WorldWideScience

Sample records for actinium 217

  1. Synthesis and Characterization of the Actinium Aquo Ion

    OpenAIRE

    Maryline G. Ferrier; Benjamin W. Stein; Enrique R. Batista; John M. Berg; Eva R. Birnbaum; Jonathan W. Engle; Kevin D. John; Stosh A. Kozimor; Juan S. Lezama Pacheco; Lindsay N. Redman

    2017-01-01

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H2O) x 3+) is critical for current ef...

  2. Synthesis and Characterization of the Actinium Aquo Ion.

    Science.gov (United States)

    Ferrier, Maryline G; Stein, Benjamin W; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Engle, Jonathan W; John, Kevin D; Kozimor, Stosh A; Lezama Pacheco, Juan S; Redman, Lindsay N

    2017-03-22

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H 2 O) x 3+ ) is critical for current efforts to develop 225 Ac [ t 1/2 = 10.0(1) d] as a targeted anticancer therapeutic agent. However, given the limited amount of actinium available for study and its high radioactivity, many aspects of actinium chemistry remain poorly defined. We overcame these challenges using the longer-lived 227 Ac [ t 1/2 = 21.772(3) y] isotope and report the first characterization of this fundamentally important Ac-aquo coordination complex. Our X-ray absorption fine structure study revealed 10.9 ± 0.5 water molecules directly coordinated to the Ac III cation with an Ac-O H2O distance of 2.63(1) Å. This experimentally determined distance was consistent with molecular dynamics density functional theory results that showed (over the course of 8 ps) that Ac III was coordinated by 9 water molecules with Ac-O H2O distances ranging from 2.61 to 2.76 Å. The data is presented in the context of other actinide(III) and lanthanide(III) aquo ions characterized by XAFS and highlights the uniqueness of the large Ac III coordination numbers and long Ac-O H2O bond distances.

  3. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  4. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  5. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  6. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  7. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  9. LaPO4 Nanoparticles Doped with Actinium-225 that Partially Sequester Daughter Radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Woodward, Jonathan [ORNL; Kennel, Steve J [ORNL; Stucnkey, Alan [University of Tennessee, Knoxville (UTK); Osborne, Dustin [University of Tennessee, Knoxville (UTK); Wall, Jonathan [University of Tennessee, Knoxville (UTK); Rondinone, Adam Justin [ORNL; Standaert, Robert F [ORNL; Mirzadeh, Saed [ORNL

    2011-01-01

    Nanoscale materials have been envisioned as carriers for various therapeutic drugs, including radioisotopes. Inorganic nanoparticles (NPs) are particularly appealing vehicles for targeted radiotherapy because they can package several radioactive atoms into a single carrier and can potentially retain daughter radioisotopes produced by in vivo generators such as actinium -225 (225Ac, t1/2=10 d). Decay of this radioisotope to stable bismuth-209 proceeds through a chain of short-lived daughters accompanied by the emission of four -particles that release >27 MeV of energy. The challenge in realizing the enhanced cytotoxic potential of in vivo generators lies in retaining the daughter nuclei at the therapy site. When 225Ac is attached to targeting agents via standard chelate conjugation methods, all of the daughter radionuclides are released after the initial -decay occurs. In this work, 225Ac was incorporated into lanthanum phosphate NPs to determine whether the radioisotope and its daughters would be retained within the dense mineral lattice. Further, the 225Ac-doped NPs were conjugated to the monoclonal antibody mAb 201B, which targets mouse lung endothelium through the vasculature, to ascertain the targeting efficacy and in vivo retention of radioisotopes. Standard biodistribution techniques and microSPECT/CT imaging of 225Ac as well as the daughter radioisotopes showed that the NPs accumulated rapidly in mouse lung after intravenous injection. By showing that excess, competing, uncoupled antibodies or NPs coupled to control mAbs are deposited primarily in the liver and spleen, specific targeting of NP-mAb 201B conjugates was demonstrated. Biodistribution analysis showed that ~30% of the total injected dose of La(225Ac)PO4 NPs accumulated in mouse lungs 1 h post-injection yielding a value of % ID/g >200. Furthermore, after 24 h, 80% of the 213Bi daughter produced from 225Ac decay was retained within the target organ and 213Bi retention increased to ~87% at 120 h. In

  10. 20 CFR 217.16 - Filing date.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Filing date. 217.16 Section 217.16 Employees... LUMP SUM Filing An Application § 217.16 Filing date. An application filed in a manner and form acceptable to the Board is officially filed with the Board on the earliest of the following dates: (a) On the...

