clause: GSA Mentor-ProtéGé Program (SEP 2009) (a) Prime contractors, including small businesses, are encouraged to...

  8. 48 CFR 952.219-70 - DOE Mentor-Protege program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false DOE Mentor-Protege program... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.219-70 DOE Mentor.... DOE Mentor-Protege Program (MAY 2000) The Department of Energy has established a Mentor-Protege...

  9. 36 CFR 219.11 - Monitoring and evaluation for adaptive management.

    Science.gov (United States)

    2010-07-01

    ... OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.11 Monitoring and evaluation for adaptive management. (a) Plan monitoring strategy... national, regional, and local supply and demand for products, services, and values. Special consideration...

  10. 20 CFR 219.31 - Evidence of a valid ceremonial marriage.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a valid ceremonial marriage. 219... marriage. (a) Preferred evidence. Preferred evidence of a ceremonial marriage is— (1) A copy of the public record of the marriage, certified by the custodian of the record or by a Board employee; (2) A copy of a...

  11. Estimating isotopic ratios, spatial distribution and inventory of radionuclides at Nuclear Sites 201, 219 and 221

    International Nuclear Information System (INIS)

    Gilbert, R.O.; Simpson, J.C.; Engel, D.W.; Kinnison, R.R.

    1984-03-01

    For NS201 the estimated average 239 240 Pu to 241 Am ratios for vegetation and soil are 7.3 and 11.5, respectively, where the 241 Am data were obtained using wet chemistry. The geometric mean 90 Sr to 137 Cs ratios for vegetation and soil at NS201 are estimated to be 1.1 and 1.9. These results suggest that the true (population) median 239 240 Pu to 241 Am and 90 Sr to 137 Cs ratios are smaller for vegetation than for soil at NS201. For NS219 and NS221 the estimated average 239 240 Pu to 241 Am ratios for surface soil at NS219 and NS221 are 2.8 and 0.78, respectively. There is an obvious statistical difference in the average 239 240 Pu to 241 Am ratios at these sites. The geometric mean 239 240 Pu to 241 Am ratios for vegetation samples at NS219 and NS221 are estimated to be 3.2 and 0.82, respectively. The data suggest there may be a difference in the 239 240 Pu to 241 Am ratios for soil and vegetation at NS219, but not at NS221. The geometric mean 90 Sr to 137 Cs ratio for surface soil at NS219 and NS221 combined is 0.93. The geometric mean 90 Sr to 137 Cs ratio for vegetation for the two sites (pooled data) is estimated to be 1.8. 43 references, 42 figures, 7 tables

  12. 41 CFR 302-3.219 - Is there a limit on how many times I may receive reimbursement for tour renewal travel?

    Science.gov (United States)

    2010-07-01

    ... many times I may receive reimbursement for tour renewal travel? 302-3.219 Section 302-3.219 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RELOCATION....219 Is there a limit on how many times I may receive reimbursement for tour renewal travel? (a) If you...

  13. I219V polymorphism in hMLH1 gene in patients affected with ulcerative colitis.

    Science.gov (United States)

    Vietri, Maria Teresa; Riegler, Gabriele; De Paola, Marialaura; Simeone, Serena; Boggia, Maria; Improta, Alessia; Parisi, Mariarita; Molinari, Anna Maria; Cioffi, Michele

    2009-04-01

    hMLH1 gene, lying on chromosome 3p21-23, is a key factor of the mismatch repair (MMR) complex, which amends DNA replication errors. MMR alterations are involved in the development of both hereditary and sporadic forms of colorectal carcinoma related to ulcerative colitis (UC). I219V Polymorphism is located on exon 8 of hMLH1 and provides an aminoacidic substitution of isoleucine to valine, on the protein codon 219. This may affect the speed and fidelity of protein synthesis because of a tRNA paucity or changes in the mRNA secondary structure. Most of the hereditary nonpolyposis colon cancer-associated missense mutations of hMLH1 cause structural changes of the amino- or carboxy-terminal regions, involving the domains that interact with ATP and hPMS2. In this study, we analyzed the hMLH1 I219V polymorphism frequency in colectomized patients with UC. Venous blood from 100 ulcerative patients and 97 apparently healthy subjects has been collected. Out of 100 patients affected with UC, 75 noncolectomized showed an alternating course of disease, while 25 did not respond to the common drugs, and underwent colectomy. Genotyping was performed by polymerase chain reaction and following enzymatic digestion by BccI. No significant differences were found between patients with UC and controls both for genotype and allele frequencies. However, our data show a significant association when colectomized and noncolectomized patients are compared. The frequencies of G homozygosity were 28% in colectomized and 10.7% in noncolectomized patients (p < 0.05, chi(2) = 4.4, Odds ratio = 3.3). The allele frequencies of allele A were 52% in colectomized and 68% in noncolectomized patients; while those of allele G were 48% and 32%, respectively. I219V polymorphism in hMLH1 could influence the clinical course of the disease and lead to resistance to therapy.

  14. 48 CFR 852.219-71 - VA mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA mentor-protégÃ....219-71 VA mentor-protégé program. As prescribed in 819.7115(a), insert the following clause: VA Mentor-Protégé Program (DEC 2009) (a) Large businesses are encouraged to participate in the VA Mentor-Protégé...

  15. 48 CFR 3052.219-71 - DHS mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false DHS mentor-protégÃ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.219-71 DHS mentor-protégé program. As prescribed in (HSAR) 48 CFR 3019.708-70(b), insert the following clause: DHS Mentor-Protégé Program (JUN 2006) (a...

  16. 48 CFR 1852.219-77 - NASA Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA Mentor-ProtégÃ... and Clauses 1852.219-77 NASA Mentor-Protégé Program. As prescribed in 1819.7215, insert the following clause: NASA Mentor-Protégé Program (MAY 2009) (a) Prime contractors are encouraged to participate in the...

  17. 48 CFR 752.219-70 - USAID Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false USAID Mentor-ProtégÃ....219-70 USAID Mentor-Protégé Program. As prescribed in 719.273-11(a), insert the following provision: USAID Mentor-Protégé Program (July 13, 2007) (a) Large and small business are encouraged to participate...

  18. Conceptual design report, 219-S secondary containment upgrade, Project W-178

    International Nuclear Information System (INIS)

    Beyer, J.J.

    1993-05-01

    The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000

  19. The TLX-miR-219 cascade regulates neural stem cell proliferation in neurodevelopment and schizophrenia iPSC model.

    Science.gov (United States)

    Murai, Kiyohito; Sun, Guoqiang; Ye, Peng; Tian, E; Yang, Su; Cui, Qi; Sun, Guihua; Trinh, Daniel; Sun, Olivia; Hong, Teresa; Wen, Zhexing; Kalkum, Markus; Riggs, Arthur D; Song, Hongjun; Ming, Guo-li; Shi, Yanhong

    2016-03-11

    Dysregulated expression of miR-219, a brain-specific microRNA, has been observed in neurodevelopmental disorders, such as schizophrenia (SCZ). However, its role in normal mammalian neural stem cells (NSCs) and in SCZ pathogenesis remains unknown. We show here that the nuclear receptor TLX, an essential regulator of NSC proliferation and self-renewal, inhibits miR-219 processing. miR-219 suppresses mouse NSC proliferation downstream of TLX. Moreover, we demonstrate upregulation of miR-219 and downregulation of TLX expression in NSCs derived from SCZ patient iPSCs and DISC1-mutant isogenic iPSCs. SCZ NSCs exhibit reduced cell proliferation. Overexpression of TLX or inhibition of miR-219 action rescues the proliferative defect in SCZ NSCs. Therefore, this study uncovers an important role for TLX and miR-219 in both normal neurodevelopment and in SCZ patient iPSC-derived NSCs. Moreover, this study reveals an unexpected role for TLX in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.

  20. MicroRNA-219-5p Promotes Tumor Growth and Metastasis of Hepatocellular Carcinoma by Regulating Cadherin 1

    Directory of Open Access Journals (Sweden)

    Jing Yang

    2018-01-01

    Full Text Available MicroRNAs play significant roles in the development of cancer and may serve as promising therapeutic targets. In our previous work, miR-219-5p was identified as one of the important metastasis-related microRNAs in HCC. Here we demonstrated that miR-219-5p expression was elevated in HCC tissues and was associated with vascular invasion and dismal prognosis. In multivariate analysis, miR-219-5p was identified as an independent prognostic indicator for HCC patients. Functional mechanism analyses showed that miR-219-5p promoted HCC cell proliferation and invasion in in vitro, as well as in vivo, tumor growth and metastasis in nude mice models bearing human HCC tumors. In addition, cadherin 1 (CDH1 was revealed to be a downstream target of miR-219-5p in HCC cells. In conclusion, miR-219-5p promotes tumor growth and metastasis of HCC by regulating CDH1 and can serve as a prognostic marker for HCC patients.

  1. ECNJEFI. A JEFI based 219-group neutron cross-section library: User's manual

    International Nuclear Information System (INIS)

    Stad, R.C.L. van der; Gruppelaar, H.

    1992-07-01

    This manual describes the contents of the ECNJEF1 library. The ECNJEF1 library is a JEF1.1 based 219-group AMPX-Master library for reactor calculations with the AMPX/SCALE-system, e.g. the PASC-3 system as implemented at the Netherlands Energy Research Foundation in Petten, Netherlands. The group cross-section data were generated with NJOY and NPTXS/XLACS-2 from the AMPX system. The data on the ECNJEF1 library allows resolved-resonance treatment by NITAWL and/or unresolved resonance self-shielding by BONAMI. These codes are based upon the Nordheim and Bondarenko methods, respectively. (author). 10 refs., 7 tabs

  2. VizieR Online Data Catalog: K2-19b light curve (Armstrong+, 2015)

    Science.gov (United States)

    Armstrong, D. J.; Santerne, A.; Veras, D.; Barros, S. C. C.; Demangeon, O.; Lillo-Box, J.; McCormac, J.; Osborn, H. P.; Tsantaki, M.; Almenara, J.-M.; Barrado, D.; Boisse, I.; Bonomo, A. S.; Brown, D. J. A.; Bruno, G.; Rey Cerda, J.; Courcol, B.; Deleuil, M.; Diaz, R. F.; Doyle, A. P.; Hebrard, G.; Kirk, J.; Lam, K. W. F.; Pollacco, D. L.; Rajpurohit, A.; Spake, J.; Walker, S. R.

    2015-08-01

    The Near Infrared Transiting ExoplanetS (NITES) Telescope is a semi-robotic 0.4m (f/10) Meade LX200GPS Schmidt-Cassegrain telescope installed at the ORM, La Palma. One transit of K2-19b was observed on 2015 Feb 28. The telescope was defocused slightly to 3.3 FWHM and 814 images of 20s exposure time were obtained with 5s dead time between each. Observations were obtained without a filter. The table presents data taken with the NITES telescope shown in Figure 1 of the publication. (1 data file).

  3. Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 104

    International Nuclear Information System (INIS)

    Ross, G.A.

    1998-01-01

    A sample of solids was obtained from tank 104 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprenel tubing (Phthalate free). The sample obtained in a glass jar with Teflon 2 lid, was analyzed for PCBs as Aroclor mixtures. A soxhlet extraction procedure was used to extract the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). The extraction method closely follows SW-846 method 3540C and the analysis follows SW-846 method

  4. Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 101

    International Nuclear Information System (INIS)

    Diaz, L.A.

    1998-01-01

    One waste sample that was obtained with solids from tank 101 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprene tubing (Phthalate free) was obtained in a glass jar with teflon lid was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Results are presented

  5. Synthesis, radiochemistry and biological evaluation of a new somatostatin analogue (SDZ 219-387) labelled with technetium-99m

    International Nuclear Information System (INIS)

    Maina, T.; Stolz, B.; Albert, R.; Bruns, C.; Koch, P.; Maecke, H.

    1994-01-01

    A new derivative of octreotide SDZ 219-387 [PnAO-(D)Phe 1 -octreotide] was synthesized, which binds specifically and with high affinity to somatostatin receptors in vitro (pK i =9.79±0.16). This new somatostatin analogue chelates technetium-99m under mild labelling conditions in good yields. The resulting [ 99m Tc]SDZ 219-387 was stable up to 6 h after labelling and could be isolated in a pure radiochemical and chemical form by high-perfomance liquid chromatographic purification. The intravenous administration of purified [ 99m Tc]SDZ 219-387 revealed that the radioligand was rapidly cleared from circulation, and tumour uptake of 0.38% ID/g was observed at 1.5 h post injection. [ 99m Tc]SDZ 219-387 specifically interacted with somatostatin binding sites on the tumour. However, the radioligand is highly lipophilic and excreted mainly through the hepatobiliary system. As a consequence, [ 99m Tc]SDZ 219-387 exhibits increased background activity and therefore is not appropriate for the in vivo visualization of somatostatin receptor-positive tumours and/or their metastases in the abdomen. (orig.)

  6. Hypothalamic miR-219 regulates individual metabolic differences in response to diet-induced weight cycling

    Directory of Open Access Journals (Sweden)

    Mariana Schroeder

    2018-03-01

    Full Text Available Consumption of a low calorie diet is the most common approach to lose weight. While generally effective at first, it is frequently followed by a relapse where the pre-diet weight is regained, and often exceeded. This pattern of repeated weight loss/regain is referred to as weight cycling and the resulting metabolic response varies greatly between individuals. Objective: We attempted to address the issue of individual differences in the response to weight cycling in male mice. Methods: We first exposed adult wild type mice to repeated cycles of high/low fat food. Next, using a lentiviral approach, we knocked-down or over-expressed miR-219 in the ventromedial hypothalamus (VMH of an additional mouse cohort and performed a full metabolic assessment. Results: Exposure of wild type males to weight cycling resulted in the division of the cohort into subsets of resistant versus metabolic-syndrome-prone (MS animals, which differed in their metabolic profile and hypothalamic miR-219 levels. Lentiviral knock-down of miR-219 in the VMH led to exacerbation of metabolic syndrome. In contrast, over-expression of miR-219 resulted in moderation of the metabolic syndrome phenotype. Conclusions: Our results suggest a role for miR-219 in the mediation of the metabolic phenotype resulting from repeated weight cycling. Keywords: Weight cycling, Metabolic syndrome, miRNAs, Ventromedial hypothalamus, High fat diet, Diabetes

  7. Marker-assisted introgression of broad-spectrum blast resistance genes into the cultivated MR219 rice variety.

    Science.gov (United States)

    Miah, Gous; Rafii, Mohd Y; Ismail, Mohd R; Puteh, Adam B; Rahim, Harun A; Latif, Mohammad A

    2017-07-01

    The rice cultivar MR219 is famous for its better yield and long and fine grain quality; however, it is susceptible to blast disease. The main objective of this study was to introgress blast resistance genes into MR219 through marker-assisted selection (MAS). The rice cultivar MR219 was used as the recurrent parent, and Pongsu Seribu 1 was used as the donor. Marker-assisted foreground selection was performed using RM6836 and RM8225 to identify plants possessing blast resistance genes. Seventy microsatellite markers were used to estimate recurrent parent genome (RPG) recovery. Our analysis led to the development of 13 improved blast resistant lines with Piz, Pi2 and Pi9 broad-spectrum blast resistance genes and an MR219 genetic background. The RPG recovery of the selected improved lines was up to 97.70% with an average value of 95.98%. Selected improved lines showed a resistance response against the most virulent blast pathogen pathotype, P7.2. The selected improved lines did not express any negative effect on agronomic traits in comparison with MR219. The research findings of this study will be a conducive approach for the application of different molecular techniques that may result in accelerating the development of new disease-resistant rice varieties, which in turn will match rising demand and food security worldwide. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  8. The corrosion Characteristics and Behaviors of the Ti-2.19Al-2.35Zr alloy

    International Nuclear Information System (INIS)

    Kim, Tae Hoon; Kang, Chang Sun; Baek, Jong Hyuk; Kim, Hyun Gil; Choi, Byoung Kwon; Jeong, Yong Hwan

    2007-01-01

    Ti-2.19Al-2.35Zr alloy is being considered as a steam generator tube material for the advanced pressurized water reactor (PWR) which is being developed by KAERI for the purpose of seawater desalination as well as a small scale electricity production. The main operational environment of SMART differs somewhat from that of a commercial PWR. That is, a heat-exchange tube is always exposed to a high temperature/pressure condition and an ammonia water chemistry is designed as a pH controlling agent without an addition of boric acid. The excellent mechanical and corrosion resistance properties are required for the steam generator tube material in SMART. Thus Ti-2.19Al-2.35Zr alloy was studied to investigate of the corrosion characteristics and behaviors of the Ti- 2.19Al-2.35Zr alloy in a simulated-SMART loop

  9. 222-S radioactive liquid waste line replacement and 219-S secondary containment upgrade, Hanford Site, Richland, Washington

    International Nuclear Information System (INIS)

    1995-01-01

    The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission

  10. Characterization Problem (Troubleshooting) for IR219 Irradiator, JS10000 in Mintec-SINAGAMA: The Partnership

    International Nuclear Information System (INIS)

    Shahidan Yob; Nor Ishadi Ismail; Kamarudin Buyong

    2015-01-01

    Control of the fuel-efficient plant operations are key to gamma irradiation service in MINTec-Sinagama. Without an efficient operation, irradiation services will be disrupted and lead to customer product failed to be completed in a set time. Additionally, downtime each time operation is also important to monitor to ensure that the fuel-efficient plant exceeded 85% in each month. In this paper MINTec plant operations data collection-Sinagama made during the year 2011-2015. Analysis carried out against downtime, the extent of damage and the action according to the classification of plant problems. This data collection is important for pattern characterization solution that can be made to the irradiator IR219, JS10000 in MINTec-Sinagama. (author)

  11. Project specific quality assurance plan for Project W-178, 219-S secondary containment

    International Nuclear Information System (INIS)

    Buckles, D.I.

    1994-01-01

    The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation

  12. Influence of APOE and RNF219 on Behavioral and Cognitive Features of Female Patients Affected by Mild Cognitive Impairment or Alzheimer’s Disease

    Directory of Open Access Journals (Sweden)

    Alessandra Mosca

    2018-04-01

    Full Text Available The risk for Alzheimer’s disease (AD is associated with the presence of the 4 allele of Apolipoprotein E (APOE gene and, recently, with a novel genetic variant of the RNF219 gene. This study aimed at evaluating interactions between APOE-4 and RNF219/G variants in the modulation of behavioral and cognitive features of two cohorts of patients suffering from mild cognitive impairment (MCI or AD. We enrolled a total of 173 female MCI or AD patients (83 MCI; 90 AD. Subjects were screened with a comprehensive set of neuropsychological evaluations and genotyped for the APOE and RNF219 polymorphic variants. Analysis of covariance was performed to assess the main and interaction effects of APOE and RNF219 genotypes on the cognitive and behavioral scores. The analysis revealed that the simultaneous presence of APOE-4 and RNF219/G variants results in significant effects on specific neuropsychiatric scores in MCI and AD patients. In MCI patients, RNF219 and APOE variants worked together to impact the levels of anxiety negatively. Similarly, in AD patients, the RNF219 variants were found to be associated with increased anxiety levels. Our data indicate a novel synergistic activity APOE and RNF219 in the modulation of behavioral traits of female MCI and AD patients.

  13. 48 CFR 3052.219-72 - Evaluation of prime contractor participation in the DHS mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... contractor participation in the DHS mentor-protégé program. 3052.219-72 Section 3052.219-72 Federal... Evaluation of prime contractor participation in the DHS mentor-protégé program. As prescribed in (HSAR) 48... the DHS Mentor-Protégé Program (JUN 2006) This solicitation contains a source selection factor or...

  14. The diagnosis and molecular analysis of a novel 21.9kb deletion (Qinzhou type deletion) causing α+ thalassemia.

    Science.gov (United States)

    Long, Ju; Yan, Shanhuo; Lao, Kegan; Pang, Wanrong; Ye, Xuehe; Sun, Lei

    2014-04-01

    α-Thalassemia is a common single-gene genetic disease that can cause Hb Bart's hydrops fetalis and Hb H disease in tropical and subtropical regions. When examining conventional thalassemia genes, an only detected --(SEA) genotype sample needs further analysis. In doing so, we found a novel 21.9kb deletion (Qinzhou type deletion). The deletion position of the novel 21.9kb deletion is from 14373bp to 36299bp of the α-globin gene cluster (NG_000006.1); thus, there exists a 21927bp sequence deletion, into which a 29bp sequence is added. After sequence analysis, a group of Gap-PCR primers were synthesized to diagnose this novel thalassemia genotype. Through pedigree analysis, we deduced that the propositus obtained the novel alleles from her mother. The genotype of this propositus is --(SEA)/-α(21.9) and its phenotype conforms to the characteristics of Hb H disease, establishing that the combination between -α(21.9) genotype and α(0) genotype can lead to Hb H disease. By molecular analysis, we established that this case fits the characteristic of an α(+) thalassemia genotype. © 2013.

  15. 75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside

    Science.gov (United States)

    2010-05-10

    ... Small Business Set-Aside AGENCY: Defense Logistics Agency, DoD. ACTION: Notice. SUMMARY: This is to...) regarding partial small business set-asides for Defense Logistics Agency (DLA), Defense Energy Support..., DESC is requesting a class deviation from FAR Clause 52.219-7, Notice of Partial Small Business Set...

  16. MicroRNA-219-2-3p functions as a tumor suppressor in gastric cancer and is regulated by DNA methylation.

    Directory of Open Access Journals (Sweden)

    Huizi Lei

    Full Text Available BACKGROUND AIMS: Gastric cancer is the most frequent gastrointestinal tumor in adults and is the most lethal form of human cancer. Despite of the improvements in treatments, the underlying mechanism of gastric carcinogenesis is not well known. To define novel modulators that regulate susceptibility to tumorgenesis, we focused on miR-219-2-3p. METHODS: Quantitative RT-PCR was employed to investigate the level of miR-219-2-3p in gastric cancer (GC tissues (n = 113 and their matched adjacent normal tissues (n = 113. In vitro cell proliferation, apoptosis assays, cell migration, and invasion assays were performed to elucidate biological effects of miR-219-2-3p. Since silencing of miRNA by promoter CpG island methylation may be an important mechanism in tumorgenesis, GC cells were treated with 5-aza-2'-deoxycytidine and trichostatin A, and expression changes of miR-219-2-3p were subsequently examined by quantitative RT-PCR. Finally, the methylation status of CpG island upstream of miR-219-2-3p was analyzed by methylation-specific PCR in GC tissues (n = 22. RESULTS: miR-219-2-3p was down-regulated in GC and cell lines. In addition, the experiments documented the lower expression of miR-219-2-3p in GC specimens with higher grade and later stage tumors. Meanwhile, miR-219-2-3p exerted antiproliferative, proapoptotic, and antimetastatic roles and reduced levels of p-ERK1/2 in GC cells. Furthermore, 5-aza-2'-deoxycytidine and trichostatin A increased the expression (~2 fold of miR-219-2-3p in GC cells. By methylation-specific PCR, DNA methylation in the upstream region of miR-219-2-3p was detected in both adjacent normal tissues and cancer tissues. As expected, the methylation level was considerably higher in the miR-219-2-3p down-regulated group than up-regulated group. CONCLUSIONS: miR-219-2-3p is potentially involved in gastric cancer progression and metastasis by regulating ERK1/2-related signal pathways, which may provide a novel therapeutic strategy

  17. Incidence and predictors of difficult laryngoscopy in 11,219 pediatric anesthesia procedures.

    Science.gov (United States)

    Heinrich, Sebastian; Birkholz, Torsten; Ihmsen, Harald; Irouschek, Andrea; Ackermann, Andreas; Schmidt, Joachim

    2012-08-01

    Difficult laryngoscopy in pediatric patients undergoing anesthesia. This retrospective analysis was conducted to investigate incidence and predictors of difficult laryngoscopy in a large cohort of pediatric patients receiving general anesthesia with endotracheal intubation. Young age and craniofacial dysmorphy are predictors for the difficult pediatric airway and difficult laryngoscopy. For difficult laryngoscopy, other general predictors are not yet described. Retrospectively, from a 5-year period, data from 11.219 general anesthesia procedures in pediatric patients with endotracheal intubation using age-adapted Macintosh blades in a single center (university hospital) were analyzed statistically. The overall incidence of difficult laryngoscopy [Cormack and Lehane (CML) grade III and IV] was 1.35%. In patients younger than 1 year, the incidence of CML III or IV was significantly higher than in the older patients (4.7% vs 0.7%). ASA Physical Status III and IV, a higher Mallampati Score (III and IV) and a low BMI were all associated (P pediatric anesthesia is lower than in adults. Our results show that the risk of difficult laryngoscopy is much higher in patients below 1 year of age, in underweight patients and in ASA III and IV patients. The underlying disease might also contribute to the risk. If the Mallampati score could be obtained, prediction of difficult laryngoscopy seems to be reliable. Our data support the existing recommendations for a specialized anesthesiological team to provide safe anesthesia for infants and neonates. © 2012 Blackwell Publishing Ltd.