  11. 29 CFR 780.217 - Forestry activities.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Forestry activities. 780.217 Section 780.217 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... as It Relates to Specific Situations Hatchery Operations § 780.217 Forestry activities. Operations in...

  12. 14 CFR 217.7 - Certification.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Certification. 217.7 Section 217.7 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... NONSCHEDULED SERVICES § 217.7 Certification. The certification for BTS Form 41 Schedule T-100(f) shall be...

  13. 48 CFR 252.217-7006 - Title.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Title. 252.217-7006... Clauses 252.217-7006 Title. As prescribed in 217.7104(a), use the following clause: Title (DEC 1991) (a) Unless otherwise provided, title to all materials and equipment to be incorporated in a vessel in the...

  14. 49 CFR 229.217 - Fuel tank.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fuel tank. 229.217 Section 229.217 Transportation... TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Locomotive Crashworthiness Design Requirements § 229.217 Fuel tank. (a) External fuel tanks. Locomotives equipped with external fuel tanks shall, at a minimum...

  15. 48 CFR 252.217-7010 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items of...

  16. 49 CFR 238.217 - Side structure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Side structure. 238.217 Section 238.217 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.217 Side structure. Each passenger car shall comply with the following: (a) Side posts and...

  17. 40 CFR 21.7 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false 21.7 Section 21.7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.7 Comment: Applications for a statement resulting from a requirement to control pollution from non-point sources as identified in section...

  18. 22 CFR 217.23 - New construction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...

  19. Nuclear Data Sheets for A=217

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F. G.; McCutchan, E. A.; Singh, B.; Banerjee, K.; Bhattacharya, S.; Chakraborty, A.; Garg, S.; Jovancevic, N.; Kumar, S.; Rathi, S. K.; Roy, T.; Lee, J.; Shearman, R.

    2018-01-01

    The evaluated spectroscopic data are presented for 12 known nuclides with A=217 (Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa, U). For Tl-217, Pb-217, Pa-217, and U-217 nuclei, only information on the ground state is available. Levels in Bi-217 are known only from isomer decay following fragmentation reaction and those in At-217 and Rn-217 only from the a decay of Fr-221 and Ra-221, respectively. High spin levels in Ra-217 are mainly from 1987SuZY and 2011MuZZ which are a lab report and thesis, respectively. Due to differences between these studies, further experimental study is needed to firmly establish the level scheme.This evaluation was carried out as part of a joint IAEA-ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, Aug 22 to Sept 2 2016. The evaluation work was coordinated by E.A. McCutchan (BNL). This work supersedes the previous previous A=217 evaluation (2003Ak06) by Y.A. Akovali.

  20. 14 CFR 145.217 - Contract maintenance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to an...

  1. 22 CFR 217.61 - Procedures.

    Science.gov (United States)

    2010-04-01

    ... applicable to title VI of the Civil Rights Act of 1964 apply to this part. These procedures are found in... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procedures. 217.61 Section 217.61 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR...

  2. 48 CFR 1252.217-77 - Title.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Title. 1252.217-77 Section... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-77 Title. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Title (OCT 1994) (a) Unless otherwise...

  3. 48 CFR 1252.217-72 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1252.217-72... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon...

  4. 27 CFR 24.217 - Vinegar stock.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Vinegar stock. 24.217... OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.217 Vinegar stock. Vinegar stock may be produced on bonded wine premises with the addition of any quantity of water desired to meet...

  5. 40 CFR 86.217-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  6. 48 CFR 217.170 - General.

    Science.gov (United States)

    2010-10-01

    ... order quantity procurement in excess of $20 million in any one year (see 217.174(a)(1)); (iii) Employ an... quantity procurement in excess of $20 million in any one year (see 217.174(a)(2)); or (v) Include a... (Acquisition, Technology, and Logistics) (OUSD(AT&L)DPAP), and to the Deputy Under Secretary of Defense...

  7. 36 CFR 21.7 - Health examinations.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Health examinations. 21.7... SPRINGS NATIONAL PARK; BATHHOUSE REGULATIONS § 21.7 Health examinations. No employee who comes in direct... health examination, or remain in such employment without undergoing periodic health examinations, as...