  18. Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

    International Nuclear Information System (INIS)

    Khazrouni, S.

    1985-06-01

    Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr

  19. Tank 103, 219-S Facility at 222-S Laboratory, analytical results for the final report

    International Nuclear Information System (INIS)

    Fuller, R.K.

    1998-01-01

    This is the final report for the polychlorinated biphenyls analysis of Tank-103 (TK-103) in the 219-S Facility at 222-S Laboratory. Twenty 1-liter bottles (Sample numbers S98SO00074 through S98SO00093) were received from TK-103 during two sampling events, on May 5 and May 7, 1998. The samples were centrifuged to separate the solids and liquids. The centrifuged sludge was analyzed for PCBs as Aroclor mixtures. The results are discussed on page 6. The sample breakdown diagram (Page 114) provides a cross-reference of sample identification of the bulk samples to the laboratory identification number for the solids. The request for sample analysis (RSA) form is provided as Page 117. The raw data is presented on Page 43. Sample Description, Handling, and Preparation Twenty samples were received in the laboratory in 1-Liter bottles. The first 8 samples were received on May 5, 1998. There were insufficient solids to perform the requested PCB analysis and 12 additional samples were collected and received on May 7, 1998. Breakdown and sub sampling was performed on May 8, 1998. Sample number S98SO00084 was lost due to a broken bottle. Nineteen samples were centrifuged and the solids were collected in 8 centrifuge cones. After the last sample was processed, the solids were consolidated into 2 centrifuge cones. The first cone contained 9.7 grams of solid and 13.0 grams was collected in the second cone. The wet sludge from the first centrifuge cone was submitted to the laboratory for PCB analysis (sample number S98SO00102). The other sample portion (S98SO00103) was retained for possible additional analyses

  20. 48 CFR 653.219-71 - DOS form DS-4053, Department of State Mentor-Protégé Program Application.

    Science.gov (United States)

    2010-10-01

    ..., Department of State Mentor-Protégé Program Application. 653.219-71 Section 653.219-71 Federal Acquisition...-4053, Department of State Mentor-Protégé Program Application. As prescribed in 619.102-70(i), DS-4053 is prescribed for use in applying for an agreement under the Department of State Mentor-Protégé...

  1. Long non-coding RNA TUG1 promotes progression of oral squamous cell carcinoma through upregulating FMNL2 by sponging miR-219.

    Science.gov (United States)

    Yan, Guangqi; Wang, Xue; Yang, Mingliang; Lu, Li; Zhou, Qing

    2017-01-01

    Oral squamous cell carcinoma (OSCC) is a prevalent oral disease with a high morbidity and mortality rate. Several long non-coding RNAs (lncRNAs) were identified as important regulators of carcinogenesis. However, the pathogenic implications of TUG1 in OSCC are still unclear. In the present study, the expression of TUG1 was increased in OSCC cells. Knockdown of TUG1 inhibited cell proliferation, migration, and invasion, and induced cell cycle arrest at G0/G1 phase, whereas overexpression of TUG1 exerted the opposite effect on OSCC cells. A reciprocal repressive interaction between TUG1 and miR-219 was found, and miR-219 inhibition abolished the tumor-suppressive effect of TUG1 knockdown on cell growth and motility. Furthermore, bioinformatics analysis and luciferase reporter assay showed that FMNL2 was a direct target of miR-219. Restoration of FMNL2 abrogated the miR-219-induced inhibition of cell proliferation, cell cycle progression, migration, and invasion. Besides, overexpression of TUG1 promoted tumor growth and metastasis in vivo . Clinically, the expression of TUG1 and FMNL2 were increased, but miR-219 was decreased in primary tumors compared to non-tumor tissues. Both the upregulated TUG1, and FMNL2 and the downregulated miR-219 was associated with advanced stage of OSCC and poor overall survival. Notably, multivariate analyses confirmed that FMNL2 was an independent risk factor for OSCC. In conclusion, our data revealed that TUG1 confers oncogenic function in OSCC and TUG1/miR-219/FMNL2 axis may be a novel therapeutic strategy in this disease.

  2. Introgression of Blast Resistance Genes (Putative Pi-b and Pi-kh) into Elite Rice Cultivar MR219 through Marker-Assisted Selection

    Science.gov (United States)

    Tanweer, Fatah A.; Rafii, Mohd Y.; Sijam, Kamaruzaman; Rahim, Harun A.; Ahmed, Fahim; Ashkani, Sadegh; Latif, Mohammad A.

    2015-01-01

    Blast is the most common biotic stress leading to the reduction of rice yield in many rice-growing areas of the world, including Malaysia. Improvement of blast resistance of rice varieties cultivated in blast endemic areas is one of the most important objectives of rice breeding programs. In this study, the marker-assisted backcrossing strategy was applied to improve the blast resistance of the most popular Malaysian rice variety MR219 by introgressing blast resistance genes from the Pongsu Seribu 2 variety. Two blast resistance genes, Pi-b and Pi-kh, were pyramided into MR219. Foreground selection coupled with stringent phenotypic selection identified 15 plants homozygous for the Pi-b and Pi-kh genes, and background selection revealed more than 95% genome recovery of MR219 in advanced blast resistant lines. Phenotypic screening against blast disease indicated that advanced homozygous blast resistant lines were strongly resistant against pathotype P7.2 in the blast disease endemic areas. The morphological, yield, grain quality, and yield-contributing characteristics were significantly similar to those of MR219. The newly developed blast resistant improved lines will retain the high adoptability of MR219 by farmers. The present results will also play an important role in sustaining the rice production of Malaysia. PMID:26734013

  3. The generation, validation and testing of a coupled 219-group neutron 36-group gamma ray AMPX-II library

    International Nuclear Information System (INIS)

    Panini, G.C.; Siciliano, F.; Lioi, A.

    1987-01-01

    The main characteristics of a P 3 coupled 219-group neutron 36-group gamma-ray library in the AMPX-II Master Interface Format obtained processing ENDF/B-IV data by means of various AMPX-II System modules are presented in this note both for the more reprocessing aspects and features of the generated component files-neutrons, photon and secondary gamma-ray production cross sections. As far as the neutron data are concerned there is the avaibility of 186 data sets regarding most significant fission products. Results of the additional validation of the neutron data pertaining to eighteen benchmark experiments are also given. Some calculational tests on both neutron and coupled data emphasize the important role of the secondary gamma-ray data in nuclear criticality safety calculations

  4. Comparative in vitro activities of trovafloxacin (CP-99,219) against 445 gram-positive isolates from patients with endocarditis and those with other bloodstream infections

    NARCIS (Netherlands)

    H.P. Endtz (Hubert); J.W. Mouton (Johan); J.G. den Hollander (Jan); N.P.W.C.J. van den Braak (Nicole); H.A. Verbrugh (Henri)

    1997-01-01

    textabstractThe in vitro activity of trovafloxacin (CP-99,219), a new fluoroquinolone, was compared with the in vitro activities of other commonly used quinolones and other antimicrobial agents against 445 gram-positive microorganisms isolated between 1986 and 1995 from

  5. Morphology and magnetism of Fe monolayers and small Fen clusters (n 2-19) supported on the Ni(111) surface

    International Nuclear Information System (INIS)

    Longo, R C; MartInez, E; Dieguez, O; Vega, A; Gallego, L J

    2007-01-01

    Using the modified embedded atom model in conjunction with a self-consistent tight-binding method, we investigated the lowest-energy structures of Fe monolayers and isolated Fe n clusters (n = 2-19) supported on the Ni(111) surface. In keeping with experimental findings, our calculations predict that the atoms of the monolayer occupy face-centred cubic (fcc) rather than hexagonal close-packed (hcp) sites. Likewise in agreement with experiment we found that Fe layers stack with a pseudomorphic fcc structure up to two monolayers, beyond which they stack as bcc(110). The structures of supported Fe clusters are predicted to be two-dimensional islands maximizing the number of nearest-neighbour bonds among the adsorbed Fe atoms, and their average magnetic moments per atom decrease towards that of the supported Fe monolayer almost monotonically as n increases. Finally, a pair of Fe 3 clusters on Ni(111) were found to exhibit virtually no interaction with each other even when separated by only one atomic row, i.e. so long as they do not coalesce they retain their individual magnetic properties

  6. Contribution of weight status to asthma prevalence racial disparities, 2-19 year olds, 1988-2014.

    Science.gov (United States)

    Akinbami, Lara J; Rossen, Lauren M; Fakhouri, Tala H I; Simon, Alan E; Kit, Brian K

    2017-08-01

    Racial disparities in childhood asthma prevalence increased after the 1990s. Obesity, which also varies by race/ethnicity, is an asthma risk factor but its contribution to asthma prevalence disparities is unknown. We analyzed nationally representative National Health Examination and Nutrition Survey data for 2-19 year olds with logistic regression and decomposition analyses to assess the contributions of weight status to racial disparities in asthma prevalence, controlling for sex, age, and income status. From 1988-1994 to 2011-2014, asthma prevalence increased more among non-Hispanic black (NHB) (8.4% to 18.0%) than non-Hispanic white (NHW) youth (7.2% to 10.3%). Logistic regression showed that obesity was an asthma risk factor for all groups but that a three-way "weight status-race/ethnicity-time" interaction was not significant. That is, weight status did not modify the race/ethnicity association with asthma over time. In decomposition analyses, weight status had a small contribution to NHB/NHW asthma prevalence disparities but most of the disparity remained unexplained by weight status or other asthma risk factors (sex, age and income status). NHB youth had a greater asthma prevalence increase from 1988-1994 to 2011-2014 than NHW youth. Most of the racial disparity in asthma prevalence remained unexplained after considering weight status and other characteristics. Published by Elsevier Inc.

  7. Germination Response of MR 219 Rice Variety to Different Exposure Times and Periods of 2450 MHz Microwave Frequency

    Directory of Open Access Journals (Sweden)

    Daryush Talei

    2013-01-01

    Full Text Available Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR, germination percentage (GP, and mean germination time (MGT were analyzed by exposing its seeds to 2450 MHz of microwave frequency for one, four, seven, and ten hours. It was revealed that exposing the seeds to the microwave frequency for 10 hours resulted in the highest GP. This treatment led to 100% of germination after three days with a mean germination time of 2.1 days. Although the other exposure times of microwave frequency caused the moderate effects on germination with a GPa3 ranged from 93% to 98%, they failed to reduce the MGTa3. The results showed that ten-hour exposure times of microwave frequency for six days significantly facilitated and improved the germination indices (primary shoot and root length. Therefore, the technique is expected to benefit the improvement of rice seed germination considering its simplicity and efficacy in increasing the germination percentage and rate as well as the primary shoot and root length without causing any environmental toxicity.

  8. Identification of Three Types of α-Thalassemia Deletion, -α21.9, -α2.4, and - -THAI, and Their Frequencies, in One Family in the Population of Southern Guangxi Zhuang Autonomous Region, People's Republic of China.

    Science.gov (United States)

    Pang, Wanrong; Long, Ju; Weng, Xunjin; Fan, Qiongying; Sun, Lei; Pan, Zhijian; Fan, Zuqian

    2018-01-01

    Different types of deletional α-thalassemia (α-thal) have been reported by researchers in China. This study describes one family carrying -α 21.9 (NG_000006.1: g.14373_36299delinsGGGAAGGGTGGGTGGGAATAACAGCTTTT), -α 2.4 (NG_000006.1: g.36860_39251del) and - - THAI (Thailand) (NG_000006.1: g.10664_44164del) alleles in Guangxi Zhuang Autonomous Region, People's Republic of China (PRC), and reports the frequencies of these types in the population of this region. The proband was a 4-year-old girl, who screened positive for thalassemia, although the thalassemia genotype results were normal when screened using the routine kits. Samples of the proband's parents were also collected to perform further analyses. Two real-time gap-polymerase chain reaction (gap-PCR) systems were designed for separate detection of - - THAI and screening for -α 21.9 and -α 2.4 . The genotype of the proband was -α 21.9 /-α 2.4 , and the two variants were inherited from her parents. In the frequency study, five - - THAI , four -α 21.9 and 11 -α 2.4 positive individuals were detected in the 3410 random samples. Thus, allele frequencies of -α 21.9 , - - THAI and -α 2.4 in the population of southern Guangxi were determined as 0.059, 0.073 and 0.161%, respectively. This is the first report of an individual carrying the -α 21.9 /-α 2.4 genotype, and the first report of the detection of -α 21.9 , -α 2.4 and - - THAI in a single family. The total frequency for these alleles was 0.293% in southern Guangxi, suggesting that the thalassemia clinical center in this region should utilize a screening kit that allows detection of these types of deletions for a more comprehensive evaluation of thalassemia risk.

  9. Yield Traits, Physico-chemical Characteristics and Nutritional Composition of MR219 M3 Generation and its Effect on Glycemic Index and Responses in Animal Model

    International Nuclear Information System (INIS)

    Asma Ilyani Kadar; Sobri Hussein; Abdul Rahim Harun; Fazliana Mohd Saaya

    2014-01-01

    Mutation technique is a conventional breeding technique and it is very effective in improving of main crop characteristics such as yield traits, resistance to diseases and pests and nutritional qualities. In this study, MR219 seeds were treated with Carbon ion radiation (60 Gy) by AVF-Cyclotron at the Japan Atomic Energy Research Institute (JAERI), Takasaki, Japan and were planted at the Malaysian Nuclear Agency up to third mutant generation (M3). Thirty one M3 mutant lines (ML1 to ML31) were evaluated on morphological, yield and yield components, and were compared to the parental variety, MR219. Analysis of variance revealed that there was a significant difference among mutant lines in culm height, days to flowering, number of tillers, number of panicles, 1000 grain weight, total grain weight, total of dry matter, alkaline spreading value, gel consistency, amylose content, ash, crude protein, fat, dietary fibre, carbohydrate and energy. Mutant line ML21 had the best performance in majority of yield components and vegetative traits as compared to others mutant lines and parental variety. For nutritional composition, mutant lines namely ML31, ML21, ML10, ML19 were improved in crude protein content, dietary fibre and carbohydrate content. The estimation of glycemic index revealed that two mutant lines namely ML3 and ML30 can be consumed by diabetics. (author)

  10. Folding model analysis of 58Ni + 64Ni elastic and inelastic scattering at Elab=203.8 and 219.2 MeV

    International Nuclear Information System (INIS)

    Ruiz, J.A.; Ferrero, J.L.; Bilwes, B.; Bilwes, R.

    1992-01-01

    Angular distributions of elastic scattering of 58 Ni by 64 Ni and inelastic scattering leading to the first 2 + state in 58 Ni or in 64 Ni were measured at E lab =203.8 and 219.2 MeV. The data were analyzed in the frame of the folding model. A renormalization N of the folding potential consistently lower than unity (N∼0.65) is needed to reproduce the elastic scattering data. Coupled-channel calculations including the main inelastic channels explain partly this discrepancy. They reproduce the elastic and inelastic scattering data with a renormalization of N∼0.8 at both energies. Interference between Coulomb and nuclear excitation is shown to play an important role in the repulsive character of the polarization potential. (author) 38 refs.; 6 figs.; 1 tab

  11. Primary and secondary cutaneous CD30(+) lymphoproliferative disorders : a report from the Dutch Cutaneous Lymphoma Group on the long-term follow-up data of 219 patients and guidelines for diagnosis and treatment

    NARCIS (Netherlands)

    Bekkenk, MW; Geelen, FAMJ; Vader, PCV; Heule, F; Geerts, ML; van Vloten, WA; Meijer, CJLM; Willemze, R

    2000-01-01

    To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lympho proliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with

  12. Primary and secondary cutaneous CD30(+) lymphoproliferative disorders: a report from the Dutch Cutaneous Lymphoma Group on the long-term follow-up data of 219 patients and guidelines for diagnosis and treatment

    NARCIS (Netherlands)

    Bekkenk, M. W.; Geelen, F. A.; van Voorst Vader, P. C.; Heule, F.; Geerts, M. L.; van Vloten, W. A.; Meijer, C. J.; Willemze, R.

    2000-01-01

    To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lymphoproliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with

  13. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  14. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    International Nuclear Information System (INIS)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

    2017-01-01

    The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  16. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  17. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  19. CHARACTERIZATION OF THE K2-19 MULTIPLE-TRANSITING PLANETARY SYSTEM VIA HIGH-DISPERSION SPECTROSCOPY, AO IMAGING, AND TRANSIT TIMING VARIATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Narita, Norio; Hori, Yasunori; Kusakabe, Nobuhiko; Takeda, Yoichi; Tamura, Motohide [Astrobiology Center, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Hirano, Teruyuki [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan); Fukui, Akihiko; Yanagisawa, Kenshi [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, Asakuchi, Okayama 719-0232 (Japan); Sanchis-Ojeda, Roberto [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); Winn, Joshua N. [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Ryu, Tsuguru; Onitsuka, Masahiro [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Kudo, Tomoyuki [Subaru Telescope, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Delrez, Laetitia; Gillon, Michael; Jehin, Emmanuel [Institut d’Astrophysique et de Géophysique, Université de Liège, Allée du 6 Août 17, Bat. B5C, B-4000 Liège (Belgium); McCormac, James [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom); Holman, Matthew [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Izumiura, Hideyuki, E-mail: norio.narita@nao.ac.jp [SOKENDAI (The Graduate University for Advanced Studies), 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan)

    2015-12-10

    K2-19 (EPIC201505350) is an interesting planetary system in which two transiting planets with radii ∼7 R{sub ⊕} (inner planet b) and ∼4 R{sub ⊕} (outer planet c) have orbits that are nearly in a 3:2 mean-motion resonance. Here, we present results of ground-based follow-up observations for the K2-19 planetary system. We have performed high-dispersion spectroscopy and high-contrast adaptive-optics imaging of the host star with the HDS and HiCIAO on the Subaru 8.2 m telescope. We find that the host star is a relatively old (≥8 Gyr) late G-type star (T{sub eff} ∼ 5350 K, M{sub s} ∼ 0.9 M{sub ⊙}, and R{sub s} ∼ 0.9 R{sub ⊙}). We do not find any contaminating faint objects near the host star that could be responsible for (or dilute) the transit signals. We have also conducted transit follow-up photometry for the inner planet with KeplerCam on the FLWO 1.2 m telescope, TRAPPISTCAM on the TRAPPIST 0.6 m telescope, and MuSCAT on the OAO 1.88 m telescope. We confirm the presence of transit timing variations (TTVs), as previously reported by Armstrong and coworkers. We model the observed TTVs of the inner planet using the synodic chopping formulae given by Deck and Agol. We find two statistically indistinguishable solutions for which the period ratios (P{sub c}/P{sub b}) are located slightly above and below the exact 3:2 commensurability. Despite the degeneracy, we derive the orbital period of the inner planet P{sub b} ∼ 7.921 days and the mass of the outer planet M{sub c} ∼ 20 M{sub ⊕}. Additional transit photometry (especially for the outer planet) as well as precise radial-velocity measurements would be helpful to break the degeneracy and to determine the mass of the inner planet.

  20. In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

    Directory of Open Access Journals (Sweden)

    D. A. Fink

    2015-02-01

    Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

  1. Clinical Management and Follow-up of Hypercholesterolemia Among Perinatally HIV-Infected Children Enrolled in the PACTG 219C Study

    Science.gov (United States)

    Jacobson, Denise L.; Williams, Paige; Tassiopoulos, Katherine; Melvin, Ann; Hazra, Rohan; Farley, John

    2011-01-01

    Background Hypercholesterolemia is common in perinatally HIV-infected (HIV+) children, but little is known about the clinical course and management in this population. Methods We studied HIV+ children in a multisite prospective cohort study (PACTG 219C) and considered follow-up for two years after development of hypercholesterolemia. We estimated the time to and factors associated with resolution of hypercholesterolemia and described changes in ARV regimen and use of lipid-lowering medications. We defined incident hypercholesterolemia as entry total cholesterol (cholesterol) hypercholesterolemia as two consecutive cholesterol hypercholesterolemia. Results Among 240 incident hypercholesterolemia cases, 81 (34%) had resolution to normal cholesterol within two years of follow-up (median follow-up = 1.9 years). The median age of cases was 10.3 years with 54% Non-Hispanic black and 53% male. Resolution to normal cholesterol was more likely in children who changed ARV regimen (adjusted Hazard Ratio (aHR) = 2.37, 95%CI 1.45, 3.88) and who were ≥ 13 years old (aHR=2.39, 95%CI 1.33, 4.27). Types of regimen changes varied greatly and 15 children began statins. Conclusions The majority of children who develop hypercholesterolemia maintain elevated levels over time, potentially placing them at risk for premature cardiovascular morbidity. PMID:21602698

  2. Association between in-hospital mortality and renal dysfunction in 186,219 patients hospitalized for acute stroke in the Emilia-Romagna region of Italy.

    Science.gov (United States)

    Fabbian, Fabio; Gallerani, Massimo; Pala, Marco; De Giorgi, Alfredo; Salmi, Raffaella; Dentali, Francesco; Ageno, Walter; Manfredini, Roberto

    2014-11-01

    Using a regional Italian database, we evaluated the relationship between renal dysfunction and in-hospital mortality (IHM) in patients with acute stroke (ischemic/hemorrhagic). Patients were classified on the basis of renal damage: without renal dysfunction, with chronic kidney disease (CKD), and with end-stage renal disease (ESRD). Of a total of 186,219 patients with a first episode of stroke, 1626 (0.9%) had CKD and 819 (0.4%) had ESRD. Stroke-related IHM (total cases) was independently associated with CKD, ESRD, atrial fibrillation (AF), age, and Charlson comorbidity index (CCI). In patients with ischemic stroke (n=154,026), IHM remained independently associated with CKD, ESRD, AF, and CCI. In patients with hemorrhagic stroke (n=32,189), variables that were independently associated with IHM were CKD, ESRD, and AF. Renal dysfunction is associated with IHM related to stroke, both ischemic and hemorrhagic, with even higher odds ratios than those of other established risk factors, such as age, comorbidities, and AF. © The Author(s) 2013.

  3. Flexible synthetic routes to poison-frog alkaloids of the 5,8-disubstituted indolizidine-class I: synthesis of common lactam chiral building blocks and application to the synthesis of (--203A, (--205A, and (--219F

    Directory of Open Access Journals (Sweden)

    Spande Thomas F

    2007-09-01

    Full Text Available Abstract Background The 5,8-disubstituted indolizidines are the largest class of poison-frog alkaloids found in anuran skin, and are of considerable interest because of their inhibitory effects on the neuronal nicotinic acetylcholine receptors. Many synthetic strategies for the construction of this nucleus have been reported: however, a flexible route has not been reported to date. Results Synthesis of lactam chiral building blocks for the flexible synthesis of the title alkaloids has been achieved using a Michael-type conjugate addition reaction to a chiral cyclic enamine ester as the key step in constructing the trisubstituted piperidine ring system. To demonstrate the usefulness of these chiral building blocks, syntheses of (--203A, (--205A from 1, and (--219F from 2 have been achieved. Conclusion The total synthesis of (--203A, (--205A, and (--219F was achieved, and the absolute stereochemistry of natural 203A was determined to be 5S, 8R, 9S. In addition, the relative stereochemistry of natural 219F was determined.

  4. Value of neutrophil-to-lymphocyte ratio for predicting lung cancer prognosis: A meta-analysis of 7,219 patients.

    Science.gov (United States)

    Yu, Yu; Qian, Lei; Cui, Jiuwei

    2017-09-01

    Current evidence suggests that the neutrophil-to-lymphocyte ratio (NLR) may be a biomarker for poor prognosis in lung cancer, although this association remains controversial. Therefore, a meta-analysis was performed to evaluate the association between NLR and lung cancer outcome. A systematic literature search was performed through the PubMed, Embase and Cochrane Library databases (until July 30, 2016), to identify studies evaluating the association between NLR and overall survival (OS) and/or progression-free survival (PFS) among patients with lung cancer. Based on the results of this search, data from 18 studies involving 7,219 patients with lung cancer were evaluated. The pooled hazard ratio (HR) suggested that elevated pretreatment NLR predicted poor OS [HR=1.46, 95% confidence interval (CI): 1.30-1.64] and poor PFS (HR=1.42, 95% CI: 1.15-1.75) among patients with lung cancer. Subgroup analysis revealed that the prognostic value of NLR for predicting poor OS increased among patients who underwent surgery (HR=1.50, 95% CI: 1.21-1.84) or patients with early-stage disease (HR=1.64, 95% CI: 1.37-1.97). An NLR cut-off value of ≥4 significantly predicted poor OS (HR=1.56, 95% CI: 1.31-1.85) and PFS (HR=1.54, 95% CI: 1.13-1.82), particularly in the cases of small-cell lung cancer. Thus, the results of the present meta-analysis suggested that an elevated pretreatment NLR (e.g., ≥4) may be considered as a biomarker for poor prognosis in patients with lung cancer.