  8. 31 CFR 800.217 - Hold.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Hold. 800.217 Section 800.217 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY...

  9. 14 CFR 217.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS REPORTING TRAFFIC STATISTICS BY FOREIGN AIR CARRIERS IN CIVILIAN SCHEDULED, CHARTER, AND... carriers; and an infant who does not occupy a seat. (This definition is for 14 CFR part 217 traffic...) Persons injured in aircraft accidents, and physicians, nurses, and others attending such persons; (6) Any...

  10. 14 CFR 120.217 - Tests required.

    Science.gov (United States)

    2010-01-01

    ... or to obtain necessary emergency medical care. (c) Random alcohol testing. (1) Except as provided in... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Alcohol Testing Program Requirements § 120.217 Tests required. (a) Pre-employment alcohol testing. As an...

  11. 25 CFR 217.6 - Method of casting votes.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Method of casting votes. 217.6 Section 217.6 Indians.... § 217.6 Method of casting votes. Within 30 days after an issue and any analysis provided for in §§ 217.4... superintendent in writing of the number of votes cast for and against the proposed or alternative solutions. If...

  12. 49 CFR 199.217 - On-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false On-duty use. 199.217 Section 199.217 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.217 On-duty use. Each operator shall prohibit a covered employee from using alcohol...

  13. 48 CFR 217.7404-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 217.7404-2 Section 217.7404-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contract Actions 217.7404-2 Price ceiling. UCAs shall include a not-to-exceed price. ...

  14. 22 CFR 217.9 - Administrative requirements for small recipients.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administrative requirements for small recipients. 217.9 Section 217.9 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON... recipient with fewer than fifteen employees, or any class of such recipients, to comply with §§ 217.7 and...

  15. 48 CFR 217.7103-4 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Emergency work. 217.7103-4 Section 217.7103-4 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Repair and Alteration of Vessels 217.7103-4 Emergency work. (a) The contracting officer, without...

  16. 12 CFR 741.217 - Truth in savings.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Truth in savings. 741.217 Section 741.217 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS REQUIREMENTS FOR... Also Apply to Federally Insured State-Chartered Credit Unions § 741.217 Truth in savings. Any credit...

  17. 49 CFR 234.217 - Flashing light units.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units. 234.217 Section 234.217..., Inspection, and Testing Maintenance Standards § 234.217 Flashing light units. (a) Each flashing light unit.... (b) Each flashing light unit shall be maintained to prevent dust and moisture from entering the...

  18. 48 CFR 252.217-7001 - Surge option.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surge option. 252.217-7001... Clauses 252.217-7001 Surge option. As prescribed in 217.208-70(b), use the following clause: Surge Option... established by negotiation as provided in this clause. (b) Schedule. (1) When the Production Surge Plan (DI...

  19. The Emerging Role of Zfp217 in Adipogenesis

    Directory of Open Access Journals (Sweden)

    Hong Xiang

    2017-06-01

    Full Text Available Zinc finger protein 217 (Zfp217, a member of the krüppel-type zinc finger protein family, plays diverse roles in cell differentiation and development of mammals. Despite extensive research on the functions of Zfp217 in cancer, pluripotency and reprogramming, its physiological roles in adipogenesis remain unknown. Our previous RNA sequencing data suggest the involvement of Zfp217 in adipogenesis. In this study, the potential function of Zfp217 in adipogenesis was investigated through bioinformatics analysis and a series of experiments. The expression of Zfp217 was found to be gradually upregulated during the adipogenic differentiation in C3H10T1/2 cells, which was consistent with that of the adipogenic marker gene Pparg2. Furthermore, there was a positive, significant relationship between Zfp217 expression and adipocyte differentiation. It was also observed that Zfp217 could not only trigger proliferative defect in C3H10T1/2 cells, but also interact with Ezh2 and suppress the downstream target genes of Ezh2. Besides, three microRNAs (miR-503-5p, miR-135a-5p and miR-19a-3p which target Zfp217 were found to suppress the process of adipogenesis. This is the first report showing that Zfp217 has the capacity to regulate adipogenesis.

  20. 29 CFR 1952.217 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Changes to approved plans. 1952.217 Section 1952.217 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... plans. (a) Legislation. (1) On March 29, 1994, the Assistant Secretary approved Maryland's revised...