  5. Effect of the male factor on the clinical outcome of intracytoplasmic sperm injection combined with preimplantation aneuploidy testing: observational longitudinal cohort study of 1,219 consecutive cycles.

    Science.gov (United States)

    Mazzilli, Rossella; Cimadomo, Danilo; Vaiarelli, Alberto; Capalbo, Antonio; Dovere, Lisa; Alviggi, Erminia; Dusi, Ludovica; Foresta, Carlo; Lombardo, Francesco; Lenzi, Andrea; Tournaye, Herman; Alviggi, Carlo; Rienzi, Laura; Ubaldi, Filippo Maria

    2017-12-01

    To evaluate the impact of the male factor on the outcomes of intracytoplasmic sperm injection (ICSI) cycles combined with preimplantation genetic testing for aneuploidies (PGT-A). Observational longitudinal cohort study. Private in vitro fertilization (IVF) center. A total of 1,219 oocyte retrievals divided into five study groups according to sperm parameters: normozoospermia (N), moderate male factor (MMF), severe oligoasthenoteratozoospermia (OAT-S), obstructive azoospermia (OA), and nonobstructive azoospermia (NOA). ICSI with ejaculated/surgically retrieved sperm, blastocyst culture, trophectoderm-based quantitative polymerase chain reaction PGT-A, and frozen-warmed euploid embryo transfer (ET). The primary outcome measures were fertilization, blastocyst development, and euploidy rates; the secondary outcome measures were live birth and miscarriage rates. Perinatal and obstetrical outcomes were monitored as well. A total of 9,042 metaphase II oocytes were inseminated. The fertilization rate was significantly reduced in MMF, OAT-S, OA, and NOA compared with N (74.8%, 68.7%, 67.3%, and 53.1% vs. 77.2%). The blastocyst rate per fertilized oocyte was significantly reduced in MMF and NOA compared with N (48.6% and 40.6% vs. 49.3%). The timing of blastocyst development also was affected in OA and NOA. Logistic regression analysis adjusted for confounders highlighted NOA as a negative predictor of obtaining an euploid blastocyst per OPU (odds ratio 0.5). When the analysis was performed per obtained blastocyst, however, no correlation between male factor and euploidy rate was observed. Embryo transfers also resulted in similar live birth and miscarriage rates. No impact of sperm factor on obstetrical/perinatal outcomes was observed. Severe male factor impairs early embryonic competence in terms of fertilization rate and developmental potential. However, the euploidy rate and implantation potential of the obtained blastocysts are independent from sperm quality

  6. Probabilistic risk assessment: Number 219

    International Nuclear Information System (INIS)

    Bari, R.A.

    1985-01-01

    This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)

  7. The unusually strong hydrogen bond between the carbonyl of Q(A) and His M219 in the Rhodobacter sphaeroides reaction center is not essential for efficient electron transfer from Q(A)(-) to Q(B).

    Science.gov (United States)

    Breton, Jacques; Lavergne, Jérôme; Wakeham, Marion C; Nabedryk, Eliane; Jones, Michael R

    2007-06-05

    In native reaction centers (RCs) from photosynthetic purple bacteria the primary quinone (QA) and the secondary quinone (QB) are interconnected via a specific His-Fe-His bridge. In Rhodobacter sphaeroides RCs the C4=O carbonyl of QA forms a very strong hydrogen bond with the protonated Npi of His M219, and the Ntau of this residue is in turn coordinated to the non-heme iron atom. The second carbonyl of QA is engaged in a much weaker hydrogen bond with the backbone N-H of Ala M260. In previous work, a Trp side chain was introduced by site-directed mutagenesis at the M260 position in the RC of Rb. sphaeroides, resulting in a complex that is completely devoid of QA and therefore nonfunctional. A photochemically competent derivative of the AM260W mutant was isolated that contains a Cys side chain at the M260 position (denoted AM260(W-->C)). In the present work, the interactions between the carbonyl groups of QA and the protein in the AM260(W-->C) suppressor mutant have been characterized by light-induced FTIR difference spectroscopy of the photoreduction of QA. The QA-/QA difference spectrum demonstrates that the strong interaction between the C4=O carbonyl of QA and His M219 is lost in the mutant, and the coupled CO and CC modes of the QA- semiquinone are also strongly perturbed. In parallel, a band assigned to the perturbation of the C5-Ntau mode of His M219 upon QA- formation in the native RC is lacking in the spectrum of the mutant. Furthermore, a positive band between 2900 and 2400 cm-1 that is related to protons fluctuating within a network of highly polarizable hydrogen bonds in the native RC is reduced in amplitude in the mutant. On the other hand, the QB-/QB FTIR difference spectrum is essentially the same as for the native RC. The kinetics of electron transfer from QA- to QB were measured by the flash-induced absorption changes at 780 nm. Compared to native RCs the absorption transients are slowed by a factor of about 2 for both the slow phase (in the

  8. Formation and evolution of ultrafine particles produced by radiolysis and photolysis

    International Nuclear Information System (INIS)

    Madelaine, G.J.; Perrin, M.L.; Renoux, A.

    1980-01-01

    Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation

  9. Assessment of soil contamination by potentially toxic trace elements (PTSD) (As, Cd, Cu, Hg, Pb, Zn) in a lower plain of the Hron River according to Law no. 219/2008 Coll., by geo-accumulation index, anthropogenic factor and Tomlinson index; Zhodnotenie kontaminacie pod potencialne toxickymi stopovymi prvkami (PTSP) (As, Cd, Cu, Hg, Pb, Zn) v dolnej casti nivy Hrona podla zakona c. 219/2008 Z.z., indexu geoakumulacie, antropogenneho faktora a Tomlinsonovho indexu

    Energy Technology Data Exchange (ETDEWEB)

    Hlodak, M [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Ustav laboratorneho vyskumu geomaterialov, 84215 Bratislava (Slovakia)

    2012-04-25

    Soil contamination by different PTSD may have different geogenic and anthropogenic origin and occurs in all countries of the world. The aim of this paper is to evaluate the soils contamination of a lower plain of the Hron River. This paper used the results of the thesis Soil contamination of the Hron River floodplain by trace elements (As, Cd, Cu, Hg, Pb, Zn) [1]. Soil contamination was evaluated by: Act. 219/2008 Coll. on the protection and use of agricultural land, by anthropogenic factor (AF), geo-accumulation index (IgeoE) and Tomlinson index - the index of the pollution load (PLI). (author)

  10. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  11. FERREIRA, Maria Alice Araújo; SOUZA, Germana Henriques Pereira de; GOROVITZ, Sabine (Org. Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. (Org.. Brasília: Editora da UnB, 2014. 219 p.

    Directory of Open Access Journals (Sweden)

    Marie Hélène C. Torres

    2014-12-01

    Full Text Available Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.

  12. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  13. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    Marx, Sebastian Markus

    2014-01-01

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  14. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  15. Phosphorylations of Serines 21/9 in Glycogen Synthase Kinase 3α/β Are Not Required for Cell Lineage Commitment or WNT Signaling in the Normal Mouse Intestine.

    Directory of Open Access Journals (Sweden)

    Fiona Hey

    Full Text Available The WNT signalling pathway controls many developmental processes and plays a key role in maintenance of intestine renewal and homeostasis. Glycogen Synthase Kinase 3 (GSK3 is an important component of the WNT pathway and is involved in regulating β-catenin stability and expression of WNT target genes. The mechanisms underpinning GSK3 regulation in this context are not completely understood, with some evidence suggesting this occurs through inhibitory N-terminal serine phosphorylation in a similar way to GSK3 inactivation in insulin signaling. To investigate this in a physiologically relevant context, we have analysed the intestinal phenotype of GSK3 knockin mice in which N-terminal serines 21/9 of GSK3α/β have been mutated to non-phosphorylatable alanine residues. We show that these knockin mutations have very little effect on overall intestinal integrity, cell lineage commitment, β-catenin localization or WNT target gene expression although a small increase in apoptosis at villi tips is observed. Our results provide in vivo evidence that GSK3 is regulated through mechanisms independent of N-terminal serine phosphorylation in order for β-catenin to be stabilised.

  16. FERREIRA, Maria Alice Araújo; SOUZA, Germana Henriques Pereira de; GOROVITZ, Sabine (Org. Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. (Org.. Brasília: Editora da UnB, 2014. 219 p.

    Directory of Open Access Journals (Sweden)

    Marie Hélène C. Torres

    2014-12-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.

  17. FERREIRA, Maria Alice Araújo; SOUZA, Germana Henriques Pereira de; GOROVITZ, Sabine (Org.) Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. (Org.). Brasília: Editora da UnB, 2014. 219 p.

    OpenAIRE

    Torres, Marie Hélène C.

    2014-01-01

    http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org.), Brasília: Editora da UnB, 2014. 219 p.

  18. Potential population-level nutritional impact of replacing whole and reduced-fat milk with low-fat and skim milk among US children aged 2-19 years.

    Science.gov (United States)

    Rehm, Colin D; Drewnowski, Adam; Monsivais, Pablo

    2015-01-01

    Dietary guidance emphasizes plain low-fat and skim milk over whole, reduced-fat, and flavored milk (milk eligible for replacement [MER]). The objective of this study was to evaluate the population-level impact of such a change on energy, macronutrient and nutrient intakes, and diet cost. Cross-sectional modeling study. Data from the 2001-2002 and 2003-2004 National Health and Nutrition Examination Survey. A total of 8,112 children aged 2-19 years. Energy, macronutrient, and micronutrient intake before and after replacement of MER with low-fat or skim milk. Survey-weighted linear regression models. Milk eligible for replacement accounted for 46% of dairy servings. Among MER consumers, replacement with skim or low-fat milk would lead to a projected reduction in energy of 113 (95% confidence interval [CI], 107-119) and 77 (95% CI, 73-82) kcal/d and percent energy from saturated fat by an absolute value of 2.5% of total energy (95% CI, 2.4-2.6) and 1.4% (95% CI, 1.3-1.5), respectively. Replacement of MER does not change diet costs or calcium and potassium intake. Substitution of MER has the potential to reduce energy and total and saturated fat intake with no impact on diet costs or micronutrient density. The feasibility of such replacement has not been examined and there may be negative consequences if replacement is done with non-nutrient-rich beverages. Copyright © 2015. Published by Elsevier Inc.

  19. Publications | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... (restricted access). Conventional energy generation is a fundamental cause for competing demands on natural resources of both water and energy sectors, and is a significant contributor to anthropogenic climate change. This research seeks to identify barriers to wide-scale penetration of renewable energy technologies.

  20. 28 CFR 2.19 - Information considered.

    Science.gov (United States)

    2010-07-01

    ... is imprisoned about the financial, social, psychological, and emotional harm done to, or loss... Commission with specific facts and reasoning relevant to the statutory criteria for parole (18 U.S.C. 4206..., to be most helpful, a recommendation should state its underlying factual basis and reasoning. However...

  1. 219 ORIGINAL ARTICLE SEROPREVALENCE OF HEPATITIS C ...

    African Journals Online (AJOL)

    boaz

    ABSTRACT. Background: Hepatitis C virus (HCV) infection is a major public health concern. The aim of this study was to ascertain the seroprevalence and risk factors of HCV antibodies among pregnant women in Anyigba, Kogi State North Central Nigeria. Materials and methods:Blood samples (5mls) were collected from ...

  2. 12 CFR 219.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... institution means any office of a bank, savings bank, card issuer as defined in section 103 of the Consumers Credit Protection Act (15 U.S.C. 1602(n)), industrial loan company, trust company, savings association, building and loan, or homestead association (including cooperative banks), credit union, or consumer...

  3. Publications | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Science-policy dialogues for water security : addressing vulnerability and adaptation to global change in the arid Americas (restricted access) ... Impact of maternal and child health private expenditure on poverty and inequity in Bangladesh : out-of-pocket payments by patients at Ministry of Health and Family Welfare ...

  4. 36 CFR 219.3 - Overview.

    Science.gov (United States)

    2010-07-01

    ... planning framework. Land and resource management planning is a flexible process for fitting solutions to... responsible for national planning. National planning includes the Forest Service national strategic plan... Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest...

  5. 12 CFR 219.24 - Retention period.

    Science.gov (United States)

    2010-01-01

    ... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S... period of time, taking into consideration the nature of the record and the amount of time that has...

  6. 12 CFR 219.3 - Cost reimbursement.

    Science.gov (United States)

    2010-01-01

    ... that the financial institution use programming or other higher level technical services of a computer... (private sector) set out in the Employment Cost Trends section of the National Compensation Survey (http... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S...

  7. 49 CFR 219.23 - Railroad policies.

    Science.gov (United States)

    2010-10-01

    ... approved forms for mandatory post-accident toxicological testing under subpart C of this part provides the... start of alcohol testing under the railroad's alcohol misuse prevention program and to each person... the work day the covered employee is required to be in compliance with this part is that period when...

  8. 12 CFR 219.4 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ... financial records or information related to: (a) Security interests, bankruptcy claims, debt collection. Any... loan insurance program. (c) Nonidentifiable information. Financial records that are not identified with.... (f) Federally required reports. Financial records required to be reported in accordance with any...

  9. 22 CFR 219.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., emotional or mental illness, and specific learning disabilities. The term “physical or mental impairment... person means any person who has a physical or mental impairment that substantially limits one or more.... As used in this definition, the phrase: (1) Physical or mental impairment includes— (i) Any...

  10. 49 CFR 107.219 - Processing.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS AND OIL TRANSPORTATION HAZARDOUS MATERIALS PROGRAM... with the disposition of previous applications for waiver of preemption determinations. [Amdt. 107-3, 41...

  11. Publications | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Using Technology to Document Violations: Enabling Sex Worker Communities to Document Violence Against Them in India and Cambodia (open access). The project achieved the following; a significant shift in advocacy strategies from reactive to proactive strategies with a potential impact on the lives and wellbeing of ...

  12. 32 CFR 219.107 - IRB membership.

    Science.gov (United States)

    2010-07-01

    ... counsel in safeguarding the rights and welfare of human subjects. In addition to possessing the... subjects, such as children, prisoners, pregnant women, or handicapped or mentally disabled persons... IRB consists entirely of men or entirely of women, including the institution's consideration of...

  13. 48 CFR 219.1005 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... objects, which otherwise meet criteria in FAR subpart 19.10. (b) The targeted industry categories for DoD are: North American Industry Classification System (NAICS) Description NAICS Code (1) Pharmaceutical... Navigation System and Instrument Manufacturing 334511 (10) (i) Cellular and Other Wireless Telecommunications...

  14. Association between ε2/3/4, Promoter Polymorphism (−491A/T, −427T/C, and −219T/G at the Apolipoprotein E Gene, and Mental Retardation in Children from an Iodine Deficiency Area, China

    Directory of Open Access Journals (Sweden)

    Jun Li

    2014-01-01

    Full Text Available Background. Several common single-nucleotide polymorphisms (SNPs at apolipoprotein E (ApoE have been linked with late onset sporadic Alzheimer’s disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n=130, borderline MR (n=124, and controls (n=334 from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ2 test (P>0.05. However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004, indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4 and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.

  15. Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs).

    Science.gov (United States)

    Haslach, Erica M; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G; Giulianotti, Marc A; Pinilla, Clemencia; Appel, Jon R; Doering, Skye R; Walters, Michael A; Houghten, Richard A; Haskell-Luevano, Carrie

    2014-06-12

    Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseases symptoms associated with obesity including type 2 diabetes. Several hMC4 SNP receptors have been pharmacologically characterized in vitro to have a decreased, or a lack of response, to endogenous agonists such as α-, β-, and γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin hormone (ACTH). Herein we report the use of a mixture based positional scanning combinatorial tetrapeptide library to discover molecules with nM full agonist potency and efficacy to the L106P, I69T, I102S, A219V, C271Y, and C271R hMC4Rs. The most potent compounds at all these hMC4R SNPs include Ac-His-(pI)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Arg-(pI)Phe-NH2, and Ac-Arg-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, revealing new ligand pharmacophore models for melanocortin receptor drug design strategies.

  16. 36 CFR 219.21 - Social and economic sustainability.

    Science.gov (United States)

    2010-07-01

    ... AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Ecological, Social, and... national, regional, and local scales. Social analyses address human life-styles, cultures, attitudes... management on the well-being of communities and regions, and the net benefit of uses, values, products, or...

  17. 49 CFR 219.403 - Voluntary referral policy.

    Science.gov (United States)

    2010-10-01

    ... section, the railroad treats the referral and subsequent handling, including counseling and treatment, as confidential. (3) The railroad will, to the extent necessary for treatment and rehabilitation, grant the employee a leave of absence from the railroad for the period necessary to complete primary treatment and...

  18. 49 CFR 219.101 - Alcohol and drug use prohibited.

    Science.gov (United States)

    2010-10-01

    ...) Under the influence of or impaired by alcohol; (ii) Having .04 or more alcohol concentration in the breath or blood; or (iii) Under the influence of or impaired by any controlled substance. (3) No employee... distribution is through documented over the counter sales (Schedule V only). (c) Railroad rules. Nothing in...

  19. 29 CFR 1910.219 - Mechanical power-transmission apparatus.

    Science.gov (United States)

    2010-07-01

    ... dimensions specified in this paragraph shall apply to all guards, except horizontal overhead belts, rope... drives of twenty (20) inch centers or under shall be not less than one-fourth inch from the nearest... one-fourth (11/4) inches inside diameter, or larger. If made of metal shapes or bars, their section...

  20. 75 FR 219 - Availability of Funds and Collection of Checks

    Science.gov (United States)

    2010-01-05

    ...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0.... FOR FURTHER INFORMATION CONTACT: Jeffrey S. H. Yeganeh, Financial Services Manager (202/728-5801), or...

  1. 12 CFR 219.21 - Authority, purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... amended by the Annunzio-Wylie Anti-Money Laundering Act of 1992 (Pub. L. 102-550, Title XV; 106 Stat. 3672... recordkeeping and reporting requirements will assist in the prosecution of money laundering activities and are...

  2. 37 CFR 2.19 - Revocation or withdrawal of attorney.

    Science.gov (United States)

    2010-07-01

    ...., a corporate officer or general partner of a partnership). In the case of joint applicants or joint... a trademark case may withdraw upon application to and approval by the Director or, when applicable..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized...

  3. Dicty_cDB: SHE219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KXSRTLPFELIIALDXSLQAXGQLXLDD GESIQTYVDNKYSFIQFDVVSSPSSSAYKLQSTIXNNNYNGTASLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIX...SLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIXLK Frame B: knin*n*kknetfvfinyffcyciilxcwiiisiim*isr...fixvvvisfqlnqpphmlhqlmvfqlplkxlelyhln*llpwixhykqxvnyxwmm vnqfkpmliintlsfnsmlxphhlhlptnynqpxsitiimvpll*slilsk

  4. 24 CFR 200.219 - Content of certification.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Participation and Compliance Requirements... as a result of HUD audits, management reviews or other governmental investigations; (iv) There has... Federal Government or of a State Government from doing business with such Department or Agency; (vii) The...

  5. 219-IJBCS-Article-Dr R N -Nwaoguikpe

    African Journals Online (AJOL)

    RHUMSIKI

    The mechanism of action of the drug is based on its ability to ... ml of distilled water were mixed with each extract, then ... for 48 hours. The two–liquid phase layers were then separated ... gravitational force of 1500 x g for 15 minutes using the ...

  6. 49 CFR 219.300 - Mandatory reasonable suspicion testing.

    Science.gov (United States)

    2010-10-01

    ... or body odors of the employee. (2) A railroad must require a covered employee to submit to a drug... body odors of the employee. Such observations may include indications of the chronic and withdrawal...

  7. 48 CFR 1052.219-71 - Subcontracting Plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Subcontracting Plan. 1052... Subcontracting Plan. As prescribed in DTAR 1019.708-70(b), insert the following provision: Subcontracting Plan (MAR 2002) As part of its initial proposal, each large business offeror must submit a contracting plan...

  8. 30 CFR 219.410 - What does this subpart contain?

    Science.gov (United States)

    2010-07-01

    ... GOMESA revenues are reserved for the following purposes: (1) Projects and activities for the purposes of... projects. (5) Planning assistance and administrative costs not-to-exceed 3 percent of the amounts received... Center, Building 85; MS-350B1; Denver, CO 80225-0165, or at (303) 231-3429. ...

  9. 34 CFR 685.219 - Public Service Loan Forgiveness Program.

    Science.gov (United States)

    2010-07-01

    ... duty for training or attendance at a service school. For civilians, “Military service” means service on... Revenue Code; (4) A Tribal college or university; or (5) A private organization that— (i) Provides the following public services: Emergency management, military service, public safety, law enforcement, public...

  10. 49 CFR 219.9 - Responsibility for compliance.

    Science.gov (United States)

    2010-10-01

    ..., or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed; and... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations; where a grossly...

  11. 49 CFR 397.219 - Waiver determination and order.

    Science.gov (United States)

    2010-10-01

    ... rational basis; (3) Whether the highway routing designation of the State, political subdivision thereof, or... readily identifiable by the Administrator as one who may be affected by the order. A copy of each order is... with § 397.223, an order issued under this section constitutes the final agency decision regarding...

  12. 49 CFR 219.203 - Responsibilities of railroads and employees.

    Science.gov (United States)

    2010-10-01

    ... duty tour. An employee who has been transported to receive medical care is not released from duty for... testing does not excuse such refusal by the employee timely to provide the required specimens. (c) Place...

  13. 32 CFR 219.116 - General requirements for informed consent.

    Science.gov (United States)

    2010-07-01

    ... statement that participation is voluntary, refusal to participate will involve no penalty or loss of...) Nothing in this policy is intended to limit the authority of a physician to provide emergency medical care...

  14. 48 CFR 219.704 - Subcontracting plan requirements.

    Science.gov (United States)

    2010-10-01

    ... business firms specifically identified in the subcontracting plan. Notifications shall be in writing and... SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business... business concerns shall include subcontracts with historically black colleges and universities and minority...

  15. 1935 15' Quad #219 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  16. 48 CFR 652.219-73 - Mentor Requirements and Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in 619.202-70(o)(2), insert the following clause: Mentor Requirements and Evaluation (APR 2004) (a) Mentor and protégé firms shall submit an evaluation to...

  17. 48 CFR 1552.219-70 - Mentor-Protege Program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor-Protege Program... Mentor-Protege Program. As prescribed in 1519.203(a), insert the following clause: Mentor-Protege Program OCT 2000 (a) The Contractor has been approved to participate in the EPA Mentor-Protege program. The...

  18. 48 CFR 1052.219-75 - Mentor Requirements and Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in DTAR 1019.202-70, insert the following clause: Mentor Requirements and Evaluation (JAN 2000) (a) Mentor and protégé firms shall submit an evaluation to...

  19. 49 CFR 219.213 - Unlawful refusals; consequences.

    Science.gov (United States)

    2010-10-01

    ... inconsistent with the employee's health, whether such refusal was made in good faith and based on medical..., as appropriate, also consider the following: (1) Whether the railroad made a good faith determination...

  20. 47 CFR 90.219 - Use of signal boosters.

    Science.gov (United States)

    2010-10-01

    ... to operate radio systems in the frequency bands above 150 MHz may employ signal boosters at fixed... fill in only weak signal areas and cannot extend the system's normal signal coverage area. (b) Class A... effective radiated power (ERP) of the unit to a maximum of 5 watts under all conditions. Class B broadband...

  1. 49 CFR 219.405 - Co-worker report policy.

    Science.gov (United States)

    2010-10-01

    ... dependence on alcohol or a drug or by another identifiable and treatable mental or physical disorder... and treatable mental or physical disorder— (1) The railroad must return the employee to service within... effects of alcohol and drugs on occupational or transportation safety. (f) Follow-up tests. A railroad may...

  2. 49 CFR 1544.219 - Carriage of accessible weapons.

    Science.gov (United States)

    2010-10-01

    ...) Flights for which screening is conducted. The provisions of § 1544.201(d), with respect to accessible weapons, do not apply to a law enforcement officer (LEO) aboard a flight for which screening is required..., county, or state law enforcement officer who is a direct employee of a government agency. (ii) Be sworn...

  3. All projects related to | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Integrated Approach to Address Food and Nutrition Security in the ... Could integrated garden and nutrition programs at schools help address the problem? .... LABOUR POLICY, GENDER EQUALITY, ECONOMIC ANALYSIS, LABOUR ...

  4. Dicty_cDB: VHD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available igf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtsp...lihligf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtspeng*r*qwmvdaqslkeviillt

  5. Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators

    Science.gov (United States)

    Wolszczak, W.; Dorenbos, P.

    2017-06-01

    Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.