  1. 48 CFR 3052.217-96 - Title (USCG).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Title (USCG). 3052.217-96... of Provisions and Clauses 3052.217-96 Title (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Title (DEC 2003) (a) Unless otherwise provided...

  2. 48 CFR 217.7506 - Spare parts breakout program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Spare parts breakout... Acquisition of Replenishment Parts 217.7506 Spare parts breakout program. See PGI 217.7506 and DoD 4140.1-R, DoD Supply Chain Materiel Management Regulation, Chapter 8, Section C8.3, for spare parts breakout...

  3. 20 CFR 217.10 - Application filed after death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter. The...

  4. 20 CFR 217.17 - Who may sign an application.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Who may sign an application. 217.17 Section... APPLICATION FOR ANNUITY OR LUMP SUM Filing An Application § 217.17 Who may sign an application. An application... (able to handle his or her own affairs), and physically able to sign the application, must sign in his...

  5. 40 CFR 98.217 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.217... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Miscellaneous Uses of Carbonate § 98.217 Records that must be retained. In addition to the records required by § 98.3(g), you must retain the records specified in...

  6. 22 CFR 217.42 - Admissions and recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Admissions and recruitment. 217.42 Section 217... Admissions and recruitment. (a) General. Qualified handicapped persons may not, on the basis of handicap, be denied admission or be subjected to discrimination in admission or recruitment by a recipient to which...

  7. 31 CFR 0.217 - Personal financial interests.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Personal financial interests. 0.217... TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.217 Personal financial interests. (a) Employees may... affect the integrity of an employee's service. ...

  8. 49 CFR 1542.217 - Law enforcement personnel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1542.217 Section 1542... ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.217 Law enforcement personnel. (a) Each airport operator must ensure that law enforcement personnel used...

  9. 30 CFR 217.301 - Lease account reconciliations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliations. 217.301 Section... MANAGEMENT AUDITS AND INSPECTIONS Geothermal Resources § 217.301 Lease account reconciliations. Specific lease account reconciliations will be performed with priority being given to reconciling those lease...

  10. 30 CFR 217.51 - Lease account reconciliation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliation. 217.51 Section... MANAGEMENT AUDITS AND INSPECTIONS Oil and Gas, General § 217.51 Lease account reconciliation. Specific lease account reconciliations shall be performed with priority being given to reconciling those lease accounts...

  11. Isomeric decay spectroscopy of the Bi217 isotope

    Science.gov (United States)

    Gottardo, A.; Valiente-Dobón, J. J.; Benzoni, G.; Lunardi, S.; Gadea, A.; Algora, A.; Al-Dahan, N.; de Angelis, G.; Ayyad, Y.; Bazzacco, D.; Benlliure, J.; Boutachkov, P.; Bowry, M.; Bracco, A.; Bruce, A. M.; Bunce, M.; Camera, F.; Casarejos, E.; Cortes, M. L.; Crespi, F. C. L.; Corsi, A.; Denis Bacelar, A. M.; Deo, A. Y.; Domingo-Pardo, C.; Doncel, M.; Engert, T.; Eppinger, K.; Farrelly, G. F.; Farinon, F.; Farnea, E.; Geissel, H.; Gerl, J.; Goel, N.; Górska, M.; Grebosz, J.; Gregor, E.; Habermann, T.; Hoischen, R.; Janik, R.; John, P. R.; Klupp, S.; Kojouharov, I.; Kurz, N.; Lenzi, S. M.; Leoni, S.; Mandal, S.; Menegazzo, R.; Mengoni, D.; Million, B.; Modamio, V.; Morales, A. I.; Napoli, D. R.; Naqvi, F.; Nicolini, R.; Nociforo, C.; Pfützner, M.; Pietri, S.; Podolyák, Zs.; Prochazka, A.; Prokopowicz, W.; Recchia, F.; Regan, P. H.; Reed, M. W.; Rudolph, D.; Sahin, E.; Schaffner, H.; Sharma, A.; Sitar, B.; Siwal, D.; Steiger, K.; Strmen, P.; Swan, T. P. D.; Szarka, I.; Ur, C. A.; Walker, P. M.; Weick, H.; Wieland, O.; Wollersheim, H.-J.

    2014-09-01

    The structure of the neutron-rich bismuth isotope Bi217 has been studied for the first time. The fragmentation of a primary U238 beam at the FRS-RISING setup at GSI was exploited to perform γ-decay spectroscopy, since μs isomeric states were expected in this nucleus. Gamma rays following the decay of a t1/2=3 μs isomer were observed, allowing one to establish the low-lying structure of Bi217. The level energies and the reduced electric quadrupole transition probability B (E2) from the isomeric state are compared to large-scale shell-model calculations.

  12. Identification of genes directly regulated by the oncogene ZNF217using ChIP-chip assays.

    Energy Technology Data Exchange (ETDEWEB)

    Krig, S.R.; Jin, V.X.; Bieda, M.C.; O' geen, H.; Yaswen, P.; Green, R.; Farnham, P.J.

    2007-01-26

    It has been proposed that ZNF217, which is amplified at 20q13 in various tumors, plays a key role during neoplastic transformation. ZNF217 has been purified in complexes that contain repressor proteins such as CtBP2, suggesting that it acts as a transcriptional repressor. However, the function of ZNF217 has not been well characterized due to a lack of known target genes. Using a global chromatin immunoprecipitation (ChIP)-chip approach, we identified thousands of ZNF217 binding sites in three tumor cell lines (MCF7, SW480, and Ntera2). Further analysis of ZNF217 in Ntera2 cells showed that many promoters are bound by ZNF217 and CtBP2 and that a subset of these promoters are activated upon removal of ZNF217. Thus, our in vivo studies corroborate the in vitro biochemical analyses of ZNF217-containing complexes and support the hypothesis that ZNF217 functions as a transcriptional repressor. Gene ontology analysis showed that ZNF217 targets in Ntera2 cells are involved in organ development, suggesting that one function of ZNF217 may be to repress differentiation. Accordingly we show that differentiation of Ntera2 cells with retinoic acid led to down-regulation of ZNF217. Our identification of thousands of ZNF217 target genes will enable further studies of the consequences of aberrant expression of ZNF217 during neoplastic transformation.

  13. 27 CFR 9.217 - Happy Canyon of Santa Barbara.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Happy Canyon of Santa... Areas § 9.217 Happy Canyon of Santa Barbara. (a) Name. The name of the viticultural area described in this section is “Happy Canyon of Santa Barbara”. For purposes of part 4 of this chapter, “Happy Canyon...

  14. 36 CFR 2.17 - Aircraft and air delivery.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Aircraft and air delivery. 2... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.17 Aircraft and air delivery. (a) The following are prohibited: (1) Operating or using aircraft on lands or waters other than at locations designated pursuant to...

  15. 31 CFR 31.217 - Confidentiality of information.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Confidentiality of information. 31... RELIEF PROGRAM Conflicts of Interest § 31.217 Confidentiality of information. (a) Nonpublic information... shall take appropriate measures to ensure the confidentiality of nonpublic information and to prevent...

  16. 37 CFR 2.17 - Recognition for representation.

    Science.gov (United States)

    2010-07-01

    ... or in good standing with the Canadian Intellectual Property Office, but not registered as a patent..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized Persons § 2.17 Recognition for representation. (a) Authority to practice in trademark cases. Only an...

  17. 8 CFR 217.7 - Electronic data transmission requirement.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Electronic data transmission requirement... VISA WAIVER PROGRAM § 217.7 Electronic data transmission requirement. (a) An alien who applies for... manifest data relative to that alien passenger in accordance with 19 CFR 4.7b or 19 CFR 122.49a. Upon...

  18. 20 CFR 702.217 - Penalty for false statement, misrepresentation.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Penalty for false statement... PROCEDURE Claims Procedures Notice § 702.217 Penalty for false statement, misrepresentation. (a) Any..., or his dependents pursuant to section 9, 33 U.S.C. 909, if the injury results in death, shall be...

  19. 14 CFR 217.5 - Data collected (data elements).

    Science.gov (United States)

    2010-01-01

    .... This code represents the industry designator as described in the appendix to § 217.10 of this part. A common private industry source of these industry designator codes is the Official Airline Guides (OAG... reporting the data. The carrier code is assigned by DOT. The Office of Airline Information (OAI'S) will...

  20. Zinc finger gene 217 (ZNF217) Promoted Ovarian Hyperstimulation Syndrome (OHSS) through Regulating E2 Synthesis and Inhibiting Thrombospondin-1 (TSP-1).