  6. 48 CFR 52.219-28 - Post-Award Small Business Program Rerepresentation.

    Science.gov (United States)

    2010-10-01

    ... influence on a national basis in a kind of business activity in which a number of business concerns are... position, ownership or control of materials, processes, patents, license agreements, facilities, sales...

  7. 48 CFR 552.219-74 - Section 8(a) Direct Award.

    Science.gov (United States)

    2010-10-01

    ... contracting activity shall give advance notice to SBA before it issues a final notice terminating performance... prior to processing any advance payments or novation agreements. The contracting activity may assign contract administration functions to a contract administration office. (c) The Contractor agrees: (1) To...

  8. 28 CFR 2.219 - Maximum terms of imprisonment and supervised release.

    Science.gov (United States)

    2010-07-01

    ... contraband into prison 3 years 2 years. 22-2704 Child prostitution: abducting or harboring 3 years (10 years...) or child sex abuse 3 years (10 years if SOR) 2 years. 22-401, 4502 [22-501, 3202] Assault: with... statute for offense circumstances) 3 years 2 years. 22-1101(a), (c)(1) [22-901] Cruelty to children 1st...

  9. Fission in Empire-II version 2.19 beta1, Lodi

    International Nuclear Information System (INIS)

    Sin, M.

    2003-01-01

    This is a description of the fission model implemented presently in EMPIRE-II. This package offers two ways to calculate the fission probability selected by parameters in the optional input. Fission barriers, fission transmission coefficients, fission cross sections and fission files are calculated

  10. Sexospécificités | Page 219 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Uncontrolled development was threatening to destroy the forest environment and the traditional way of life of the hill people of Ratanakiri. Researchers worked with the villagers to produce unique maps and resource use plans that convinced the government of the people's traditional resource use and management rights, ...

  11. Polychlorinated biphenyls (PCB) analysis report for solid sample for 219S tank 102

    International Nuclear Information System (INIS)

    Ross, G.A.

    1997-01-01

    One waste sample was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Extraction follows closely method 354 C of SW-846, analysis follows SW-846 method 8082. A cross reference of laboratory sample number to the customer identification is given in a table

  12. 219 The Revised Edition of Korean Calendar for Allergenic Pollens

    Science.gov (United States)

    Oh, Jae-won; Kim, Joo-Hwa; Kim, Seong-Won; Kang, Im-Joo; Kim, Bong-Seong; Kook, Myung-Hee; Park, Kang-Seo; Lee, Ha-Baik; Kim, Kyu Rang; Choi, Young-Jean

    2012-01-01

    Background The old version of pollen calendar was used until this year in South Korea. That calendar did not reflect current pollen distribution and concentrations that can be influenced by changes in weather and environment. A new pollen calendar of allergenic pollens was made based on the data on pollen concentrations obtained in 8 regions nationwide between 1997 and 2009 in South Korea. Methods The distribution of pollen grains was assessed every day at 8 areas (Seoul, Guri, Busan, Daegu, Jeonju, Kwangju, Kangneung, and Jeju) nationwide for 12 years between July 1, 1997 and June 30, 2009. Pollen were collected by using Burkard 7-day sampler (Burkard manufacturing Co Ltd, Hertfordshire, UK), and the collected pollens were sent every week to Hanyang Guri Hospital. Then pollens were strained with Calberla's fuchsin staining solution and were identified. The number of pollen grains per m3 was calculated. Results Alder, birch and Japanese cedar started to appear in February. Japanese cedar showed a highest pollen concentration in Jeju. Pine became the highest pollen in May, and the pollen concentrations of oak and birch also became high. Common ragweed appeared in the middle of August and showed the highest pollen concentration in the middles of September. Japanese hop showed a high concentration between the middle of August and the end of September, and mugwort appeared in the middles of August and its concentration increased up until early September. Birch appeared earlier in Kangneung, and pine showed a higher pollen concentration than in the other areas. In Daegu, Oriental thuja, alder and juniper produced a large concentration of pollens. Pine produced a large concentration of pollens between the middle of April and the end of May. Weeds showed higher concentrations in September and mugwort appeared earlier than common ragweed. In Busan where is the southeast city, the time of flowering is relatively early, and alder and Oriental thuja appeared earliest among all areas. In Kwangju, Oriental thuja and hazelnut appeared in early February. In Jeju which is the end of southern island, Japanese cedar showed a higher pollen concentration than the other areas Conclusions New information on pollen distributions and concentrations should be provided for the general publics or allergic patients through the website in order to prevent the occurrence of pollinosis.

  13. 36 CFR 219.23 - The role of science in assessments, analyses, and monitoring.

    Science.gov (United States)

    2010-07-01

    ... SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning... be led by a Chief Scientist selected by the Deputy Chief of Research and Development. When...

  14. 48 CFR 52.219-16 - Liquidated Damages-Subcontracting Plan.

    Science.gov (United States)

    2010-10-01

    ... following clause: Liquidated Damages—Subcontracting Plan (JAN 1999) (a) Failure to make a good faith effort... has failed to make such good faith effort, the Contracting Officer shall give the Contractor written notice specifying the failure and permitting the Contractor to demonstrate what good faith efforts have...

  15. 48 CFR 52.219-12 - Special 8(a) Subcontract Conditions.

    Science.gov (United States)

    2010-10-01

    ... all of the requirements of Contract No. __ [insert number of contract] for the consideration stated... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... into Contract No. __ [insert number of contract] with the __ [insert name of contracting agency] to...

  16. People and things. CERN Courier, November 1981, v. 21(9)

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. At the end of August a circulating electron beam was achieved for the first time in the VUV (vacuum ultraviolet) ring of the US National Synchrotron Light Source at Brookhaven. Commissioning of the X-ray ring of the NSLS is imminent. From 11-14 January, an International Colloquium on Baryon Nonconservation (ICOBAN) will be held at the Tata Institute of Fundamental Research, Bombay.From 17-23 February an International Conference on Instrumentation for Colliding Beam Physics will be held at the Stanford Linear Accelerator Center. A Europhysics Conference on 'Computing in Accelerator Design and Operation' will be held in Warsaw from 21-24 September 1982. A team at Los Alamos, led by Charles Brau, has demonstrated the principle of a high efficiency free electron laser. Work has started on a prototype magnet to confirm the design of a 2 GeV electron microtron under study at Argonne for use in nuclear and particle physics research. On 2 October a new ion source and injector system, known as ABEL, was inaugurated at Berkeley. The X-ray synchrotron radiation produced by electron storage rings could provide improved diagnosis in conditions such as coronary artery disease. Fermilab is proposing to set up an on-site Latin America Center for Fundamental Physics and Technology to assist scientists and engineers from developing countries

  17. Molecular dynamics study of the dominant-negative E219K polymorphism in human prion protein

    NARCIS (Netherlands)

    Jahandideh, Samad; Jamalan, Mostafa; Faridounnia, Maryam|info:eu-repo/dai/nl/338666923

    2015-01-01

    Human prion diseases are associated with misfolding or aggregation of the Human Prion Protein (HuPrP). Missense mutations in the HuPrP gene, contribute to conversion of HuPrP(C) to HuPrP(Sc) and amyloid formation. Based on our previous comprehensive study, three missense mutations, from two

  18. Yeast Interacting Proteins Database: YPL031C, YPL219W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ting the cellular response to nutrient levels and environmental conditions and progression through the cell ...e cellular response to nutrient levels and environmental conditions and progression through the cell cycle R

  19. 49 CFR Appendix C to Part 219 - Post-Accident Testing Specimen Collection

    Science.gov (United States)

    2010-10-01

    ... the transfer of the blood tubes on the second line of STEP 5 (the chain of custody block). E. Collect... (the chain of custody block). F. Seal the Individual Employee Kit a. The blood and urine specimens have... railroad representatives handling the box shall document chain of custody of the shipping box and shall...

  20. 219 Enumah et al., Afr J Tradit Complement Altern Med. (2016) 13(3 ...

    African Journals Online (AJOL)

    The practice of medicine continues to evolve in Sub-Saharan Africa, and its .... notes were taken to enhance and supplement future data acquisition and analysis. .... especially given the modern trend in advertising for what the pastor dubbed ..... conceptualization of her illness speaks to a larger phenomenon that is noted ...

  1. 7 CFR 2.19 - Under Secretary for Food, Nutrition, and Consumer Services.

    Science.gov (United States)

    2010-01-01

    ... nutrition assistance program benefits to be so distributed. (v) Develop food plans for use in establishing supplemental nutrition assistance benefit levels, and assess the nutritional impact of Federal food programs... eating qualities of food served in homes and institutions. (iv) Develop materials to aid the public in...

  2. 32 CFR 219.101 - To what does this policy apply?

    Science.gov (United States)

    2010-07-01

    ..., such as (i) research on regular and special education instructional strategies, or (ii) research on the effectiveness of or the comparison among instructional techniques, curricula, or classroom management methods... as provided in paragraph (b) of this section, this policy applies to all research involving human...

  3. New research initiatives program. Project W-219: chemistry in comet comae. Final report

    International Nuclear Information System (INIS)

    Huebner, W.F.

    1978-02-01

    The scientific objective to investigate theoretically chemical reactions in the comae of comets was accomplished using a one-dimensional model. Ninety-eight species, which involved 441 reactions in the presence of wavelength-dependent solar radiation, were considered in a time-dependent calculation, which includes effects resulting from ultraviolet opacity

  4. Evaluation report on SCTF Core-II test S2-19

    International Nuclear Information System (INIS)

    Ohnuki, Akira; Iwamura, Takamichi; Iguchi, Tadashi; Abe, Yutaka; Murao, Yoshio; Adachi, Hiromichi.

    1991-03-01

    Experimental studies using Slab Core Test Facility (SCTF) have revealed that the heat transfer enhancement in higher power bundles is mainly governed by the radial power ratio in core during the reflood in PWR-LOCA. As a physical mechanism for the heat transfer enhancement, it can be considered from the experimental evidence that the increase of upward steam flow rate in a higher power bundle which is caused by the higher steam production rate in the bundle gives the higher upward liquid flow rate in the bundle and the increase of the liquid flow rate gives the heat transfer enhancement. In order to develop a mechanistic model for the heat transfer enhancement based on this idea, the following relations should be identified quantitatively: (1) Relation between the steam production rate and the upward liquid flow rate, (2) Cross flow rate above the quench front and (3) Relation between the degree of heat transfer enhancement due to radial power ratio and the amount of increase of upward liquid flow rate. In this report, the above relation (3) was investigated experimentally as a step to develop the mechanistic model using the SCTF where the relation between the radial power ratio and the heat transfer enhancement has been made clear quantitatively. The degree of increase of heat transfer between two forced feed tests with the different flow rate in LPCI period was compared with the degree of heat transfer enhancement under a radial power ratio in the previous SCTF tests. The two forced feed tests were performed under the condition without any significant two-dimensional hydraulic behavior in core. The ratio of the mass flow rate between the two tests was about double. (author)

  5. Taiwo et al., Afr J Tradit Complement Altern Med., (2017) 14 (1): 219 ...

    African Journals Online (AJOL)

    isolate a novel compound whose structure was elucidated from the analysis of the .... The crude extract was dissolved in 500 ml of water and 2.0 L of acetone was ..... at 2.97 Å was retrieved from the RCSB database (www.rcsb.org), PDB code.

  6. 48 CFR 52.219-23 - Notice of Price Evaluation Adjustment for Small Disadvantaged Business Concerns.

    Science.gov (United States)

    2010-10-01

    ... black college or university means an institution determined by the Secretary of Education to meet the... application was submitted. In this case, in order to receive the benefit of a price evaluation adjustment, an... integral part of such a college or university before November 14, 1986. Minority institution means an...

  7. Codon 219 polymorphism of PRNP in healthy caucasians and Creutzfeldt-Jakob disease patients

    Energy Technology Data Exchange (ETDEWEB)

    Petraroli, R.; Pocchiari, M. [Instituto Superiore di Sanita, Rome (Italy)

    1996-04-01

    A number of point and insert mutations of the PrP gene (PRNP) have been linked to familial Creutzfeldt-Jakob disease (CJD) and Gerstmann-Straussler-Scheinker disease (GSS). Moreover, the methionine/valine homozygosity at the polymorphic codon 129 of PRNP may cause a predisposition to sporadic and iatrogenic CJD or may control the age at onset of familial cases carrying either the 144-bp insertion or codon 178, codon 198, and codon 210 pathogenic mutations in PRNP. In addition, the association of methionine or valine at codon 129 and the point mutation at codon 178 on the same allele seem to play an important role in determining either fatal familial insomnia or CJD. However, it is noteworthy that a relationship between codon 129 polymorphism and accelerated pathogenesis (early age at onset or shorter duration of the disease) has not been seen in familial CJD patients with codon 200 mutation or in GSS patients with codon 102 mutation, arguing that other, as yet unidentified, gene products or environmental factors, or both, may influence the clinical expression of these diseases. 17 refs.

  8. 48 CFR 352.219-70 - Mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Mentor-protégé program. As prescribed in 319.270-1(a), the Contracting Officer shall insert the following provision: Mentor-Protégé Program (January 2010) (a) Large business prime contractors serving as mentors in...

  9. 14 CFR 120.219 - Handling of test results, record retention, and confidentiality.

    Science.gov (United States)

    2010-01-01

    .../headquarters_offices/avs/offices/aam/drug_alcohol/. (3) A service agent may prepare the MIS report on behalf of an employer. However, a company official (e.g., Designated Employer Representative as defined in 49...

  10. 20 CFR 219.34 - When evidence that a marriage has ended is required.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence that a marriage has ended is... a marriage has ended is required. Evidence of how a previous marriage ended may be required to determine whether a later marriage is valid. If a widow or widower remarried after the employee's death and...

  11. SUBTASK 2.19 – OPERATIONAL FLEXIBILITY OF CO2 TRANSPORT AND STORAGE

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Melanie; Schlasner, Steven; Sorensen, James; Hamling, John

    2014-12-31

    Carbon dioxide (CO2) is produced in large quantities during electricity generation and by industrial processes. These CO2 streams vary in terms of both composition and mass flow rate, sometimes substantially. The impact of a varying CO2 stream on pipeline and storage operation is not fully understood in terms of either operability or infrastructure robustness. This study was performed to summarize basic background from the literature on the topic of operational flexibility of CO2 transport and storage, but the primary focus was on compiling real-world lessons learned about flexible operation of CO2 pipelines and storage from both large-scale field demonstrations and commercial operating experience. Modeling and pilot-scale results of research in this area were included to illustrate some of the questions that exist relative to operation of carbon capture and storage (CCS) projects with variable CO2 streams. It is hoped that this report’s real-world findings provide readers with useful information on the topic of transport and storage of variable CO2 streams. The real-world results were obtained from two sources. The first source consisted of five full-scale, commercial transport–storage projects: Sleipner, Snøhvit, In Salah, Weyburn, and Illinois Basin–Decatur. These scenarios were reviewed to determine the information that is available about CO2 stream variability/intermittency on these demonstration-scale projects. The five projects all experienced mass flow variability or an interruption in flow. In each case, pipeline and/or injection engineers were able to accommodate any issues that arose. Significant variability in composition has not been an issue at these five sites. The second source of real- world results was telephone interviews conducted with experts in CO2 pipeline transport, injection, and storage during which commercial anecdotal information was acquired to augment that found during the literature search of the five full-scale projects. The experts represented a range of disciplines and hailed from North America and Europe. Major findings of the study are that compression and transport of CO2 for enhanced oil recovery (EOR) purposes in the United States has shown that impurities are not likely to cause transport problems if CO2 stream composition standards are maintained and pressures are kept at 10.3 MPa or higher. Cyclic, or otherwise intermittent, CO2 supplies historically have not impacted in-field distribution pipeline networks, wellbore integrity, or reservoir conditions. The U.S. EOR industry has demonstrated that it is possible to adapt to variability and intermittency in CO2 supply through flexible operation of the pipeline and geologic storage facility. This CO2 transport and injection experience represents knowledge that can be applied in future CCS projects. A number of gaps in knowledge were identified that may benefit from future research and development, further enhancing the possibility for widespread application of CCS. This project was funded through the Energy & Environmental Research Center–U.S. Department of Energy Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  12. : tous les projets | Page 219 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: URBAN YOUTH, CRIME PREVENTION, YOUTH UNREST, ORGANIZED CRIME, VIOLENCE, MARGINALISM. Région: Guatemala, North and Central America, Honduras, El Salvador, South America. Programme: Gouvernance et justice. Financement total : CA$ 464,000.00. Prévention de la violence chez les jeunes ...

  13. 14 CFR 125.219 - Oxygen for medical use by passengers.

    Science.gov (United States)

    2010-01-01

    ... in conformity with the manufacturing, packaging, marking, labeling, and maintenance requirements of... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Instrument and..., maintained under the certificate holder's approved maintenance program; (iii) Free of flammable contaminants...

  14. La Desercion Escolar en los Niveles de Sexto y Noveno Grado: Una Comparacion Entre Zonas Rurales y Urbanas. Boletin 219 (The Educational Desertion in the 6th and 9th Grades: A Comparison Between Rural and Urban Zones. Bulletin 219).

    Science.gov (United States)

    Lopez, Maria I. Hernandez; And Others

    In 1962 and again in 1965, a group of sixth and ninth grade students in selected schools in four Puerto Rican communities were interviewed to investigate the factors influencing students' decision to withdraw from school before completing twelfth grade and to identify some characteristics of dropouts. Of 616 students interviewed in 1962, 20.9% of…

  15. Lithium-vanadium advanced blanket development. ITER final report on U.S. contribution: Task T219/T220

    Energy Technology Data Exchange (ETDEWEB)

    Smith, D.L.; Mattas, R.F. [comps.

    1997-07-01

    The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report.

  16. 75 FR 53533 - Procedures for the Handling of Retaliation Complaints Under Section 219 of the Consumer Product...

    Science.gov (United States)

    2010-08-31

    ... you about submitting personal information such as social security numbers and birth dates. Docket: To... Withdrawal of Complaints, Objections, and Petitions for Review; Settlement This section provides for the procedures and time periods for withdrawal of complaints, the withdrawal of findings and/or preliminary...

  17. Cusculium (Plin. XVI 22, coscus (Chiron 237 and coccolubis (Colum. III 2.19: Mediterranean substrate and Latin form

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández

    2014-12-01

    Full Text Available Cusculium, a hapax used by Pliny in its accusative form, has a Pre-Roman base (cuscu- that is found throughout western Mediterranean countries; the same root appears in coscus, referring to certain types of worm. Given its Latin ending, the word could be used to designate both the tree (cusculius «kermes oak» and its acorns (cusculium. Coccolubis is a compound adjective, the first element of which is the diminutive of coccum («grain of kermes», which carries the same Mediterranean root as the previous word. Given its use as an epithet for a type of vine, its second element may be seen to contain the base of the noun uua. Its original form may have therefore been coccoluuis («of red grape». The Navarran term cuzculubita («oak apple», however, suggests that a Pre-Roman compound may have existed.

  18. 75 FR 56533 - Wireless Telecommunications Bureau Postpones Auction of 218-219 MHz Service and Phase II 220 MHz...

    Science.gov (United States)

    2010-09-16

    ... FEDERAL COMMUNICATIONS COMMISSION [AU Docket No. 10-107; DA 10-1630] Wireless Telecommunications... Auction 89. FOR FURTHER INFORMATION CONTACT: Wireless Telecommunications Bureau, Auctions and Spectrum... by the Chief, Wireless Telecommunications Bureau pursuant to authority delegated by 47 CFR 0.131...

  19. Lithium-vanadium advanced blanket development. ITER final report on U.S. contribution: Task T219/T220

    International Nuclear Information System (INIS)

    Smith, D.L.; Mattas, R.F.

    1997-07-01

    The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report

  20. Contribution to the study of disintegration schemes of "2"2"7Th and of "2"1"9Rn

    International Nuclear Information System (INIS)

    Cluzeau, Serge

    1965-01-01

    After some theoretical recalls on the unified model, notably for regions of complete layers, for regions far from these layers, and for intermediate regions, and on angular correlations (γ ray shower, α-γ ray shower), this research thesis reports the study of total angular moments and of nucleus parities for some excitation states, for some elements of the "2"2"7Ac family. For this purpose, an alpha-gamma and gamma-gamma coincidence spectrometer has been developed. The author reports the study of the spectrometer performance, and discusses experimental results [fr

  1. Characterization of Nitrogen Uptake Pattern in Malaysian Rice MR219 at Different Growth Stages Using 15N Isotope

    Directory of Open Access Journals (Sweden)

    Mohammad Mu’az Hashim

    2015-09-01

    Full Text Available Nitrogen (N use efficiency is usually less than 50%, and it remains a major problem in rice cultivation. Controlled release fertilizer (CRF technology is one of the well-known efforts to overcome this problem. The efficiency of CRF, however, is very much dependent on the timing of nutrient release. This study was conducted to determine the precise time of N uptake by rice as a guideline to develop efficient CRF. Fertilizer N uptake by rice at different growth stages was investigated by using 15N isotopic technique. Rice was planted in pots, with 15N urea as N source at the rate of 120 kg/hm2. Potassium and phosphorus were applied at the same rate of 50 kg/hm2. Standard agronomic practices were employed throughout the growing periods. Rice plants were harvested every two weeks until maturation at the 14th week and analyzed for total N and 15N content. Nitrogen derived from fertilizer was calculated. Total N uptake in plants consistently increased until the 11th week. After that, it started to plateau and finally declined. Moreover, N utilization by rice plants peaked at 50%, which occurred during the 11th week after transplanting. N derived from fertilizer in rice plants were in the range of 18.7% to 40.0% in all plant tissues. The remaining N was derived from soil. Based on this study, N release from CRF should complete by the 11th week after planting to ensure the maximum fertilizer N uptake by rice plants. Efficient CRF should contribute to higher N derived from fertilizer which also resultedin a higher total N uptake by rice plants, increasing the potential of rice to produce higher yield while at the same time of reducing loss.

  2. 77 FR 40494 - Procedures for the Handling of Retaliation Complaints Under Section 219 of the Consumer Product...

    Science.gov (United States)

    2012-07-10

    ... jurisdiction over the action without regard to the amount in controversy, and the case will be tried before a... complainant, the agency will redact them in accordance with the Privacy Act of 1974, 5 U.S.C. 552a, and other... confidentiality laws. However, in addition to the Privacy Act, a variety of confidentiality provisions may protect...

  3. 48 CFR 52.219-21 - Small Business Size Representation for Targeted Industry Categories Under the Small Business...

    Science.gov (United States)

    2010-10-01

    ... employees for the past 12 months (check this column if size standard stated in solicitation is expressed in terms of number of employees) or Offeror's average annual gross revenue for the last 3 fiscal years (check this column if size standard stated in solicitation is expressed in terms of annual receipts...

  4. Vegetation changes along gradients of long-term soil development in the Hawaiian montane rainforest zone11-219.

    Science.gov (United States)

    Kanehiro Kitayama; Dieter Mueller-Dombois

    1995-01-01

    The development of the Hawaiian montane rainforest was investigated along a 4.1-million-year soil age gradient at 1200 m elevation under two levels of precipitation, the mesic (c. 2500 mm annual rainfall) vs. wet (> 4000 mm)age gradient. Earlier analyses suggested that soil fertility and foliar nutrient concentrations of common canopy species changed unimodally on...

  5. 76 FR 8620 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Turbofan Engines

    Science.gov (United States)

    2011-02-15

    ... inspection AD 97-17-04R1, and to allow automatic eddy current inspection per engine manual Section 72-33-31.... That AD currently requires revisions to the engine manufacturer's time limits section (TLS) to include... modifies the TLS of the manufacturer's engine manual and an air carrier's approved continuous airworthiness...

  6. 50 CFR 226.219 - Critical habitat for the Southern Distinct Population Segment of North American Green Sturgeon...

    Science.gov (United States)

    2010-10-01

    ...″ W.), and Bonilla Point, British Columbia (48°35′30″ N./124°43′00″ W.); in Jefferson and Island... following coastal bays and estuaries in California, Oregon, and Washington: (i) San Francisco Bay, San Pablo Bay, and Suisun Bay in California. All tidally influenced areas of San Francisco Bay, San Pablo Bay...

  7. Review on transactinium isotope build-up and decay in reactor fuel and related sensitivities to cross section changes and results and main conclusions of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data, held at Karlsruhe, November 1975

    International Nuclear Information System (INIS)

    Kuesters, H.; Lalovic, M.