    Science.gov (United States)

    Zhai, Junyu; Liu, Jiansheng; Cheng, Xiaoyue; Li, Shang; Hong, Yan; Sun, Kang; Chen, Zi-Jiang; Du, Yanzhi; Li, Weiping

    2017-06-12

    Zinc finger gene 217 (ZNF217) is a candidate gene of polycystic ovary syndrome (PCOS) which is vulnerable to ovarian hyperstimulation syndrome (OHSS). However, the relationship between ZNF217 and OHSS is largely unknown. Our study demonstrated that ZNF217 was mainly distributed in the granulosa cells of rat ovary. Significantly higher expression of ovarian ZNF217 was detected in OHSS rats, being consistent with serum 17β-estradiol concentration and ovarian aromatase. Moreover, OHSS rats also showed decreased ovarian TSP-1 mRNA, an acknowledged VEGF signaling suppressor. The same changes were detected in human granulosa cells and follicular fluid. Thus, the increased ZNF217 and decreased TSP-1 may participate in OHSS onset. In vitro experiment revealed that ZNF217 positively regulated E2 synthesis through promoting cAMP response element binding protein (CREB) and thereby CYP19A1 in KGN cells. Furthermore, ZNF217 negatively regulated TSP-1 in KGN cells while TSP-1 promoted claudin1 and inhibited nitric oxide (NO) in HUVECs and HAECs. Both of claudin1 and NO are responsible for the regulation of vascular permeability (VP). Therefore, we demonstrated that ZNF217 contributed to OHSS onset through promoting E2 synthesis and the increase of VP. Moreover, the increased ZNF217 and decreased TSP-1 provided new targets for the prevention or treatment of OHSS in the future.

  1. Dust Plasma Analogue for Interstellar 217.5 nm Extinction

    Directory of Open Access Journals (Sweden)

    Stefanović, I.

    2008-12-01

    Full Text Available The new ultraviolet (UV extinction measurements of carbonaceous nanoparticles in the range from 140 nm to 260 nm are presented. The plasma polymerized hydrocarbon nanoparticles were already proposed as a new astro analogue, which describe the infrared (IR extinction spectra in an excellent way. We use the same particles to find the possible carrier of the "mysterious" UV 217.5 nm extinction "bump" of interstellar media (ISM.

  2. 14 CFR 21.7 - Continued airworthiness and safety improvements for transport category airplanes.

    Science.gov (United States)

    2010-01-01

    ... improvements for transport category airplanes. 21.7 Section 21.7 Aeronautics and Space FEDERAL AVIATION... § 21.7 Continued airworthiness and safety improvements for transport category airplanes. (a) On or... subchapter. (b) For new transport category airplanes manufactured under the authority of the FAA, the holder...

  3. 20 CFR 725.217 - Determination of dependency; surviving divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; surviving divorced spouse. 725.217 Section 725.217 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.217 Determination of dependency; surviving divorced spouse. An individual who is the miner...

  4. ZNF217 is associated with poor prognosis and enhances proliferation and metastasis in ovarian cancer.

    Science.gov (United States)

    Li, Jing; Song, Lanlin; Qiu, Yuwen; Yin, Ailan; Zhong, Mei

    2014-01-01

    ZNF217 is an alternatively spliced Kruppel-like transcription factor that has recently been implicated to play a role in human carcinogenesis. Here, we used immunohistochemistry (IHC) to show that ZNF217 protein is overexpressed in nearly 60% of ovarian tumor samples. The disease-free survival time was shorter in patients with positive ZNF217 expression than in ZNF217-negative patients (P=0.042). Fluorescence in situ hybridization (FISH) analysis showed ZNF217 genomic amplification in the poorly differentiated tumors, suggesting that ZNF217 is associated with the progression of ovarian cancer. Invasion was enhanced in HO-8910 cells stably transfected with constructs carrying full-length ZNF217 relative to cells transfected with the empty vector. To confirm our findings in vivo, we performed a tumorigenicity assay in nude mice inoculated with the HO-8910 overexpressing ZNF217 cells. As expected, tumors grown in the ZNF217 group were more invasive and prone to metastasis than those formed control groups. Based on these clinical and laboratory observations, we conclude that ZNF217 may contribute to ovarian cancer invasion and metastasis, and associated with worse clinical outcomes.