    1976-04-01

    In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de

  8. Long non-coding RNA TUG1 promotes progression of oral squamous cell carcinoma through upregulating FMNL2 by sponging miR-219

    OpenAIRE

    Yan, Guangqi; Wang, Xue; Yang, Mingliang; Lu, Li; Zhou, Qing

    2017-01-01

    Oral squamous cell carcinoma (OSCC) is a prevalent oral disease with a high morbidity and mortality rate. Several long non-coding RNAs (lncRNAs) were identified as important regulators of carcinogenesis. However, the pathogenic implications of TUG1 in OSCC are still unclear. In the present study, the expression of TUG1 was increased in OSCC cells. Knockdown of TUG1 inhibited cell proliferation, migration, and invasion, and induced cell cycle arrest at G0/G1 phase, whereas overexpression of TU...

  9. Technical-evaluation report on the monitoring of electric power to the reactor-protection system for the Oyster Creek Nuclear Generating Station. (Docket No. 50-219)

    International Nuclear Information System (INIS)

    Selan, J.C.

    1983-01-01

    During the operating license review for Hatch 2, the Nuclear Regulatory Commission (NRC) staff raised a concern about the capability of the Class 1E reactor protection system (RPS) to operate after suffering sustained, abnormal voltage or frequency conditions from a non-Class 1E power supply. Abnormal voltage or frequency conditions could be produced as a result of one of the following causes: combinations of undetected, random single failures of the power supply components, or multiple failures of the power supply components caused by external phenomena such as a seismic event. The purpose of this report is to evaluate the licensees submittal with respect to the NRC criteria and present the reviewer's conclusion on the adequacy of the design modifications to protect the RPS from abnormal voltage and frequency conditions

  10. 77 FR 62316 - Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195; Decision and Order

    Science.gov (United States)

    2012-10-12

    ... testimony centered on certain prescriptions that presented a collection of red flags that no reasonable and... Warrants at both Respondents and interviewed various employees of each store's pharmacy departments.... Merrill stated that ``once the limit [wa]s reached,'' customers who then presented oxycodone prescriptions...

  11. Proceedings of US/Japan workshop, Q219 on high heat flux components and plasma surface interactions for next fusion devices

    Energy Technology Data Exchange (ETDEWEB)

    Ulrickson, M.A.; Stevens, P.L.; Hino, T.; Hirohata, Y. [eds.

    1996-12-01

    This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage.

  12. Topographic Map of Quadrangles 3666 and 3766, Balkh (219), Mazar-I-Sharif (220), Qarqin (213), and Hazara Toghai (214) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  13. Proceedings of US/Japan workshop, Q219 on high heat flux components and plasma surface interactions for next fusion devices

    International Nuclear Information System (INIS)

    Ulrickson, M.A.; Stevens, P.L.; Hino, T.; Hirohata, Y.

    1996-12-01

    This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage

  14. The Beaverdam Group: Archaeological Investigations at 9EB92, 9EB207, 9EB208 and 9EB219 Richard B. Russell Multiple Resource Area, Elbert County, Georgia.

    Science.gov (United States)

    1984-01-01

    emerging to suggest that the origin of domestication lies not locally but in Mesoamerica . Recent C-14 dated plant remains from 7 the Carlston-Annis site in...concept of horticulture that originated in Mesoamerica (Chomko and Crawford 1978:405). Whatever the source or inspiration of the appearance of food pro...historic period. Land-Use and Modification The records search on land-use and ownership primarily centered upon the available information in the Elbert

  15. Improving Lowland Rice (O. sativa L. cv. MR219 Plant Growth Variables, Nutrients Uptake, and Nutrients Recovery Using Crude Humic Substances

    Directory of Open Access Journals (Sweden)

    Perumal Palanivell

    2015-01-01

    Full Text Available High cation exchange capacity and organic matter content of crude humic substances from compost could be exploited to reduce ammonia loss from urea and to as well improve rice growth and soil chemical properties for efficient nutrients utilization in lowland rice cultivation. Close-dynamic air flow system was used to determine the effects of crude humic substances on ammonia volatilization. A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed with three rates of crude humic substances (20, 40, and 60 g pot−1. Standard procedures were used to evaluate rice plant dry matter production, nutrients uptake, nutrients recovery, and soil chemical properties. Application of crude humic substances increased ammonia volatilization. However, the lowest rate of crude humic substances (20 g pot−1 significantly improved total dry matter, nutrients uptake, nutrients recovery, and soil nutrients availability compared with crude humic substances (40 and 60 g pot−1 and the normal fertilization. Apart from improving growth of rice plants, crude humic substances can be used to ameliorate acid soils in rice cultivation. The findings of this study are being validated in our ongoing field trials.

  16. 77 FR 62346 - Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195; Denial of Request for Redactions

    Science.gov (United States)

    2012-10-12

    ... trade commodities and that can be said to be the end product of either innovation or substantial effort... schedule II controlled substances by competitors of the applicant. See Penick, 68 FR at 6947, 6949; Johnson... be a windfall to Respondents' competitors and would put Respondents at a competitive disadvantage...

  17. Integrated plant safety assessment: systematic evaluation program. Oyster Creek nuclear generating station. GPU Nuclear Corporation and Jersey Central Power and Light Company. Docket No. 50-219

    International Nuclear Information System (INIS)

    1982-09-01

    The Systematic Evaluation Program was initiated in February 1978 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the Oyster Creek Nuclear Generating Station (located in Ocean County, New Jersey), one of ten plants reviewed under Phase II of this program, and indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  18. Effects of Multisystemic Therapy through Midlife: A 21.9-Year Follow-Up to a Randomized Clinical Trial with Serious and Violent Juvenile Offenders

    Science.gov (United States)

    Sawyer, Aaron M.; Borduin, Charles M.

    2011-01-01

    Objective: Although current evidence suggests that the positive effects of multisystemic therapy (MST) on serious crime reach as far as young adulthood, the longer term impact of MST on criminal and noncriminal outcomes in midlife has not been evaluated. In the present study, the authors examined a broad range of criminal and civil court outcomes…

  19. Reliability and measurement error of frontal and horizontal 3D spinal motion parameters in 219 patients with chronic low back pain

    DEFF Research Database (Denmark)

    Harsted, Steen; Mieritz, Rune M; Bronfort, Gert

    2016-01-01

    BACKGROUND: In order for measurements to be clinically useful, data on psychometric conditions such as reliability should be available in the population for which the measurements are intended to be used. This study comprises a test-retest design separated by 7 to 14 days, and evaluates the intra...

  20. Revista MEDICINA - Vol. 30 No. 4 (83 - Diciembre 2008 219 Editorial Atención Primaria en Salud (APS. Una estrategia para mejorar la cobertura y la calidad.

    Directory of Open Access Journals (Sweden)

    Gustavo Malagón Londoño

    2008-12-01

    Full Text Available

    Con razón ha tomado fuerza la estrategia de atención primaria, ante las dificultades que han surgido para el cumplimiento de los enunciados originales de los sistemas de seguridad social en salud, no solamente de Colombia, sino de la mayoría de los países incluyendo los más desarrollados. Los propósitos de equidad, cobertura universal y calidad no han logrado alcanzar las metas propuestas
    por dificultades en el desarrollo del proceso en parte por las malas interpretaciones de los enunciados
    iniciales de la Ley, o por una reglamentación inconsistente y debilidad en el seguimiento y vigilancia estricta por parte de los organismos del Estado.
     
    A partir de la década del 50 del pasado siglo, terminado el conflicto bélico mundial, se aprecia como característica de todos los países un aumento notable de los índices de pobreza, aumento de la
    morbilidad, a tiempo que disminuyen los niveles de atención de la salud. A pesar del concepto prevalente de que transcurridas las grandes hecatombes surgen las mejores soluciones para borrar experiencias anteriores y marcar una notable reacción a lo vivido recientemente, aspectos como el de la atención de la
    salud han ofrecido una lenta evolución y la añorada obertura total ha encontrado todo tipo de tropiezos.
    Esto, desde luego, ha significado un espectacular freno al desarrollo económico. 

  1. Third quarterly report and final report within the counterpart subcontract no. 97/219: Support to the National Cleaner Production Centre, Tanzania

    DEFF Research Database (Denmark)

    Jørgensen, Michael Søgaard

    1999-01-01

    The report analyses barriers and incentivres to cleaner production in Tanznaia based on experiences in three demonstration projects with around 25 companies.An outline for a policy study on cleaner production in Tanzania and for the strengthening of cleaner production in Tanzania is given....

  2. SU-E-J-219: A Dixon Based Pseudo-CT Generation Method for MR-Only Radiotherapy Treatment Planning of the Pelvis and Head and Neck

    Energy Technology Data Exchange (ETDEWEB)

    Maspero, M.; Meijer, G.J.; Lagendijk, J.J.W.; Berg, C.A.T. van den [Department of Radiotherapy, UMC Utrecht (Netherlands); Seevinck, P.R.; Viergever, M.A. [Image Science Institute, UMC Utrecht (Netherlands)

    2015-06-15

    Purpose: To develop an image processing method for MRI-based generation of electron density maps, known as pseudo-CT (pCT), without usage of model- or atlas-based segmentation, and to evaluate the method in the pelvic and head-neck region against CT. Methods: CT and MRI scans were obtained from the pelvic region of four patients in supine position using a flat table top only for CT. Stratified CT maps were generated by classifying each voxel based on HU ranges into one of four classes: air, adipose tissue, soft tissue or bone.A hierarchical region-selective algorithm, based on automatic thresholding and clustering, was used to classify tissues from MR Dixon reconstructed fat, In-Phase (IP) and Opposed-Phase (OP) images. First, a body mask was obtained by thresholding the IP image. Subsequently, an automatic threshold on the Dixon fat image differentiated soft and adipose tissue. K-means clustering on IP and OP images resulted in a mask that, via a connected neighborhood analysis, allowing the user to select the components corresponding to bone structures.The pCT was estimated through assignment of bulk HU to the tissue classes. Bone-only Digital Reconstructed Radiographs (DRR) were generated as well. The pCT images were rigidly registered to the stratified CT to allow a volumetric and voxelwise comparison. Moreover, pCTs were also calculated within the head-neck region in two volunteers using the same pipeline. Results: The volumetric comparison resulted in differences <1% for each tissue class. A voxelwise comparison showed a good classification, ranging from 64% to 98%. The primary misclassified classes were adipose/soft tissue and bone/soft tissue. As the patients have been imaged on different table tops, part of the misclassification error can be explained by misregistration. Conclusion: The proposed approach does not rely on an anatomy model providing the flexibility to successfully generate the pCT in two different body sites. This research is founded by ZonMw IMDI Programme, project name: “RASOR sharp: MRI based radiotherapy planning using a single MRI sequence”, project number: 10-104003010.

  3. SU-F-J-219: Predicting Ventilation Change Due to Radiation Therapy: Dependency On Pre-RT Ventilation and Effort Correction

    Energy Technology Data Exchange (ETDEWEB)

    Patton, T; Du, K; Bayouth, J [University of Wisconsin, Madison, WI (United States); Christensen, G; Reinhardt, J [University of Iowa, Iowa City, IA (United States)

    2016-06-15

    Purpose: Ventilation change caused by radiation therapy (RT) can be predicted using four-dimensional computed tomography (4DCT) and image registration. This study tested the dependency of predicted post-RT ventilation on effort correction and pre-RT lung function. Methods: Pre-RT and 3 month post-RT 4DCT images were obtained for 13 patients. The 4DCT images were used to create ventilation maps using a deformable image registration based Jacobian expansion calculation. The post-RT ventilation maps were predicted in four different ways using the dose delivered, pre-RT ventilation, and effort correction. The pre-RT ventilation and effort correction were toggled to determine dependency. The four different predicted ventilation maps were compared to the post-RT ventilation map calculated from image registration to establish the best prediction method. Gamma pass rates were used to compare the different maps with the criteria of 2mm distance-to-agreement and 6% ventilation difference. Paired t-tests of gamma pass rates were used to determine significant differences between the maps. Additional gamma pass rates were calculated using only voxels receiving over 20 Gy. Results: The predicted post-RT ventilation maps were in agreement with the actual post-RT maps in the following percentage of voxels averaged over all subjects: 71% with pre-RT ventilation and effort correction, 69% with no pre-RT ventilation and effort correction, 60% with pre-RT ventilation and no effort correction, and 58% with no pre-RT ventilation and no effort correction. When analyzing only voxels receiving over 20 Gy, the gamma pass rates were respectively 74%, 69%, 65%, and 55%. The prediction including both pre- RT ventilation and effort correction was the only prediction with significant improvement over using no prediction (p<0.02). Conclusion: Post-RT ventilation is best predicted using both pre-RT ventilation and effort correction. This is the only prediction that provided a significant improvement on agreement. Research support from NIH grants CA166119 and CA166703, a gift from Roger Koch, and a Pilot Grant from University of Iowa Carver College of Medicine.

  4. Obesity-susceptibility loci have a limited influence on birth weight: a meta-analysis of up to 28,219 individuals

    DEFF Research Database (Denmark)

    Kilpelaeinen, T. O.; den Hoed, M.; Ong, K. K.

    2011-01-01

    High birth weight is associated with adult body mass index (BMI). We hypothesized that birth weight and BMI may partly share a common genetic background.......High birth weight is associated with adult body mass index (BMI). We hypothesized that birth weight and BMI may partly share a common genetic background....

  5. Profile of Graduate and First-Professional Students: Trends from Selected Years, 1995-96 to 2007-08. Web Tables. NCES 2011-219

    Science.gov (United States)

    Chen, Xianglei

    2010-01-01

    Enrollment in graduate and first-professional education in the United States has increased in recent years--from about 2 million students in fall 1995 to more than 2.6 million students in fall 2007 (Snyder, Dillow, and Hoffman 2009, tables 206 and 207). Increasing enrollments overall raise questions regarding the types of students entering…

  6. SU-E-J-219: Quantitative Evaluation of Motion Effects On Accuracy of Image-Guided Radiotherapy with Fiducial Markers Using CT Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Ali, I; Oyewale, S; Ahmad, S; Algan, O [University of Oklahoma Health Sciences, Oklahoma City, OK (United States); Alsbou, N [Department of Electrical and Computer Engineering, Ada, OH (United States)

    2014-06-01

    Purpose: To investigate quantitatively patient motion effects on the localization accuracy of image-guided radiation with fiducial markers using axial CT (ACT), helical CT (HCT) and cone-beam CT (CBCT) using modeling and experimental phantom studies. Methods: Markers with different lengths (2.5 mm, 5 mm, 10 mm, and 20 mm) were inserted in a mobile thorax phantom which was imaged using ACT, HCT and CBCT. The phantom moved with sinusoidal motion with amplitudes ranging 0–20 mm and a frequency of 15 cycles-per-minute. Three parameters that include: apparent marker lengths, center position and distance between the centers of the markers were measured in the different CT images of the mobile phantom. A motion mathematical model was derived to predict the variations in the previous three parameters and their dependence on the motion in the different imaging modalities. Results: In CBCT, the measured marker lengths increased linearly with increase in motion amplitude. For example, the apparent length of the 10 mm marker was about 20 mm when phantom moved with amplitude of 5 mm. Although the markers have elongated, the center position and the distance between markers remained at the same position for different motion amplitudes in CBCT. These parameters were not affected by motion frequency and phase in CBCT. In HCT and ACT, the measured marker length, center and distance between markers varied irregularly with motion parameters. The apparent lengths of the markers varied with inverse of the phantom velocity which depends on motion frequency and phase. Similarly the center position and distance between markers varied inversely with phantom speed. Conclusion: Motion may lead to variations in maker length, center position and distance between markers using CT imaging. These effects should be considered in patient setup using image-guided radiation therapy based on fiducial markers matching using 2D-radiographs or volumetric CT imaging.

  7. SU-E-J-219: Quantitative Evaluation of Motion Effects On Accuracy of Image-Guided Radiotherapy with Fiducial Markers Using CT Imaging

    International Nuclear Information System (INIS)

    Ali, I; Oyewale, S; Ahmad, S; Algan, O; Alsbou, N

    2014-01-01

    Purpose: To investigate quantitatively patient motion effects on the localization accuracy of image-guided radiation with fiducial markers using axial CT (ACT), helical CT (HCT) and cone-beam CT (CBCT) using modeling and experimental phantom studies. Methods: Markers with different lengths (2.5 mm, 5 mm, 10 mm, and 20 mm) were inserted in a mobile thorax phantom which was imaged using ACT, HCT and CBCT. The phantom moved with sinusoidal motion with amplitudes ranging 0–20 mm and a frequency of 15 cycles-per-minute. Three parameters that include: apparent marker lengths, center position and distance between the centers of the markers were measured in the different CT images of the mobile phantom. A motion mathematical model was derived to predict the variations in the previous three parameters and their dependence on the motion in the different imaging modalities. Results: In CBCT, the measured marker lengths increased linearly with increase in motion amplitude. For example, the apparent length of the 10 mm marker was about 20 mm when phantom moved with amplitude of 5 mm. Although the markers have elongated, the center position and the distance between markers remained at the same position for different motion amplitudes in CBCT. These parameters were not affected by motion frequency and phase in CBCT. In HCT and ACT, the measured marker length, center and distance between markers varied irregularly with motion parameters. The apparent lengths of the markers varied with inverse of the phantom velocity which depends on motion frequency and phase. Similarly the center position and distance between markers varied inversely with phantom speed. Conclusion: Motion may lead to variations in maker length, center position and distance between markers using CT imaging. These effects should be considered in patient setup using image-guided radiation therapy based on fiducial markers matching using 2D-radiographs or volumetric CT imaging

  8. Improving Lowland Rice (O. sativa L. cv. MR219) Plant Growth Variables, Nutrients Uptake, and Nutrients Recovery Using Crude Humic Substances.

    Science.gov (United States)

    Palanivell, Perumal; Ahmed, Osumanu Haruna; Ab Majid, Nik Muhamad; Jalloh, Mohamadu Boyie; Susilawati, Kasim

    2015-01-01

    High cation exchange capacity and organic matter content of crude humic substances from compost could be exploited to reduce ammonia loss from urea and to as well improve rice growth and soil chemical properties for efficient nutrients utilization in lowland rice cultivation. Close-dynamic air flow system was used to determine the effects of crude humic substances on ammonia volatilization. A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed with three rates of crude humic substances (20, 40, and 60 g pot(-1)). Standard procedures were used to evaluate rice plant dry matter production, nutrients uptake, nutrients recovery, and soil chemical properties. Application of crude humic substances increased ammonia volatilization. However, the lowest rate of crude humic substances (20 g pot(-1)) significantly improved total dry matter, nutrients uptake, nutrients recovery, and soil nutrients availability compared with crude humic substances (40 and 60 g pot(-1)) and the normal fertilization. Apart from improving growth of rice plants, crude humic substances can be used to ameliorate acid soils in rice cultivation. The findings of this study are being validated in our ongoing field trials.

  9. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    Science.gov (United States)

    2010-06-09

    ..., depending upon the bidding activity for the license. Equations and examples are shown in Attachment B of the.... Balancing the potential need for bidders to use withdrawals to avoid winning incomplete combinations of...

  10. P2-19: The Effect of item Repetition on Item-Context Association Depends on the Prior Exposure of Items

    Directory of Open Access Journals (Sweden)

    Hongmi Lee

    2012-10-01

    Full Text Available Previous studies have reported conflicting findings on whether item repetition has beneficial or detrimental effects on source memory. To reconcile such contradictions, we investigated whether the degree of pre-exposure of items can be a potential modulating factor. The experimental procedures spanned two consecutive days. On Day 1, participants were exposed to a set of unfamiliar faces. On Day 2, the same faces presented on the previous day were used again in half of the participants, whereas novel faces were used for the other half. Day 2 procedures consisted of three successive phases: item repetition, source association, and source memory test. In the item repetition phase, half of the face stimuli were repeatedly presented while participants were making male/female judgments. During the source association phase, both the repeated and the unrepeated faces appeared in one of the four locations on the screen. Finally, participants were tested on the location in which a given face was presented during the previous phase and reported the confidence of their memory. Source memory accuracy was measured as the percentage of correct non-guess trials. As results, we found a significant interaction between prior exposure and repetition. Repetition impaired source memory when the items had been pre-exposed on Day 1, while it led to greater accuracy in novel ones. These results show that pre-experimental exposure can modulate the effects of repetition on associative binding between an item and its contextual information, suggesting that pre-existing representation and novelty signal interact to form new episodic memory.

  11. Utilização de promotores de crescimento para frangos de corte em rações fareladas e peletizadas - DOI: 10.4025/actascianimsci.v29i2.219 Utilization of growth promoter for broiler chickens in mashed and pellets diets - DOI: 10.4025/actascianimsci.v29i2.219

    Directory of Open Access Journals (Sweden)

    Mathias Djalma Appelt

    2007-11-01

    Full Text Available Avaliou-se o efeito da suplementação de dietas com diferentes promotores de crescimento sobre o desempenho e rendimento de carcaça de frangos de corte de 1 a 42 dias de idade. Foram utilizados 576 pintos da linhagem Cobb 500, machos, alojados em cama reutilizada, distribuídos em um delineamento inteiramente casualizado, em esquema fatorial 2 x 3 (forma física da ração x diferentes promotores de crescimento, totalizando 6 tratamentos, com 6 repetições e 16 aves por unidade experimental. As características de desempenho avaliadas foram ganho de peso, peso final, consumo de ração, conversão alimentar, mortalidade e o índice de eficiência produtiva. Avaliou-se também o rendimento de carcaça, bem como rendimento em cortes, coração, fígado e gordura abdominal. Os resultados obtidos demonstram não haver efeito dos tratamentos estudados sobre as características de desempenho e rendimento de carcaça.This study evaluated the supplementation effect of diets with different growth promoters on the performance and carcass yield in broilers from 1 to 42 days of age. Five hundred seventy six broilers of the Coob 500 lineage were used, all males, lodged in reused litter, allocated according to a completely randomized design in a 2 x 3 factorial scheme (physical forms of the ration x growth promoters, totalizing 6 treatments, 6 repetitions per treatment and 16 broilers per experimental unit. The performance parameters evaluated were weight gain, final weight, feed consumption, feed conversion, mortality and index productive efficiency. The carcass yield was also evaluated, as the cuts yield and percentage of abdominal fat at 42 days. The results demonstrated no effect of the treatments studied on the performance characteristics and carcass yield.

  12. Status of liquid metal reactor development in the United States of America

    International Nuclear Information System (INIS)

    Griffith, J.D.; Horton, K.E.

    1991-01-01

    An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

  13. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira

    2007-11-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  14. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    Ahlquist, A.J.

    1981-01-01

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  15. Determination of radionuclides in discharged water from gold ...

    African Journals Online (AJOL)

    Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

  16. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions

    International Nuclear Information System (INIS)

    2007-01-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  17. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  18. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Moulin, J.

    2008-06-01

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  19. Investigation of the origin of elements of the uranium-235 family noticed in excess around the EL4 experimental nuclear reactor during its dismantling. Site of the Monts d'Arree - Brennilis (29) power plant. Years 2007-2008. Report and appendices with results

    International Nuclear Information System (INIS)

    2009-02-01

    The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods

  20. Application of solar energy to the supply of industrial process hot water: preliminary design and performance report. Volume I. Technical report. Aerotherm report TR-76-219. [For can washing at Campbell Soup Plant in Sacramento

    Energy Technology Data Exchange (ETDEWEB)

    None

    1976-10-14

    The design and performance of a solar hot water system for can washing at the Campbell Soup Plant in Sacramento, California, are presented. The collector field is located on the roof of the finished products warehouse of the Campbell Soup Sacramento plant. Water is supplied from a 3.8 cm (1/sup 1///sub 2/ in.) supply line which is located directly below an existing roof access hatch. A supply pipe will be brought up through that hatch. The water flow will then be split into two manifold lines which supply the dual rows of flat plate collectors. The preheated water from the flat plates is then passed into six sets of parallel connected concentrators. Each set consist of eight 1.83 x 3.05 m (6 x 10 foot) modules connected in series. The water from these units is gathered in a 3.8 cm (1/sup 1///sub 2/ in.) insulated pipe which transports it to the storage tank. This pipe will be attached to an existing pipe run until it reaches the can washing building. From there the pipe will follow the can washing building around to the storage tank. The storage tank is a 75,200 1 (20,000 gal) steel tank which is coated internally with a USDA approved phenolic liner. The outside of the tank is insulated. A 2.2 kw (3 hp) motor is used to pump the stored water for the tank into the can washing line. Detail drawings and descriptions of the collector field, installation, piping, controls, data acquisition equipment, and roof structure are included. Furthermore, a program schedule with equipment and manpower costs for successfully completing Phase II of this contract is included. Also included is an organization chart of the Phase II program personnel. (WHK)

  1. Petrographic atlas characterisation of aggregates regarding potential reactivity to alkalis : RILEM TC 219-ACS recommended guidance AAR-1.2, for use with the RILEM AAR-1.1 petrographic examination method

    CERN Document Server

    Ribeiro, Maria; Broekmans, Maarten; Sims, Ian

    2016-01-01

    This RILEM AAR 1.2 Atlas is complementary to the petrographic method described in RILEM AAR 1.1. It is designed and intended to assist in the identification of alkali-reactive rock types in concrete aggregate by thin-section petrography. Additional issues include: • optical thin-section petrography conforming to RILEM AAR 1.1 is considered the prime assessment method for aggregate materials, being effective regarding cost and time. Unequivocal identification of minerals in very-fine grained rock types may however require use of supplementary methods. • the atlas adheres to internationally adopted schemes for rock classification and nomenclature, as recommended in AAR 1.1. Thus, rock types are classified as igneous, sedimentary or metamorphic based upon mineral content, microstructure and texture/fabric. • in addition, the atlas identifies known alkali-reactive silica types in each rock type presented. It also identifies consistent coincidence between certain lithologies and silica types; however, it ref...

  2. RILEM recommendations for the prevention of damage by alkali-aggregate reactions in new concrete structures state-of-the-art report of the RILEM technical committee 219-ACS

    CERN Document Server

    Sims, Ian

    2016-01-01

    This book contains the full set of RILEM Recommendations which have been produced to enable engineers, specifiers and testing houses to design and produce concrete which will not suffer damage arising from alkali reactions in the concrete. There are five recommended test methods for aggregates (designated AAR-1 to AAR-5), and an overall recommendation which describes how these should be used to enable a comprehensive aggregate assessment (AAR-0). Additionally, there are two Recommended International Specifications for concrete (AAR-7.1 & 7.2) and a Preliminary International Specification for dams and other hydro structures (AAR-7.3), which describe how the aggregate assessment can be combined with other measures in the design of the concrete to produce a concrete with a minimised risk of developing damage from alkali-aggregate reactions.

  3. SU-E-T-219: Comprehensive Validation of the Electron Monte Carlo Dose Calculation Algorithm in RayStation Treatment Planning System for An Elekta Linear Accelerator with AgilityTM Treatment Head

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yi; Park, Yang-Kyun; Doppke, Karen P. [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, MA (United States)

    2015-06-15

    Purpose: This study evaluated the performance of the electron Monte Carlo dose calculation algorithm in RayStation v4.0 for an Elekta machine with Agility™ treatment head. Methods: The machine has five electron energies (6–8 MeV) and five applicators (6×6 to 25×25 cm {sup 2}). The dose (cGy/MU at d{sub max}), depth dose and profiles were measured in water using an electron diode at 100 cm SSD for nine square fields ≥2×2 cm{sup 2} and four complex fields at normal incidence, and a 14×14 cm{sup 2} field at 15° and 30° incidence. The dose was also measured for three square fields ≥4×4 cm{sup 2} at 98, 105 and 110 cm SSD. Using selected energies, the EBT3 radiochromic film was used for dose measurements in slab-shaped inhomogeneous phantoms and a breast phantom with surface curvature. The measured and calculated doses were analyzed using a gamma criterion of 3%/3 mm. Results: The calculated and measured doses varied by <3% for 116 of the 120 points, and <5% for the 4×4 cm{sup 2} field at 110 cm SSD at 9–18 MeV. The gamma analysis comparing the 105 pairs of in-water isodoses passed by >98.1%. The planar doses measured from films placed at 0.5 cm below a lung/tissue layer (12 MeV) and 1.0 cm below a bone/air layer (15 MeV) showed excellent agreement with calculations, with gamma passing by 99.9% and 98.5%, respectively. At the breast-tissue interface, the gamma passing rate is >98.8% at 12–18 MeV. The film results directly validated the accuracy of MU calculation and spatial dose distribution in presence of tissue inhomogeneity and surface curvature - situations challenging for simpler pencil-beam algorithms. Conclusion: The electron Monte Carlo algorithm in RayStation v4.0 is fully validated for clinical use for the Elekta Agility™ machine. The comprehensive validation included small fields, complex fields, oblique beams, extended distance, tissue inhomogeneity and surface curvature.

  4. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Science.gov (United States)

    2012-01-01

    Windows. To determine differences be- tween the groups and between time points, one-way analysis of variances (ANOVAs) and paired Student ’ t-tests were...Katz, “Neuropathic pain in patients with upper-extremity nerve injury,” Physiotherapy Canada, vol. 62, no. 3, pp. 190–201, 2010. Pain Research and

  5. Depaule Jean-Charles (avec la collaboration de Jean-Luc Arnaud, À travers le mur, Marseille, éditions Parenthèses, collection Eupalinos, 2014, 219 p.

    Directory of Open Access Journals (Sweden)

    Anna Madoeuf

    2014-09-01

    Full Text Available Saluons la réédition, aux éditions Parenthèses, dans la collection Eupalinos, d’À travers le mur, de Jean-Charles Depaule, ouvrage qui est tant une contribution rare et originale aux études urbaines, qu’un opus d’anthropologie sur l’espace habité, de même qu’une source de références multiples, notamment littéraires. « Rêver des lourdes portes, des passages en chicane et plus encore, peut-être des moucharabiehs perdus […] ». Cette sollicitation onirique et énigmatique, quatrième de couverture ...

  6. Ross, Robert. – A Concise History of South Africa. Cambridge, Cambridge University Press, 1999, 219 p., index, bibl. (« Cambridge Concise Histories »).

    OpenAIRE

    Creusat, Laurence

    2003-01-01

    Robert Ross, maître de conférence à l'université de Leiden, écrit et publie depuis vingt ans des ouvrages sur l'histoire de l'Afrique du Sud. Son dernier livre qui prend comme point de départ l'introduction de l'agriculture dans ce pays, il y a de cela 1 500 ans, et le conclut avec l'arrivée à la présidence de N. Mandela, est un bel exemple d'étude synthétique réussie sur l'histoire de ce pays. Le mérite de ce livre est de montrer clairement comment le passé explique le présent, commen...

  7. Comment on ;Evolution of high-pressure mafic granulites and pelitic gneisses from NE Madagascar: Tectonic implications;. Tectonophysics, 662, 219-242 (2015) by Ishwar-Kumar et al.

    Science.gov (United States)

    Goncalves, Philippe; Brandt, Sönke; Nicollet, Christian; Tucker, Robert

    2017-05-01

    Determining the possible tectonic regimes active during the Neoproterozoic is crucial for the knowledge of the evolution of the super-continent Gondwana. In Madagascar, that occupies a key position in Gondwana, there is an on-going debate regarding the location of possible suture zones and the implications in terms of paleo-geography. Recognizing high-pressure to ultra-high pressure conditions in mafic rocks is commonly viewed as a strong argument for paleo-subduction zones. Ishwar-Kumar et al. (2015) report unusual high pressure conditions (24 kbar) in Neoproterozoic to Cambrian rocks from North-Central Madagascar (Andriamena Complex). They propose a geodynamic model in which exhumation of the high pressure terranes from up to 80 km to 40 km occurred via vertical extrusion during the collision of various crustal blocks after subduction and closure of an oceanic domain during the formation of Gondwana in the late Neoproterozoic to Cambrian. We question this model and in particular the (ultra-)high pressure conditions reported, because their estimation is based on a misinterpretation of the petrography and inaccurate thermodynamic modeling for the crucial metabasite sample. The authors suggest that garnet-quartz coronas around orthopyroxene and ilmenite coexist with clinopyroxene. The postulated garnet-clinopyroxene-quartz assemblage is interpreted to document an eclogite facies overprint. However, the presence of abundant plagioclase in the sample and the lack of high jadeite content in clinopyroxene clearly refute the postulated eclogite facies conditions. According to the presented photographs clinopyroxene is part of the rock matrix. We therefore suggest that the sample represents a common two-pyroxene granulite, formed at mid- to low-pressure granulite facies conditions of > 700 °C and Madagascar, this interpretation is not justified by the data presented by Ishwar-Kumar et al. (2015).

  8. Hyperspectral surface materials map of quadrangles 3666 and 3766, Balkh (219), Mazar-e Sharif (220), Qarqin (213), and Hazara Toghai (214) quadrangles, Afghanistan, showing iron-bearing minerals and other materials

    Science.gov (United States)

    King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Johnson, Michaela R.; Giles, Stuart A.

    2013-01-01

    This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.

  9. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ] ... Length = 219 ... Query: 8 ... WNDVIGGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH 67 ... WNDVI...GGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH Sbjct: 1 ... WNDVI

  10. ORF Alignment: NC_004061 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 84 ... Query: 160 IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVI...FFKINF 219 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF Sbjct: 1 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF 60 ...

  11. ORF Alignment: NC_004311 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 70 ... Query: 219 DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 278 ... DKLKRALEAERSFTANSAHEL...RTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR Sbjct: 1 ... DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 60 ...

  12. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 219 ... Query: 38 ... RVLLFQPFTIPSASMEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI 97 ... RVLLFQPFTIPSAS...MEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI Sbjct: 1 ... RVLLFQPFTIPSASMEPNLYQGDYI

  13. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 109 ... Query: 219 ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 27...8 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA Sbjct: 1 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 60 ...

  14. 78 FR 48152 - Advisory Committee on Student Financial Assistance; Meeting

    Science.gov (United States)

    2013-08-07

    ..., 80 F Street NW., Suite 413, Washington DC 20202-7582, (202) 219- 2099. SUPPLEMENTARY INFORMATION: The... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The..., August 21, 2013 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected

  15. 75 FR 29739 - Advisory Committee on Student Financial Assistance: Hearing

    Science.gov (United States)

    2010-05-27

    ..., Capitol Place, 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. Individuals who use... (202) 219-2099 or via e-mail at [email protected] . We will attempt to meet requests after this... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The...

  16. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    International Nuclear Information System (INIS)

    P. Bernot

    2005-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  17. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  18. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  19. Radiometric determination of {sup 226}, {sup 228}Ac and {sup 40}K in fly ashes and building materials

    Energy Technology Data Exchange (ETDEWEB)

    Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science

    1996-12-31

    In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.

  20. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  1. Calculation of entropy of liquid metals using acoustic measurements in the framework of the rigid sphere model

    International Nuclear Information System (INIS)

    Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.

    2001-01-01

    For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru

  2. Journal of Naval Science. Volume 2. Number 3. July 1976

    Science.gov (United States)

    1976-07-01

    supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10

  3. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASSNQLSALPELPV Sbjct: 1 ... SETSLDLSCLGLRSLPRLPDNLDEINVSNNQLSMLPELPRALKELNASSNQLSALPELPV 60 ... Query: 180 RDDHIIRIFWLNQNRITAIPE...SILGLSSDSVVNLRENQLS 219 ... RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS Sbjct: 121 RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS 160

  4. ORF Alignment: NC_004347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available -1] ... Length = 219 ... Query: 21 ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 80 ... ... ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK Sbjct: 1 ... AA...EPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 60 ... Query: 141 YTYPTDFMDNTKITRFEAKSDAQILEMLVRGRVD

  5. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 0000004359 [Cryptosporidium hominis] ... Length = 172 ... Query: 219 DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDK...NQQDCIDINECQENSGLGPCEFGCK 278 ... DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCK Sbjct: 1 ... DIDECKEGSHSCSHICVNTR

  6. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41

  7. 'Masurium' and the 'early transuranium elements' or how discovery of nuclear fission was not clearly seen

    International Nuclear Information System (INIS)

    Keller, C.

    1988-01-01

    Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de

  8. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    International Nuclear Information System (INIS)

    Payne, T.E.

    1991-01-01

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  9. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  10. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  11. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  12. Kinetics of radioisotope exchange between brine and rock in a geothermal system

    International Nuclear Information System (INIS)

    Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku

    1988-01-01

    A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours

  13. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    Riedhauser, S.R.

    1994-06-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  14. 48 CFR 1819.7302 - NASA contract clauses.

    Science.gov (United States)

    2010-10-01

    ... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...

  15. 75 FR 55314 - Advisory Committee on Student Financial Assistance: Meeting

    Science.gov (United States)

    2010-09-10

    ... later than Monday, September 20, 2010 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION.... You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

  16. 76 FR 52943 - Advisory Committee on Student Financial Assistance: Meeting

    Science.gov (United States)

    2011-08-24

    ... later than Monday, September 5, 2011 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., Washington DC 20202-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TTY...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

  17. 76 FR 7551 - Advisory Committee on Student Financial Assistance: Hearing

    Science.gov (United States)

    2011-02-10

    ...-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TDD) may call the.... Tracy Jones at (202) 219-2099 or via email at [email protected] . We will attempt to meet...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

  18. 76 FR 44317 - Advisory Committee on Student Financial Assistance: Meeting

    Science.gov (United States)

    2011-07-25

    ... later than Monday, August 1, 2011 by contacting Ms. Tracy Jones at (202) 219-2099 or via e-mail at tracy..., 80 F Street, NW., Suite 413, Washington DC 20202-7582, (202) 219-2099. Individuals who use a...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...

  19. 77 FR 42490 - Advisory Committee on Student Financial Assistance: Meeting

    Science.gov (United States)

    2012-07-19

    ..., 80 F Street NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION: The...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration..., 2012 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected] . We...

  20. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  1. Identification of Tetrapeptides from a Mixture Based Positional Scanning Library That Can Restore nM Full Agonist Function of the L106P, I69T, I102S, A219V, C271Y, and C271R Human Melanocortin-4 Polymorphic Receptors (hMC4Rs)

    OpenAIRE

    Haslach, Erica M.; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G.; Giulianotti, Marc A.; Pinilla, Clemencia; Appel, Jon R.; Doering, Skye R.; Walters, Michael A.; Houghten, Richard A.; Haskell-Luevano, Carrie

    2014-01-01

    Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseas...

  2. Erratum: The article „Morphometric analysis of collagen and inflammatory cells in periodontal disease” [Morfometrijska analiza kolagena i inflamatornih ćelija u periodontalnoj bolesti]. Vojnosanit pregl 2015; 72(3: 219-224. (DOI:10.2298/VSP130627076G

    Directory of Open Access Journals (Sweden)

    Editorial

    2017-01-01

    Full Text Available The authors and their affiliations were listed as follows: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Listed the authors and their affiliations should read as: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; ║Department of Histology, Faculty of Medicine, University of Priština, Kosovska Mitrovica, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Link to the corrected article 10.2298/VSP130627076G

  3. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    Higgo, J.J.W.

    1987-09-01

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  4. A neutron source of variable fluence

    International Nuclear Information System (INIS)

    Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.

    1975-01-01

    The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr

  5. Calculation technique of free and impurity ion electronic structures

    International Nuclear Information System (INIS)

    Kulagin, N.A.; Sviridov, D.T.

    1986-01-01

    The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix

  6. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-09-01

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

  7. The chemistry of the actinide elements. Volume I

    International Nuclear Information System (INIS)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

  8. Development of ion beam sputtering techniques for actinide target preparation

    International Nuclear Information System (INIS)

    Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

    1985-01-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

  9. How fission was discovered

    International Nuclear Information System (INIS)

    Fluegge, S.

    1989-01-01

    After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission

  10. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

    1979-01-01

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  11. Process for radioisotope recovery and system for implementing same

    Science.gov (United States)

    Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

    2009-10-06

    A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

  12. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

    2010-01-01

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  13. Dissolved Concentration Limits of Radioactive Elements

    International Nuclear Information System (INIS)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  14. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  15. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  16. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    International Nuclear Information System (INIS)

    2006-01-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV

  19. Modélisation pluie-débit en région tropicale humide : application des réseaux de neurones sur quatre stations hydrométriques du Bandama Blanc (Bada, Marabadiassa, Tortiya et Bou situées au Nord de la Côte d'Ivoire. Thèse de l'Université de Cocody (Côte d'Ivoire, 2007, 219 p.

    Directory of Open Access Journals (Sweden)

    Yao Blaise Koffi

    2009-12-01

    Full Text Available La relation pluie-débit fait l'objet de nombreuses études, à cause de son importance dans la mise en œuvre de nombreux projets de développement. La communauté scientifique, dans le souci de faire face aux problèmes d'eau, tels que les inondations et les sècheresses, utilise différents modèles. Mais ces modèles sont généralement confrontés à la non-linéarité de la relation pluie-débit. Dans le cas du Bandama Blanc, objet de cette étude, cette non-linéarité est accentuée par la présence de plusieurs barrages à vocation agro-pastorale situés dans la partie nord de la zone d'étude et qui utilisent les eaux de ce fleuve. Ce mémoire de thèse traite donc de la modélisation des débits mensuels du Bandama Blanc, aux stations de Bada, Marabadiassa, Tortiya et Bou, à l'aide des réseaux de neurones, déjà éprouvés dans ce contexte de relation non-linéaire. Elle projette de fournir des outils plus robustes aux hydrologues africains pour la simulation et la prévision des débits des rivières jaugées. Pour atteindre cet objectif, deux Perceptrons Multicouches entraînés avec l'algorithme de la rétropropagation de l'erreur ont été construits. Le premier modèle a été utilisé seulement en simulation et le second en simulation et en prévision. Le modèle conceptuel GR2M, a été utilisé pour valider les résultats obtenus avec les réseaux de neurones. Pour cette étude, une importante base de données climatiques (pluie et température et hydrométriques (débits mensuels a été utilisée. Les résultats obtenus sont forts satisfaisants et nettement supérieurs à ceux obtenus avec le modèle conceptuel global GR2M. En effet, les réseaux de neurones parviennent à expliquer plus de 70 % de la variation des débits, avec des coefficients de corrélation de Pearson qui excèdent 0,80. Cependant ces modèles arrivent difficilement à simuler et à faire la prévision des débits extrêmes (étiages et crues, à cause probablement du nombre réduit de données à notre disposition et de la séparation des bases de calage et de validation.The rainfall-runoff relationship is the subject of many studies because of its importance in the implementation of many development projects. The scientific community, in order to cope with water problems such as floods and droughts, used different models. But these models are usually faced with the non-linearity of the rainfall-runoff relationship. In the case of the Bandama Blanc purpose of this study, this non-linearity is enhanced by the presence of several agro-pastoral dams located in the northern part of the study area and using the waters of this river. This thesis therefore deals with the modeling of flows of Bandama Blanc hydrometric stations (Bada Marabadiassa, Tortiya and Bou using neural networks already experienced in the context of non-linear relationship. It plans to provide more robust tools to African hydrologist in the simulation and forecasting of river flows. To achieve this goal, two Multilayer Perceptrons trained with the backpropagation algorithm of error have been built. The first model was used only in simulation and the second in simulation and prediction. The conceptual model GR2M was used to validate the results obtained with neural networks. An extensive database climate (rainfall and temperature and river monthly flow was used in this study. The results obtained are very satisfactory and well above those obtained with the overall conceptual model GR2M. Indeed, neural networks are able to explain more than 70% of the variation in rates, with Pearson correlation coefficients exceeding 0.80. However, these models have difficulty to simulate and predict extremes flow probably because of the reduced number of data at our disposal and separation of bases calibration and validation.

  20. 78 FR 9407 - Notice of Submission of Proposed Information Collection to OMB HOME Investment Partnerships Program

    Science.gov (United States)

    2013-02-08

    ... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... below has been submitted to the Office of Management and Budget (OMB) for review, as required by the...

  1. Interdisciplinary Workshop on the Physical-Chemical-Biological Processes Affecting Archeological Sites Held in College Station, Texas on May 27-29, 1987

    Science.gov (United States)

    1989-01-01

    8217The Nature and Status of Ethnobotany," Chronica Botanica , Vol 6, pp 219-221. Jones, Volney H. 1957. "Botany," The Identification of Non- artifactual...Chronica Botanica , Vol. 6, pp. 219-221. CULTURAL Ethnobotany, general JONES, VOLNEY H., 1957, Botany. In Taylor, W., (editor), The Identification of Non

  2. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...

  3. Prevalence of mutations and functional analyses of melanocortin 4 receptor variants identified among 750 men with juvenile-onset obesity

    DEFF Research Database (Denmark)

    Larsen, Lesli H; Echwald, Søren Morgenthaler; Sørensen, Thorkild I A

    2005-01-01

    )) for mutations in MC4R. A total of 14 different mutations were identified of which two, Ala219Val and Leu325Phe, were novel variants. The variant receptor, Leu325Phe, was unable to bind [Nle4,d-Phe7]-alphaMSH, whereas the Ala219Val variant showed a significantly impaired melanotan II induction of cAMP, compared...

  4. Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3

    International Nuclear Information System (INIS)

    McVey, C.B.

    1994-01-01

    This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms

  5. 77 FR 21161 - National Forest System Land Management Planning

    Science.gov (United States)

    2012-04-09

    ... 219 National Forest System Land Management Planning; Final Rule #0;#0;Federal Register / Vol. 77 , No... Forest Service 36 CFR Part 219 RIN 0596-AD02 National Forest System Land Management Planning AGENCY... Agriculture is adopting a new National Forest System land management planning rule (planning rule). The new...

  6. 48 CFR 1319.811-3 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... shall insert the clause 1352.219-71, Notification to Delay Performance (Deviation), in solicitations and...) Direct Award (Deviation), in direct contracts and purchase orders processed under the Partnership... 1352.219-72, Notification of Competition Limited to Eligible 8(a) Concerns, Alternate III (Deviation...

  7. AcEST: BP912238 [AcEST

    Lifescience Database Archive (English)

    Full Text Available za... 219 1e-55 tr|A6N1H0|A6N1H0_ORYSI Magnesium-protoporphyrin ix monomethyl es... 219 1e-55 tr|Q40093|Q40093_IPONI PNIL34...LAEFEPQLVY 429 Y M P++SGSVD AEFEPQLVY Sbjct: 134 AYLMPPIESGSVDFAEFEPQLVY 156 >tr|Q40093|Q40093_IPONI PNIL34

  8. 76 FR 76318 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

    Science.gov (United States)

    2011-12-07

    ... Defense Business Transformation Agency Contracting Office. PART 204--ADMINISTRATIVE MATTERS 204.402...) * * * (iii) For special notices for small business events, follow the procedures at PGI 205.207(d)(ii). PART... Economy Act order. PART 219--SMALL BUSINESS PROGRAMS 0 22. Section 219.202-1 is added to read as follows...

  9. Why Innovations in Agriculture are Necessary?

    Indian Academy of Sciences (India)

    ... of people living below poverty line (21.9%, 2011-12). Ensuring food security for increasing population and for millions of people living below poverty line (21.9%, 2011-12). Major source of livelihood (about 54.5% workers are engaged in agriculture). Major demand driver for the growth of other sectors of the economy.

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 219 of 219 ... Vol 5 (2014), Understanding the legal fundamentals of project finance contracts, Abstract PDF. Grace Chinyere Young. Vol 7 (2016), Unfair dismissal in Nigeria: Imperative for a departure from the common law, Abstract PDF. Emmanuel OC Obidimma, MI Anushiem, UMJ Ekeneme. Vol 6 (2015), United ...

  11. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    International Nuclear Information System (INIS)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-01-01

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  12. What Are the Common Treatments for Menstrual Irregularities?

    Science.gov (United States)

    ... NICHD Research Information Find a Study More Information Amenorrhea About NICHD Research Information Find a Study More ... Society for Reproductive Medicine. (2008). Current evaluation of amenorrhea. Fertility and Sterility, 90 , S219–S225. Apgar, B. S., ...

  13. A complete degradation of organophosphates by microwave-assisted hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Jansa, Petr; Čechová, Lucie; Janeba, Zlatko

    2016-01-01

    Roč. 3, č. 3 (2016), s. 219-226 ISSN 2213-3356 R&D Projects: GA MV VG20102015046 Institutional support: RVO:61388963 Keywords : organophosphates * microwave irradiation * hydrolysis Subject RIV: CC - Organic Chemistry

  14. Plant species richness-productivity relationships in a low-productive boreal region

    Czech Academy of Sciences Publication Activity Database

    Axmanová, I.; Chytrý, M.; Danihelka, Jiří; Lustyk, P.; Kočí, M.; Kubešová, S.; Horsák, M.; Cherosov, M. M.; Gogoleva, P. A.

    2013-01-01

    Roč. 214, č. 2 (2013), s. 207-219 ISSN 1385-0237 Institutional support: RVO:67985939 Keywords : competitive excluison * forest herb layer * grassland Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013

  15. Lordosis - lumbar

    Science.gov (United States)

    ... spine. Much less common causes in children include: Achondroplasia , a disorder of bone growth that causes the ... Carson BS, Rigamonti D, Ahn ES. Achondroplasia and other dwarfisms. ... PA: Elsevier Saunders; 2011:chap 219. Mistovich RJ, Spiegel ...

  16. Short communication

    African Journals Online (AJOL)

    Lincoln User

    Peer-reviewed paper: 10th World Conference on Animal Production. 219. Improving the quality of wool through the use of gene markers. T.O. Itenge. 1# .... International Wool Textile Organisation (IWTO) standards. Measurements included ...

  17. 77 FR 73516 - Federal Acquisition Regulation; Iran Threat Reduction

    Science.gov (United States)

    2012-12-10

    ... information provided. FOR FURTHER INFORMATION CONTACT: Ms. Cecelia L. Davis, Procurement Analyst, at 202-219... sector of Iran and impose sanctions with respect to transport of crude oil from Iran and evasion of...