  5. Cigarette smoke mediates epigenetic repression of miR-217 during esophageal adenocarcinogenesis.

    Science.gov (United States)

    Xi, S; Inchauste, S; Guo, H; Shan, J; Xiao, Z; Xu, H; Miettenen, M; Zhang, M R; Hong, J A; Raiji, M T; Altorki, N K; Casson, A G; Beer, D G; Robles, A I; Bowman, E D; Harris, C C; Steinberg, S M; Schrump, D S

    2015-10-29

    Although microRNAs (miRs) have been implicated in the pathogenesis of various human malignancies, limited information is available regarding mechanisms by which these noncoding RNAs contribute to initiation and progression of tobacco-induced esophageal cancers. In this study, array and quantitative reverse transcriptase-PCR techniques were used to examine miR expression in immortalized esophageal epithelia (IEE) and esophageal adenocarcinoma (EAC) cells cultured in normal media with or without cigarette smoke condensate (CSC). Under relevant exposure conditions, CSC significantly decreased miR-217 expression in these cells. Endogenous levels of miR-217 expression in cultured EAC cells (EACC)/primary EACs were significantly lower than those observed in IEE/ paired normal esophageal tissues. RNA crosslink immunoprecipitation, quantitative reverse transcriptase-PCR (qRT-PCR) and immunoblot experiments demonstrated direct interaction of miR-217 with kallikrein 7 (KLK7), encoding a putative oncogene not previously implicated in EAC. Repression of miR-217 correlated with increased levels of KLK7 in primary EACs, particularly those from smokers. Chromatin and methylated DNA immunoprecipitation experiments demonstrated that CSC-mediated repression of miR-217 coincided with DNMT3b-dependent hypermethylation and decreased occupancy of nuclear factor 1 within the miR-217 genomic locus. Deoxyazacytidine induced miR-217 expression and downregulated KLK7 in EACC; deoxyazacytidine also attenuated CSC-mediated miR-217 repression and upregulation of KLK7 in IEE and EACC. Overexpression of miR-217 significantly decreased, whereas overexpression of KLK7 increased proliferation, invasion and tumorigenicity of EACC. Collectively, these data demonstrate that epigenetic repression of miR-217 contributes to the pathogenesis of EAC via upregulation of KLK7 and suggest that restoration of miR-217 expression may be a novel treatment strategy for these malignancies.

  6. miR-217 suppresses proliferation and promotes apoptosis in cardiac myxoma by targeting Interleukin-6.

    Science.gov (United States)

    Zhang, Jing; Wang, Cui; Xu, Huimin

    2017-08-26

    Cardiac myxoma (CM) is a prevalent primary cardiac tumor. miR-217 plays a vital role in tumorigenesis of various cancers, however, its role and underlying molecular mechanism in human CM remain poorly understood. Here, we reported that the expression of miR-217 was downregulated in CM tissues and inversely correlated with the expression of Interleukin-6 (IL-6) mRNA. Gain-of-function analysis indicated that overexpression of miR-217 inhibited the proliferation and promoted the apoptosis of the primary CM cells. Bioinformatics analysis showed that IL-6 was a direct target gene of miR-217, which is confirmed by the dual luciferase assays. Moreover, downregulation of IL-6 by small interference RNA (siRNA) mimicked the tumor-suppressive effects of miR-217 in CM. Furthermore, rescue experiments pointed out that restoration of IL-6 expression abrogated the anti-proliferative and pro-apoptotic effect induced by miR-217 overexpression in CM cells. Taken together, we validated that miR-217 could act as a tumor suppressor in CM by directly targeting 3'UTR of IL-6 gene, indicating that manipulation of miR-217 may be a potential therapeutic strategy for CM patients. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

    Science.gov (United States)

    2010-10-01

    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...

  8. 33 CFR 148.217 - How can a State be designated as an adjacent coastal State?

    Science.gov (United States)

    2010-07-01

    ... concerning the risk of damage to the coastal environment of the State; and (4) Explain why the State believes the risk of damage to its coastal environment is equal to or greater than the risk to a State... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD...

  9. 14 CFR 91.217 - Data correspondence between automatically reported pressure altitude data and the pilot's...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Data correspondence between automatically reported pressure altitude data and the pilot's altitude reference. 91.217 Section 91.217 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL...