  18. Comeniana aus dem Nachlass von Dietrich Mahnke. Die Korrespondenz zwischen Dietrich Mahnke und Dmitrij Tschižewskij aus dem Jahre 1935. Beilage: die Korrespondenz

    Czech Academy of Sciences Publication Activity Database

    Schifferová, Věra

    18/42/, - (2004), s. 219-223 ISSN 0231-5955 Institutional research plan: CEZ:AV0Z9009908 Keywords : The interpretation of Comenius * the pupils of Edmund Husserl * rationalism and mysticism Subject RIV: AA - Philosophy ; Religion

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 219 ... Vol 9, No 2 (2018), Domestic amnesty for international crimes and the ... of Nigeria's international obligations in curbing domestic violence, Abstract PDF ... Nigerian copyright laws in the age of social media, Abstract PDF.

  20. 75 FR 13253 - Plan Revision for Lake Tahoe Basin Management Unit, Alpine, El Dorado, and Placer Counties, CA...

    Science.gov (United States)

    2010-03-19

    ... approved in 1988, there have been changes in economic, social, and ecological conditions, new policies and... effect. The 2000 Planning Rule's transition provisions (36 CFR 219.35) --amended in 2002 and 2003, and...

  1. ORF Alignment: NC_003076 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DNA-binding protein ... 19) ... Length = 153 ... Query: 160 GCVKGARGASGLCISH...GGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTKSAEGKT 219 ... GC KGAR ASG CISHGGG+RCQKP C KGAE KT +CK H...GGG+RCE+LGCTK AEG T Sbjct: 2 ... GCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGST 61 ... Query: 280 K

  2. Molecular hematology

    National Research Council Canada - National Science Library

    Provan, Drew; Gribben, John

    2010-01-01

    ... The molecular basis of hemophilia, 219 Paul LF Giangrande 4 The genetics of acute myeloid leukemias, 42 Carolyn J Owen & Jude Fitzgibbon 19 The molecular basis of von Willebrand disease, 233 Luciano Baronc...

  3. Cholesterol and fat lowering with hydrophobic polysaccharide derivatives

    Czech Academy of Sciences Publication Activity Database

    Čopíková, J.; Taubner, T.; Tůma, J.; Synytsya, A.; Dušková, Dagmar; Marounek, Milan

    2015-01-01

    Roč. 116, č. 1 (2015), s. 207-214 ISSN 0144-8617 Institutional support: RVO:67985904 Keywords : hydrophobically modified polysaccharides * structure * thermal analysis Subject RIV: CE - Biochemistry Impact factor: 4.219, year: 2015

  4. Cationization of heparin for film applications

    Czech Academy of Sciences Publication Activity Database

    Šimkovic, I.; Mendichi, R.; Kelnar, Ivan; Filip, J.; Hricovíni, M.

    2015-01-01

    Roč. 115, 22 January (2015), s. 551-558 ISSN 0144-8617 Institutional support: RVO:61389013 Keywords : heparin * cationization * NMR Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.219, year: 2015

  5. Oceanographic data acquired in support of the June 1980 study of the upwelling center off Point Sur, California (NODC Accession 9000024)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Current, Temperature and Depth (CTD) data were collected by Naval Postgraduate School from Coastal Waters of California between 2-19 June, 1980 using ship...

  6. Kvartérní geologická stavba historického jádra města Brna: aplikace poznatků ze stavby kolektorů

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Zapletalová, D.; Pecka, M.; Zůbek, A.; Mroczek, P.

    2006-01-01

    Roč. 91, - (2006), s. 219-226 ISSN 1211-8796 Institutional research plan: CEZ:AV0Z30130516 Keywords : collector channels * sedimentology * micromorphology * Quaternary Subject RIV: DB - Geology ; Mineralogy

  7. Two new species of the genus Xanthoxerampellia (Orchidaceae, Maxillariinae) from Antioquia, Colombia

    Czech Academy of Sciences Publication Activity Database

    Szlachetko, D. L.; Kolanowska, Marta

    2017-01-01

    Roč. 24, - (2017), s. 199-204 ISSN 1561-882X Institutional support: RVO:86652079 Keywords : biodiversity * Maxillariinae * Neotropics * orchids * taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.219, year: 2016

  8. Fulltext PDF

    Indian Academy of Sciences (India)

    sriranga

    Page 1. 219. RESONANCE │ March 2011. GENERAL │ ARTICLE. Email for Correspondence: ionguha@gmail.com. Science Smiles. Ayan Guha. Your Honor, I have proof that this accused linkage traced that 'bone' graffiti on the painting.

  9. Septin 9 hypermethylation contributes to migration and resistance to ...

    African Journals Online (AJOL)

    radiotherapy and chemotherapy are widely used but its outcomes are ... Multiple studies have shown that septin 9 gene spanning a region of 219 kb in the genome and encoding different ... suggested a tumor-suppressor role [10]. Despite.

  10. Download this PDF file

    African Journals Online (AJOL)

    Timothy Ademakinwa

    Keywords: Incubator, Biogas, Chicken egg, Temperature, Relative humidity, Hatchability. ABSTRACT. 219 ... hatching results are obtained with normal atmospheric air, which usually ... mixture of animal manures (cow dung, poultry and swine ...

  11. N-acetyl-3,4-dihydroxy-L-phenylalanine, a second identified bioactive metabolite produced by Streptomyces sp 8812

    Czech Academy of Sciences Publication Activity Database

    Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.

    2012-01-01

    Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012

  12. Varianty Gellnerovy komedie Přístav manželství jako rozcestník jeho tvorby

    Czech Academy of Sciences Publication Activity Database

    Peisertová, Lucie

    2012-01-01

    Roč. 44, č. 2012 (2012), s. 201-219 ISSN 0231-5904 Institutional support: RVO:68378068 Keywords : Czech drama * Gellner, František * textual criticism Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Evolutionary history of tree squirrels (Rodentia, Sciurini) based on multilocus phylogeny reconstruction

    Czech Academy of Sciences Publication Activity Database

    Pečnerová, P.; Martínková, Natália

    2012-01-01

    Roč. 41, č. 3 (2012), s. 211-219 ISSN 0300-3256 Institutional research plan: CEZ:AV0Z60930519 Keywords : phylogeny * Sciurus * biogeography * colonisation Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012

  14. On Development of Medical Informatics Education via European Cooperation

    Czech Academy of Sciences Publication Activity Database

    Zvárová, Jana

    1998-01-01

    Roč. 50, - (1998), s. 219-223 ISSN 1386-5056 Keywords : information technologies * education * training * medical informatics * medical statistics * epidemiology Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.357, year: 1998

  15. Formulation and Characterization of Glutaraldehyde Cross-Linked ...

    African Journals Online (AJOL)

    ... drug/polymer ratio, volume of cross linking agent and volume of surfactant were ... The microspheres were characterized for entrapment efficiency, drug loading, ... size distribution (105 – 219 μm) and an entrapment efficiency of up to 73 %.

  16. Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP

    OpenAIRE

    Alvarez von Zerboni di Sposetti, Manuel

    2003-01-01

    Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP / von Manuel Alvarez und Stefan Wotschofsky. - 2., neubearb. und erw. Aufl. - Berlin : Erich Schmidt, 2003. - XX, 219 S. [1. Aufl. 2000

  17. 77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

    Science.gov (United States)

    2012-12-31

    ...; List of Subjects in 48 CFR Parts 201, 203, 204, 215, 219, 245, and 252 Government procurement. Manuel... clause 52.203-13, Contractor Code of Business Ethics and Conduct, is the DoD Office of Inspector General...

  18. Relationship between patient satisfactions with diabetes care and ...

    African Journals Online (AJOL)

    2013-08-05

    Aug 5, 2013 ... Bener, et al.: Patients satisfaction evaluation and management of diabetes care. 219 ... socioeconomic status (SES), females and the elderly.[5‑8] .... the subject was standing bare feet and with normal straight posture. Weight ...

  19. 49 CFR 212.223 - Operating practices compliance inspector.

    Science.gov (United States)

    2010-10-01

    ...) Control of Alcohol and Drug Use (49 CFR part 219); (3) Rear End Marking Device Regulations (49 CFR part... regulations listed in paragraph (a) of this section, including the remedial action required to bring defective...

  20. Clinical effect of Fuzheng quyu therapy in patients undergoing ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research January 2017; 16 (1): 219-224 ... cervical carcinoma surgery, thus suggesting its potential clinical applications. ..... surgery. However, further clinical investigations before it can be recommended for ...

  1. 48 CFR 1652.000 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    .... 52.222-4Contract Work Hours and Safety Standards Act—Overtime Compensation—General. 52.222... Postretirement Benefits Other Than Pensions (PRB). 52.219-8Utilization of Small, Small Disadvantaged and Women...

  2. Arbuscular mycorrhizal fungi associating with roots of Alnus and Rubus in Europe and the Middle East

    Czech Academy of Sciences Publication Activity Database

    Pölme, S.; Öpik, M.; Moora, M.; Zobel, M.; Kohout, Petr; Oja, J.; Köljalg, U.; Tedersoo, L.

    2016-01-01

    Roč. 24, Part A (2016), s. 27-34 ISSN 1754-5048 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * fungi * biogeography Subject RIV: EH - Ecology, Behaviour Impact factor: 3.219, year: 2016

  3. Alternative models of entrance exams and access to higher education: the case of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Konečný, Tomáš; Basl, J.; Mysliveček, Jan; Simonová, N.

    2012-01-01

    Roč. 63, č. 2 (2012), s. 219-235 ISSN 0018-1560 Institutional support: PRVOUK-P23 Keywords : higher education * admission exams * educational equity Subject RIV: AO - Sociology, Demography Impact factor: 0.937, year: 2012

  4. Film growth and alloy enrichment during anodizing AZ31 magnesium alloy in fluoride/glycerol electrolytes of a range of water contents

    Czech Academy of Sciences Publication Activity Database

    Němcová, A.; Galal, O.; Skeldon, P.; Kuběna, Ivo; Šmíd, Miroslav; Briand, E.; Vickridge, I.; Ganem, J.-J.; Habazaki, H.

    2016-01-01

    Roč. 219, NOV (2016), s. 28-37 ISSN 0013-4686 Institutional support: RVO:68081723 Keywords : magnesium * anodic film * enrichment Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 4.798, year: 2016

  5. Knowledge, attitude and practice of emergency contraceptives ...

    African Journals Online (AJOL)

    admin

    contraceptives among female college students in Arba Minch ... those who mentioned pills as an emergency contraceptive method, 26.4% correctly ... The summary index for knowledge disclosed that 21.9% had good knowledge about EC.

  6. Groin Exploration for the Nonpalpable Testes: A Single Center ...

    African Journals Online (AJOL)

    Laparoscopy enables the evaluation of the position, size, and the structural ... presentation, side involved, type of investigation done, mode of management ... 9 (21.9%) required admission for between 1 and 4 days (median. 3 days) either ...

  7. Setkání bulharistů - Třetí mezinárodní kongres bulharistiky

    Czech Academy of Sciences Publication Activity Database

    Havlíková, Lubomíra

    2014-01-01

    Roč. 100, č. 1 (2014), s. 219-221 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian studies * International Congresses * history * philology * Cyrillo-Methodian studies Subject RIV: AB - History

  8. South African Journal for Research in Sport, Physical Education and ...

    African Journals Online (AJOL)

    Perspective of coaches on LTAD of elite judo athletes: A comparative analysis · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Petrus L. Nolte, Cora Burnett, Wim Hollander, 219-228 ...

  9. Comparison of nasopharyngeal aspirate and nasal swab specimens for detection of respiratory syncytial virus in different settings in a developing country

    DEFF Research Database (Denmark)

    Stensballe, L G; Trautner, S; Kofoed, P-E

    2002-01-01

    detection was defined as any test being positive. RESULTS: RSV antigen was detected in 84 (13%) children, the prevalence being 19% (41/219) among infants aged 230) in older children. Sensitivity of antigen detection was higher in NPA (92...

  10. Antická dramata Jaroslava Vrchlického a jejich dobová recepce

    Czech Academy of Sciences Publication Activity Database

    Čadková, Daniela

    2013-01-01

    Roč. 136, 1-2 (2013), s. 189-219 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : J. Vrchlický * drama * National Theatre * classical tradition Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. 75 FR 18076 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2010-04-09

    ...; Chairman, Coconino (08-09-1418P). Arizona Daily Sun. County Board of Supervisors, 219 East Cherry Avenue... February 13, 2009; The Honorable Paul Biane, June 19, 2009 060270 No: B-1044). of San Bernardino February...

  12. Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

    NARCIS (Netherlands)

    Kester, Bernadette

    1998-01-01

    textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

  13. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015

  14. Longitudinal view of the psychological correlates and antecedents of subjectively assessed psychosomatic problems

    Czech Academy of Sciences Publication Activity Database

    Slezáčková, Alena; Blatný, Marek; Millová, Katarína; Jelínek, Martin

    2011-01-01

    Roč. 26, č. 2 (2011), s. 219-219 ISSN 0887-0446. [European Health Psychology Conference: Engaging with Other Health Professions: Challenges and Perspectives /25./. 20.09.2011-24.09.2011, Hersonissos, Kréta] R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : psychosomatic problems * middle adulthood * subjectively assessed health Subject RIV: AN - Psychology

  15. 78 FR 54152 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines

    Science.gov (United States)

    2013-09-03

    ... Airworthiness Directives; Rolls-Royce plc Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT...; -535C-37; -535E4-37; - 535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211-524G2-19; - 524G3-19; -524H2-19; and -524H-36 turbofan engines. This AD requires a one-time inspection of the front combustion...

  16. 78 FR 20505 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines

    Science.gov (United States)

    2013-04-05

    ... Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking...; - 535E4-37; -535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211- 524G2-19; -524G3-19; -524H2-19; and -524H-36 turbofan engines. This proposed AD was prompted by the discovery of a cracked and...

  17. Veterinary Laboratory Services Study - 1976.

    Science.gov (United States)

    1976-09-01

    years. Many tests , such as ;uman pregnancy testing , Mycobacterium tuberculosis isolation and :iers have been converted to in—vitro procedures. Sheep...assignment in laboratories and worked in chemistry , mic robiology , or diagnostic areas can be directly uti l ized with little additional orientation. They...Chorionic Gonadotropin 475 730 17 1,222 UCG or Human Pregnancy 147 42 189 Tularemia 332 332 OX—19 211 211 Salmonella 219 219 Trichinella 17 17 Venipuncture

  18. Establishment and biological characteristics of Piedmontese cattle ...

    African Journals Online (AJOL)

    use

    2011-12-12

    Dec 12, 2011 ... 2.30 ± 0.48. T. 12. 3.25 ± 0.17. T. 27. 2.19 ± 0.13. T. 13. 3.25 ± 0.29. T. 28. 2.19 ± 0.33. T. 14 .... technique has been used for many years and is still being used today, practice .... tissue culture and the nude mouse. Tissue Cell.

  19. The Enemies List: The Foreign Terrorist Organization List and Its Role in Defining Terrorism

    Science.gov (United States)

    2014-03-01

    seven days before the designation is published in the Federal Register, as section 219 of the Immigration and Nationality Act requires. Upon the...Organizations.” 38 Antiterrorism and Effective Death Penalty Act of 1996, 110 Stat. 1214 (amends § 219 of the Immigration and Nationality Act (Public Law...and the Israeli-occupied territories, Chile , Iran, and Cambodia. Table 1 reflects the list of communist FTOs designated prior to 9/11, and a

  20. Emanations and 'induced' radioactivity: from mystery to (mis)use

    International Nuclear Information System (INIS)

    Kolar, Z.I.

    1999-01-01

    The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

  1. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  2. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    Energy Technology Data Exchange (ETDEWEB)

    Segre, Nadia; Fagundes, Rosane Correa, E-mail: nadia.segre@ctmsp.mar.mil.br [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  3. Review of radionuclide source terms used for performance-assessment analyses

    International Nuclear Information System (INIS)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

  4. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

    International Nuclear Information System (INIS)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung

    2014-01-01

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex

  5. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO{sub 2} and TBP Complex

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

    2014-10-15

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO{sub 3} Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO{sub 3} Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO{sub 3} Complex.

  6. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    International Nuclear Information System (INIS)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung

    2014-01-01

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

  7. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

    2014-05-15

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.

  8. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    International Nuclear Information System (INIS)

    Shiotsuki, Masao; Miyahara, Kaname

    2003-01-01

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  9. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    International Nuclear Information System (INIS)

    Segre, Nadia; Fagundes, Rosane Correa

    2013-01-01

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  10. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

    2011-03-15

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

  11. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    International Nuclear Information System (INIS)

    Kulagin, N.A.

    2011-01-01

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.

  12. Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

    International Nuclear Information System (INIS)

    Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.

    2011-01-01

    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)

  13. Alpha-emitting nuclides in the marine environment

    Science.gov (United States)

    Pentreath, R. J.

    1984-06-01

    The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.

  14. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  15. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  16. Generalized phase diagram for the rare-earth elements: Calculations and correlations of bulk properties

    International Nuclear Information System (INIS)

    Johansson, B.; Rosengren, A.

    1975-01-01

    A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K

  17. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  18. Soil nuclide distribution coefficients and their statistical distributions

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

    1984-12-01

    Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

  19. Natural radionuclides in soils of a forest fragment of Atlantic Forest under ecological restoration process

    International Nuclear Information System (INIS)

    Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.

    2017-01-01

    The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide

  20. Natural radionuclides in soils of a forest fragment of Atlantic Forest under ecological restoration process; Radionuclídeos naturais em solos de um fragmento florestal de Mata Atlântica sob processo de restauração ecológica

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J., E-mail: biologofabiano10@gmail.com [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)

    2017-07-01

    The natural radioactive isotopes come from the radioactive series of the {sup 238}U (Uranium Series), the {sup 235}U (Actinium Series) and the {sup 232}Th (Thorium Series) series, or they can occur in isolation as is the case with the {sup 40}K. Primordial radionuclides such as {sup 40}K, {sup 232}Th, {sup 235}U and {sup 238}U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of {sup 40}K, {sup 226}Ra and {sup 228}Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of {sup 40}K, {sup 226}Ra and {sup 228}Ra were 12, 15 and 20 Bq kg{sup -1}, respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide.

  1. Isolation and characterization of a novel endoglucanase from a Bursaphelenchus xylophilus metagenomic library.

    Directory of Open Access Journals (Sweden)

    Lin Zhang

    Full Text Available A novel gene (designated as cen219 encoding endoglucanase was isolated from a Bursaphelenchus xylophilus metagenomic library by functional screening. Sequence analysis revealed that cen219 encoded a protein of 367 amino acids. SDS-PAGE analysis of purified endoglucanase suggested that Cen219 was a monomeric enzyme with a molecular mass of 40 kDa. The optimum temperature and pH for endoglucanase activity of Cen219 was separately 50 °C and 6.0. It was stable from 30 to 50 °C, and from pH 4.0 to 7.0. The activity was significantly enhanced by Mn(2+ and dramatically reduced by detergent SDS and metals Fe(3+, Cu(2+ or Hg(2+. The enzyme hydrolyzed a wide range of β-1, 3-, and β-1, 4-linked polysaccharides, with varying activities. Activities towards microcrystalline cellulose and filter paper were relatively high, while the highest activity was towards oat gum. The Km and Vmax of Cen219 towards CMC was 17.37 mg/ml and 333.33 U/mg, respectively. The findings have an insight into understanding the molecular basis of host-parasite interactions in B. xylophilus species. The properties also make Cen219 an interesting enzyme for biotechnological application.

  2. Nitrogen Dynamic Study on Rice Mutant Lines Using 15N Isotope Techniques

    International Nuclear Information System (INIS)

    Ahmad Nazrul Abd Wahid; Shyful Azizi Abdul Rahman; Abdul Rahim Harun

    2015-01-01

    Malaysian Nuclear Agency in collaboration with UPM and MARDI has produced two types of rice mutant lines of MR219, viz. MR219-4 and MR219-9 developed under rice radiation mutagenenesis programme for adaptability to aerobic conditions. Aerobic cultivating is rice cultivation system on well drained soil and using minimal water input. At Malaysian Nuclear Agency, a nitrogen fertilization study in aerobic condition for the rice mutant lines was carried out in the shade house and field. The study is intended to examine and assess the dynamics of nitrogen by rice mutant lines through the different soil water management and nitrogen levels. Direct 15 N isotopic tracer method was used in this study, whereby the 15 N labeled urea fertilizer was utilized as a tracer for nitrogen nutrient uptake by the test crops. This paper is intended to highlight the progress that has been made in the study of the nitrogen dynamics on MR219-4 and MR219-9 rice mutant lines. (author)

  3. The inhibition of IGF-1 signaling promotes proteostasis by enhancing protein aggregation and deposition.

    Science.gov (United States)

    Moll, Lorna; Ben-Gedalya, Tziona; Reuveni, Hadas; Cohen, Ehud

    2016-04-01

    The discovery that the alteration of aging by reducing the activity of the insulin/IGF-1 signaling (IIS) cascade protects nematodes and mice from neurodegeneration-linked, toxic protein aggregation (proteotoxicity) raises the prospect that IIS inhibitors bear therapeutic potential to counter neurodegenerative diseases. Recently, we reported that NT219, a highly efficient IGF-1 signaling inhibitor, protects model worms from the aggregation of amyloid β peptide and polyglutamine peptides that are linked to the manifestation of Alzheimer's and Huntington's diseases, respectively. Here, we employed cultured cell systems to investigate whether NT219 promotes protein homeostasis (proteostasis) in mammalian cells and to explore its underlying mechanisms. We found that NT219 enhances the aggregation of misfolded prion protein and promotes its deposition in quality control compartments known as "aggresomes." NT219 also elevates the levels of certain molecular chaperones but, surprisingly, reduces proteasome activity and impairs autophagy. Our findings show that IGF-1 signaling inhibitors in general and NT219 in particular can promote proteostasis in mammalian cells by hyperaggregating hazardous proteins, thereby bearing the potential to postpone the onset and slow the progression of neurodegenerative illnesses in the elderly.-Moll, L., Ben-Gedalya, T., Reuveni, H., Cohen, E. The inhibition of IGF-1 signaling promotes proteostasis by enhancing protein aggregation and deposition. © FASEB.

  4. Anomalies of Nuclear Criticality, Revision 6

    International Nuclear Information System (INIS)

    Clayton, E.D.; Prichard, Andrew W.; Durst, Bonita E.; Erickson, David; Puigh, Raymond J.

    2010-01-01

    This report is revision 6 of the Anomalies of Nuclear Criticality. This report is required reading for the training of criticality professionals in many organizations both nationally and internationally. This report describes many different classes of nuclear criticality anomalies that are different than expected. An anomaly is defined as something not in keeping with expected notions of fitness and order, a departure from the regular arrangement or general rule. In reviewing the literature and experimental data on nuclear criticality and the conditions under which a fission chain reaction can be achieved, a number of anomalies have come to light. The actinide group is composed of the fourteen elements beginning with thorium, Atomic No. 90, and ending with lawrencium, Atomic No. 103. There are about 220 known actinide isotopes, most of which are believed capable of supporting neutron chain reactions. Although every element in the actinide group has at least one isotope believed capable of supporting a chain reaction, from a practical point of view regarding the time for chemical processing, only those nuclides with half-lives more than several weeks are of obvious concern in criticality safety. Forty-six of the nuclides are known to have half-lives greater than six weeks. The selection of six weeks is somewhat arbitrary. There may well be shorter-lived nuclides of concern in criticality safety. These 46 nuclides are identified in Figure 44. Of the 46 nuclides, 4 are known and 37 are believed to be capable of supporting chain reactions, and 5 are known or believed to not support a chain reaction. Figure 44 was constructed in the format used for the Chart of the Nuclides.(1) Figure 44 also shows the distinction between fissile and fissible nuclides. The actinides derive their name from actinium (Atomic No. 89) because they tend to maintain an actinium-like electron structure as the fourteen inner electrons are added to the 5f electron shell. Actually, electrons do

  5. The Shift of the Intestinal Microbiome in the Innate Immunity-Deficient Mutant rde-1 Strain of C. elegans upon Orsay Virus Infection

    Directory of Open Access Journals (Sweden)

    Yuanyuan Guo

    2017-05-01

    Full Text Available The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host–virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 (ne219 strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 (ne219 mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 (ne219 mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.

  6. The Shift of the Intestinal Microbiome in the Innate Immunity-Deficient Mutant rde-1 Strain of C. elegans upon Orsay Virus Infection.

    Science.gov (United States)

    Guo, Yuanyuan; Xun, Zhe; Coffman, Stephanie R; Chen, Feng

    2017-01-01

    The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host-virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 ( ne219 ) strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 ( ne219 ) mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 ( ne219 ) mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.

  7. The Properties of Trilaurylmethylammonium Nitrate as an Extractant for Trivalent Actinides. RCN Report

    International Nuclear Information System (INIS)

    Ooyen, J. van

    1970-03-01

    The concept of the group of the actinide elements as a f-type transition series within the periodic system was first launched by G.T. Seaborg in 1944]. In this transition series the filling up of the 5 f electron shell would cause a close similarity with the lanthanide series. This proved to be a very fruitful hypothesis in the prediction of the properties of the new elements americium and curium that soon were discovered. The new hypothesis necessitated a shift of the accepted ideas concerning the place of the elements thorium, protactinium and uranium in the periodic table. In fact, the chemistry of these elements had never been considered to be so closely parallel to that of the lanthanides. On the contrary, the trend in the stability of the oxidation states had been interpreted to indicate that these elements would belong to group IVA, VA and VIA respectively. It is undeniable that there are marked differences in oxidation states between the lanthanide elements and the first six elements of the actinide series. However, physical and chemical investigations both of the newly discovered elements and the elements actinium to uranium disclosed many resemblances with the lanthanides that had not been noticed before in this group. The actinide elements - and more in particular the transuranium elements - have been the subject of a number of monographs covering the discovery, the synthesis, the systematics, the chemistry, and (or) the nuclear properties of these elements. It is for this reason that the scope of the following sections in this chapter will be limited to a summary of the chemistry in sofar as it is relevant to the investigations described in the following chapters, viz., the properties of the elements in aqueous systems and more in particular in those systems containing nitrate ions

  8. Complexes of groups 3,4, the lanthanides and the actinides containing neutral phophorus donor ligands

    International Nuclear Information System (INIS)

    Fryzuk, M.D.; Haddad, T.S.; Berg, D.J.

    1990-01-01

    Of relevance to this review are complexes of the early transition elements, in particular groups 3 and 4 and the lanthanides and actinides. In this review the authors have attempted to collect all the data up to the end of 1988 for complexed of groups 3 and 4, the lanthanides and the actinides that contain phosphorus donor ligands. The 1989s have seen a renaissance of the use of phosphine donors for the early d elements (groups 3 and 4) and the f elements. Neutral phosphorus donors are defined as primary (PH 2 R), secondary (PH 2 ) or tertiary phosphines (PR 3 ), including complexes of phosphine, PH 3 . Also reviewed are complexes of PF 3 and phosphites, P(OR) 3 . Specifically excluded are phosphido derivates, PR 2 . The ability of a neutral phosphorus donor to bind the metals of groups 3 and 4, the lanthanides and the actinides is now well established. While there are still no examples of lanthanum or actinium phosphine complexes, such derivatives should be accessible at least for lanthanum. series. However, there is no obvious chemical reason to suggest that such derivatives cannot be generated. The phosphine ligands that appear to generate the most stable phosphine-metal interaction are chelating phosphines such as dmpe, trmpe and trimpsi. In addition, the use of the chelate effect in conjunction with a hard ligand such as the amide in - N(SiMe 2 CH 2 PMe 2 ) 2 , or an alkoxide as found in - OC(BU t ) 2 CH 2 PMe 2 , also appears to be effective in anchoring the phosphine donor to the metal. The majority of low oxidation state derivatives of the group 4 elements are stabilized by phosphine donors in contrast with other parts of the transition series where one finds that classic π-acceptor-type ligands such as CO or RNC are utilized. 233 refs

  9. Radiological survey of the Mallinckrodt Chemical Works, St. Louis, Missouri

    International Nuclear Information System (INIS)

    Goldsmith, W.A.; Leggett, R.W.; Haywood, F.F.

    1981-12-01

    The results of a radiological survey of part of the Mallinckrodt Chemical Works (former Destrehan and Broadway Street plants), St. Louis, Missouri, are presented. During the period 1942 through 1957, this site was used for various projects involving the production of purified uranium from pitchblende concentrates. The survey included measurements of the following: residual alpha and beta-gamma contamination levels in the existing buildings that were used in the uranium projects; external gamma radiation levels at 1 m above the surface in these buildings and outdoors around these buildings; radon and radon daughter concentrations in the air in these buildings; uranium, radium, actinium, and thorium concentrations in surface and subsurface soil on the site; concentrations of radionuclides in water and sediment found in drains both inside and outside the buildings; and concentrations of radionuclides in ground and surface water on the site and in river water taken near the site. Alpha and beta-gamma contamination levels inside and outside some of the buildings were above limits set by current federal guidelines concerning the release of property for unrestricted use. Elevated external gamma radiation levels were measured at some outdoor locations and in some of the buildings. Licensable concentrations of uranium were found in soil at some places, and the concentration of uranium in a water sample taken from a core hole between Buildings 100 and 101 was in excess of limits set by current federal standards. Radon and radon daughter concentrations in three buildings were in excess of current federal guidelines for nonoccupational radiation exposure

  10. The effects of actinide separation on the radiological consequences of disposal of high-level radioactive waste on the ocean bed

    International Nuclear Information System (INIS)

    Camplin, W.C.; Grimwood, P.D.; White, I.F.

    1980-01-01

    One option in the management of high-level radioactive wastes is to separate the actinides prior to vitrification and disposal. This option is examined in the context of disposal of high-level wastes on the deep ocean bed. The initial quantity of waste corresponds to the generation of 1000 GW(e)y of nuclear energy, and the actinide-separation process is assumed to remove 99% of all elements of atomic number greater than that of actinium. The models used to describe the dispersion of activity from a single disposal site on the bed of the Atlantic Ocean represent both local dispersion and long-term mixing. Collective doses and doses to individuals are calculated for six potential pathways: ingestion of fish, crustacea, molluscs, plankton and seaweed, and external irradiation from contaminated beach sediments. The period from 400 to 1,000,000 years after disposal is considered. The potential radiological impact from disposal of high-level waste without separation of actinides on the ocean bed arises from the actinides; isotopes of americium, neptunium and plutonium give the highest doses. Actinide separation would reduce these doses in proportion to the effectiveness of the separation process, until doses become determined by fission products rather than actinides: the achievable dose reduction would be a factor of approximately a hundred, or less for certain pathways. This reduction applies only to doses to the public from waste disposal: no account was taken of doses arising from the separation process itself or from the management of the separated actinides. The results of the assessment are contrasted with those of similar studies based on toxicity indices. Major deficiencies are identified in the use of toxicity indices as a basis for decision-making. (author)

  11. Radiological survey of the Mallinckrodt Chemical Works, St. Louis, Missouri

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, W A; Leggett, R W; Haywood, F F

    1981-12-01

    The results of a radiological survey of part of the Mallinckrodt Chemical Works (former Destrehan and Broadway Street plants), St. Louis, Missouri, are presented. During the period 1942 through 1957, this site was used for various projects involving the production of purified uranium from pitchblende concentrates. The survey included measurements of the following: residual alpha and beta-gamma contamination levels in the existing buildings that were used in the uranium projects; external gamma radiation levels at 1 m above the surface in these buildings and outdoors around these buildings; radon and radon daughter concentrations in the air in these buildings; uranium, radium, actinium, and thorium concentrations in surface and subsurface soil on the site; concentrations of radionuclides in water and sediment found in drains both inside and outside the buildings; and concentrations of radionuclides in ground and surface water on the site and in river water taken near the site. Alpha and beta-gamma contamination levels inside and outside some of the buildings were above limits set by current federal guidelines concerning the release of property for unrestricted use. Elevated external gamma radiation levels were measured at some outdoor locations and in some of the buildings. Licensable concentrations of uranium were found in soil at some places, and the concentration of uranium in a water sample taken from a core hole between Buildings 100 and 101 was in excess of limits set by current federal standards. Radon and radon daughter concentrations in three buildings were in excess of current federal guidelines for nonoccupational radiation exposure.

  12. Determination of radium in water

    Energy Technology Data Exchange (ETDEWEB)

    Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

    1995-10-01

    These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).

  13. Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and Coast of Quintana Roo, Mexico

    International Nuclear Information System (INIS)

    Salas Mar, Bernardo; Martinez Negrete, Marco Antonio; Ruiz Chavarria, Gerardo; Abarca Munguia, Jose

    2008-01-01

    Full text: We describe in this paper the results obtained by the project 'Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and coast of Quintana Roo, Mexico'. The purpose of the study is to identify and quantify the natural and anthropogenic radionuclides present from sediments, sand and seawater from several sites located along the coast of the Gulf of Mexico and the Caribean Sea. The samples are analysed in a Canberra Multichannel analyzer system for gamma spectrometry, equipped with a detector of hyper pure germanium and a Genie 2000 software, in the 'Laboratory of Radiological Analysis of Environmental Samples', belonging to the Physics Department, Faculty of Sciences, National Autonomous University of Mexico (UNAM). The geographic sites were samples were taken include the states of Tamaulipas, Veracruz, Tabasco, Campeche, Yucatan and Quintana Roo. The results of this studies will be published at the end of the project and we hope they will be useful for the national health and industrial sectors. Until now we have identified and measured the presence of natural radionuclides such as Potassium-40 (K-40), Bismuth 212 (Bi-212), Lead-212 (Pb-212), Bismuth-214 (Bi-214), Lead-214 (Pb-214), Radium-226 (Ra-226), Actinium 228 (Ac-228), Uranium-235 (U-235), as well as some anthropogenic radionuclides found near the Laguna Verde Nuclear Power Plant. The project is scheduled to last for three years, finishing in 2009. At its ending we shall be able to present conclusions and identify some tendencies, in connection with the background and possible radioactive contamination of the studied zones. This project takes place under the auspice of the 'Program of Support to Projects of Research and Technological Innovation' of the National Autonomous University of Mexico. (author)

  14. Determination of radium in water

    International Nuclear Information System (INIS)

    Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

    1995-10-01

    These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)

  15. Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys

    International Nuclear Information System (INIS)

    Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.

    2006-01-01

    Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation

  16. Alpha-emitting isotopes and chromium in a coastal California aquifer

    Science.gov (United States)

    Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.

    2014-01-01

    The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238U and its daughter 234U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232Th, including its daughter 224Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ53Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development.

  17. Alpha Emitting Radionuclides and Radiopharmaceuticals for Therapy

    International Nuclear Information System (INIS)

    Chérel, Michel; Barbet, Jacques

    2013-01-01

    Today, cancer treatments mainly rely on surgery or external beam radiation to remove or destroy bulky tumors. Chemotherapy is given when tumours cannot be removed or when dissemination is suspected. However, these approaches cannot permanently treat all cancers and relapse occurs in up to 50% of the patients’ population. Radioimmunotherapy (RIT) and peptide receptor radionuclide therapy (PRRT) are effective against some disseminated and metastatic diseases, although they are rarely curative. Most preclinical and clinical developments in this field have involved electron-emitting radionuclides, particularly iodine-131, yttrium-90 and lutetium-177. The large range of the electrons emitted by these radionuclides reduces their efficacy against very small tumour cell clusters or isolated tumour cells present in residual disease and in many haematological tumours (leukaemia, myeloma). The range of alpha particles in biological tissues is very short, less than 0.1 mm, which makes alpha emitters theoretically ideal for treatment of such isolated tumour cells or micro-clusters of malignant cells. Thus, over the last decade, a growing interest for the use of alpha-emitting radionuclides has emerged. Research on targeted alpha therapy (TAT) began years ago in Nantes through cooperation between Subatech, a nuclear physics laboratory, CRCNA, a cancer research centre with a nuclear oncology team and ITU (Karlsruhe, Germany). CD138 was demonstrated as a potential target antigen for Multiple Myeloma, which is a target of huge clinical interest particularly suited for TAT because of the disseminated nature of the disease consisting primarily of isolated cells and small clusters of tumour cells mainly localized in the bone marrow. Thus anti-CD138 antibodies were labelled with bismuth-213 from actinium-225/bismuth-213 generators provided by ITU and used to target multiple myeloma cells. In vitro studies showed cell cycle arrest, synergism with chemotherapy and very little induction

  18. An aerial radiological survey of the Nevada Test Site

    International Nuclear Information System (INIS)

    Hendricks, T.J.; Riedhauser, S.R.

    1999-01-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys

  19. Radiation sources and process

    International Nuclear Information System (INIS)

    Honious, H.B.; Janzow, E.F.; Malson, H.A.; Moyer, S.E.

    1980-01-01

    The invention relates to radiation sources comprising a substrate having an electrically-conductive non-radioactive metal surface, a layer of a metal radioactive isotope of the scandium group, which in addition to scandium, yttrium, lanthanum and actinium, includes all the lanthanide and actinide series of elements, with the actinide series usually being preferred because of the nature of the radioactive isotopes therein, particularly americium-241, curium-244, plutonium-238, californium-252 and promethium-147, and a non-radioactive bonding metal codeposited on the surface by electroplating the isotope and bonding metal from an electrolytic solution, the isotope being present in the layer in minor amount as compared to the bonding metal, and with or without a non-radioactive protective metal coating covering the isotoype and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating. The invention also relates to a process for providing radiation sources comprising codepositing a layer of the metal radioactive isotope with a non-radioactive bonding metal from an electrolytic solution in which the isotope is present in minor molar amount as compared to the bonding metal such that the codeposited layer contains a minor molar amount of the isotope compared to the bonding metal by electroplating on an electrically-conductive non-radioactive metal surface of a cathode substrate, and with or without depositing a nonradioactive protective metal coating over the isotope and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating

  20. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

    2013-01-01

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  1. Multi-Energy Processing for Novel Coating Technologies

    Science.gov (United States)

    2014-12-18

    shape bounced back with increased inner flame lengths and reduced diameters. At 10.532 ^m, the length of the inner flame was the shortest, 3 mm, with a...brighter and shorter. At 10.22 ^m, the inner flame length was the shortest, 4 mm with 2 m expansion in diameter, indicating accelerated combustion...absorption rates less than 1/3 of that at 9 219 um the lame length shrank further and became brighter. With a laser irradiation at 9.219 ^m the flame

  2. Fifth international symposium on the natural radiation environment (NRE - V). Book of abstracts

    International Nuclear Information System (INIS)

    1991-01-01

    Most of the 219 contributions Are on radon (to a much lesser extent: thoron) and its daughter products in dwellings and in the environment; on corresponding measuring instruments and - methods; on measurements done; and on radiation doses to professional workers and to the public. The section heading give a fairly good account of the subject matters treated. Measurement Techniques and Metrology (Nrs 1-33); Exposure to Natural Radiation in Non-Domestic Environments (34-56); Natural Radionuclides and Transfer Pathways (57-107); Radioactivity and Radiation in the Human Environment (108-183); Health Effects of Natural Radiation (184-205); Industrially Modified Levels of Radiation Exposure (206-219). (Quittner)

  3. Monolithic Hybrid and Passive Mode-Locked 40GHz Quantum Dot Laser Diodes

    DEFF Research Database (Denmark)

    Thompson, M. G.; Larsson, David; Rae, A. R.

    2006-01-01

    For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs.......For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs....

  4. Několik poznámek k problematice ochrany duševního vlastnictví

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich

    2011-01-01

    Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf

  5. A Study of Selected Isozymes in Capsicum baccatum, Capsicum eximium, Capsicum cardenasii and Two Interspecific F1 Hybrids in Capsicum Species

    OpenAIRE

    ONUS, Ahmet Naci

    2014-01-01

    Selected isozymes were investigated in plants of Capsicum baccatum L. ( Solanaceae) accessions SA219 (P.G.Smith), Hawkes 6489 (P.G.Smith), Capsicum cardenasii Heiser and Smith accession SA268 (P.G.Smith), Capsicum eximium A.T.Hunz accession Hawkes 3860 (J.G.Hawkes) and two interspecific F1 hybrids, C. baccatum SA219 x C. eximium Hawkes 3860 and C. baccatum Hawkes 6489 x C. cardenasii SA 268. The standard technique of horizontal gel electrophoresis was employed. The gel was cut into severa...

  6. Resposta de plantas micropropagadas de abacaxizeiro à inoculação de bactérias diazotróficas em casa de vegetação Response of pineapple plantlets to inoculation with diazotrophic bacteria in greenhouse

    Directory of Open Access Journals (Sweden)

    Olmar Baller Weber

    2003-12-01

    Full Text Available O objetivo deste trabalho foi selecionar e avaliar bactérias diazotróficas isoladas de abacaxizeiro (Ananas comosus (L. Merril no desenvolvimento de cultivares micropropagadas da mesma espécie em casa de vegetação. Plantas da cultivar Perolera foram submetidas à inoculação com Asaia bogorensis (AB219 e cultivadas em tubetes, durante 145 dias, com as misturas: casca de arroz carbonizada, folha de carnaubeira triturada e vermicomposto; casca de arroz carbonizada, pó da casca do coco maduro e vermicomposto; casca de arroz carbonizada, vermiculita e vermicomposto. Plantas da cultivar Primavera receberam inóculos com o AB219 e bactérias relacionadas a Burkholderia cepacia (AB202 e AB213, enquanto plantas das cultivares Pérola e Smooth Cayenne receberam AB219 e AB213, sendo cultivadas, por 140 dias, em tubetes com a mistura de vermicomposto e vermiculita. A colonização dos abacaxizeiros pelas bactérias diazotróficas foi confirmada. As plantas da cultivar Perolera cresceram melhor em casca de arroz carbonizada, vermiculita e vermicomposto e responderam positivamente ao AB219. Já as plantas da cultivar Primavera não apresentaram resposta significativa à inoculação com AB219, AB202 e AB213. Houve incremento de 23,1% a 38,5% na matéria seca de raízes das plantas da cultivar Pérola na presença de AB213 e AB219, respectivamente. A presença de AB213 incrementou em 15,2% a matéria seca da parte aérea das plantas da cultivar Smooth Cayenne. Os resultados revelam a eficiência de bactérias diazotróficas na promoção do crescimento de abacaxizeiros.The objective of this work was to select and to evaluate isolates of diazotrophic bacteria associated to pineapple (Ananas comosus (L. Merril plants in the development of micropropagated plantlets of cultivars pineapple in greenhouse. Plantlets from the Perolera cultivar have been submitted to inoculation with Asaia bogorensis (AB219 and were cultivated during 145 days on the following

  7. Obesity and Socioeconomic Status in Children and Adolescents: United States, 2005-2008. NCHS Data Brief. Number 51

    Science.gov (United States)

    Ogden, Cynthia L.; Lamb, Molly M.; Carroll, Margaret D.; Flegal, Katherine M.

    2010-01-01

    In 2007-2008 almost 17% of children and adolescents aged 2-19 years were obese. Childhood obesity often tracks to adulthood and, in the short run, childhood obesity can lead to psychosocial problems and cardiovascular risk factors such as high blood pressure, high cholesterol, and abnormal glucose tolerance or diabetes. Studies have suggested that…

  8. 48 CFR 570.601 - FAR provisions and clauses.

    Science.gov (United States)

    2010-10-01

    ... Business Participation Program—Targets.52.219-25Small Disadvantaged Business Participation Program...-24Preaward On-Site Equal Opportunity Compliance Review. (i) you require cost or pricing data for work or services exceeding $500,000 52.215-10Price Reduction for Defective Cost or Pricing Data.52.215...

  9. 78 FR 70012 - Lake Tahoe Basin Management Unit, California, Land Management Plan Revision

    Science.gov (United States)

    2013-11-22

    ... 60 days after the date of publication of the legal notice in the Sacramento Bee, Sacramento, CA (36... 60 days after the date of publication of the legal notice in the Sacramento Bee, Sacramento, CA (36..., Sacramento, CA (36 CFR 219.56). The written notice of objection must be submitted to the Chief of the Forest...

  10. A simulation analysis of an extension of one-dimensional speckle correlation method for detection of general in-plane translation

    Czech Academy of Sciences Publication Activity Database

    Hamarová, Ivana; Šmíd, Petr; Horváth, P.; Hrabovský, M.

    2014-01-01

    Roč. 2014, č. 1 (2014), "704368-1"-"704368-12" ISSN 1537-744X R&D Projects: GA ČR GA13-12301S Institutional support: RVO:68378271 Keywords : one-dimensional speckle correlation * speckle * general In-plane translation Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.219, year: 2013

  11. Effect of information and communication technology on culture of the ...

    African Journals Online (AJOL)

    Effect of information and communication technology on culture of the people of Saki west local government area of Oyo State, Nigeria. PO Eniola, Mf Siyanbola, OA Olaniyi. Abstract. No Abstract. International Journal of Tropical Agriculture and Food Systems Vol. 1 (3) 2007: pp. 214-219. Full Text: EMAIL FULL TEXT EMAIL ...

  12. Placenta accreta in Aba, South Eastern Nigeria | Umezurike ...

    African Journals Online (AJOL)

    No Abstract. Nigerian Journal of Medicine Vol. 16 (3) 2007: pp.219-222. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  13. 7 CFR 1767.19 - Liabilities and other credits.

    Science.gov (United States)

    2010-01-01

    ... this section shall be used by all RUS borrowers. Liabilities and Other Credits Margins and Equities... Income Taxes—Other Liabilities and Other Credits Margins and Equities 200Memberships A. This account... conformance with the bylaws of the cooperative. 219Other Margins and Equities A. This account shall include...

  14. Crack closure in near-threshold fatigue crack propagation in railway axle steel EA4T

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Pavel; Vojtek, Tomáš; Náhlík, Luboš; Hutař, Pavel

    2017-01-01

    Roč. 185, NOV (2017), s. 2-19 ISSN 0013-7944 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Fatigue crack propagation * crack closure * EA4T * Railway axle Subject RIV: JL - Materials Fatigue, Friction Mechanics OBOR OECD: Audio engineering , reliability analysis Impact factor: 2.151, year: 2016

  15. Analysis of major histocompatibility complex class II gene in water voles using capillary electrophoresis-single stranded conformation polymorphism

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Galan, M.; Charbonnel, N.; Cosson, J.-F.

    2005-01-01

    Roč. 5, č. 1 (2005), s. 173-176 ISSN 1471-8278 Institutional research plan: CEZ:AV0Z6093917 Keywords : water vole * population genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.219, year: 2005

  16. Application of compact finite-difference schemes to simulations of stably stratified fluid flows

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš; Beneš, L.; Fraunie, P.; Kozel, Karel

    2012-01-01

    Roč. 219, č. 7 (2012), s. 3336-3353 ISSN 0096-3003 Institutional support: RVO:61388998 Keywords : stratification * finite- difference * finite-volume * Runge-Kutta Subject RIV: BA - General Mathematics Impact factor: 1.349, year: 2012 http://www.sciencedirect.com/science/article/pii/S0096300311010988

  17. New floristic records in the Balkans: 3

    DEFF Research Database (Denmark)

    2006-01-01

    ), Euphorbiaceae (41-43, 77), Fabaceae (7, 8, 44, 45, 89, 90, 110, 111, 120, 121, 129, 164-168, 218, 219), Fagaceae (78, 79), Fumariaceae (80), Gentianaceae (169), Geraniaceae (46, 47, 170, 171, 220), Grossulariaceae (236), Guttiferae (9, 112, 172), Iridaceae (65, 66, 85), Juncaceae (240), Lamiaceae (10, 48-51, 81...

  18. Study of the nickel-fullerene nano-structured thin films

    Czech Academy of Sciences Publication Activity Database

    Vacík, Jiří; Naramoto, H.; Narumi, K.; Yamamoto, S.; Abe, H.

    2004-01-01

    Roč. 219, č. 20 (2004), s. 862-866 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nickel * fullerene * magnesium oxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.997, year: 2004

  19. Healthy first-degree relatives of patients with type 1 dabetes exhibit significant differences in basal gene expression pattern of immunocompetent cells compared to controls: expression pattern as predeterminant of autoimmune diabetes

    Czech Academy of Sciences Publication Activity Database

    Štechová, K.; Kolář, Michal; Blatný, R.; Halbhuber, Z.; Včeláková, J.; Hubáčková, M.; Petruželková, L.; Sumnik, Z.; Obermannová, B.; Pithová, P.; Staviková, V.; Krivjanská, M.; Neuwirth, Aleš; Kalousková, S.; Filipp, Dominik

    2012-01-01

    Roč. 75, č. 2 (2012), s. 210-219 ISSN 0300-9475 R&D Projects: GA MŠk 2B08066 Institutional research plan: CEZ:AV0Z50520514 Keywords : type 1 diabetes * microarray analysis * pathogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.199, year: 2012

  20. Investigating the environmental adaptability of promising subtropical ...

    African Journals Online (AJOL)

    Trees were assessed for frost sensitivity at 15 months, and height and basal area at 48 months. Eucalyptus longirostrata, E. pilularis, Corymbia citriodora subsp. citriodora, C. henryi and C. maculata, species that performed well in forerunner ICFR coastal Zululand site-species trials (MAT range 21.7–21.9°C), generally ...