  10. MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming, E-mail: lizm_1001@sina.com

    2016-02-26

    MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

  11. Learning the local Bayesian network structure around the ZNF217 oncogene in breast tumours.

    Science.gov (United States)

    Prestat, Emmanuel; de Morais, Sérgio Rodrigues; Vendrell, Julie A; Thollet, Aurélie; Gautier, Christian; Cohen, Pascale A; Aussem, Alex

    2013-05-01

    In this study, we discuss and apply a novel and efficient algorithm for learning a local Bayesian network model in the vicinity of the ZNF217 oncogene from breast cancer microarray data without having to decide in advance which genes have to be included in the learning process. ZNF217 is a candidate oncogene located at 20q13, a chromosomal region frequently amplified in breast and ovarian cancer, and correlated with shorter patient survival in these cancers. To properly address the difficulties in managing complex gene interactions given our limited sample, statistical significance of edge strengths was evaluated using bootstrapping and the less reliable edges were pruned to increase the network robustness. We found that 13 out of the 35 genes associated with deregulated ZNF217 expression in breast tumours have been previously associated with survival and/or prognosis in cancers. Identifying genes involved in lipid metabolism opens new fields of investigation to decipher the molecular mechanisms driven by the ZNF217 oncogene. Moreover, nine of the 13 genes have already been identified as putative ZNF217 targets by independent biological studies. We therefore suggest that the algorithms for inferring local BNs are valuable data mining tools for unraveling complex mechanisms of biological pathways from expression data. The source code is available at http://www710.univ-lyon1.fr/∼aaussem/Software.html. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. Characterization and antimicrobial activity of bacteriocin 217 produced by natural isolate Lactobacillus paracasei subsp. paracasei BGBUK2-16.

    Science.gov (United States)

    Lozo, Jelena; Vukasinovic, Maja; Strahinic, Ivana; Topisirovic, Ljubisa

    2004-12-01

    The strain Lactobacillus paracasei subsp. paracasei BGBUK2-16. which was isolated from traditionally homemade white-pickled cheese, produces bacteriocin 217 (Bac217; approximately 7 kDa). The onset of Bac217 biosynthesis was observed in the logarithmic phase of growth, and the production plateau was reached after 9 or 12 h of incubation at 37 and 30 degrees C, respectively, when culture entered the early stationary phase. Biochemical characterization showed that Bac217 retained antimicrobial activity within the range of pH 3 to 12 or after treatment at 100 degrees C for 15 min. Bac217 antimicrobial activity also remained unchanged after storage at 4 degrees C for 6 months or -20 degrees C for up to 12 months. However, Bac217 activity was completely lost after treatment with different proteolytic enzymes. BGBUK2-16 contains only one plasmid about 80 kb in size. Plasmid curing indicated that genes coding for Bac217 synthesis and immunity seem to be located on this plasmid. Bac217 exhibited antimicrobial activity against some pathogenic bacteria, such as Staphylococcus aureus and Bacillus cereus. Interestingly, Bac217 showed activity against Salmonella sp. and Pseudomonas aeruginosa ATCC27853. The inhibitory effect of BGBUK2-16 on the growth of S. aureus in mixed culture was observed. S. aureus treatment with Bac217 led to a considerable decrease (CFU/ml) within a short period of time. The mode of Bac217 action on S. aureus was identified as bactericidal. It should be noted that the strain BGBUK2-16 was shown to be resistant to bacteriocin nisin, which is otherwise widely used as a food additive for fermented dairy products.

  13. Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available y (0) YDL217C TIM22 Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopi...rey gene name TIM22 Prey description Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopic

  14. 20 CFR 217.7 - Claim filed with the Social Security Administration.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Claim filed with the Social Security... RETIREMENT ACT APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.7 Claim filed with the Social Security... social security application was filed. (3) The applicant asks the Board in a written statement to...

  15. 14 CFR 302.217 - Exceptions to administrative law judge's initial or recommended decision.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Exceptions to administrative law judge's..., DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) PROCEDURAL REGULATIONS RULES OF PRACTICE IN PROCEEDINGS... Disposition of Applications § 302.217 Exceptions to administrative law judge's initial or recommended decision...

  16. 31 CFR 535.217 - Blocking of property of the former Shah of Iran and of certain other Iranian nationals.

    Science.gov (United States)

    2010-07-01

    ... in the control of the estate of Mohammad Reza Pahlavi, the former Shah of Iran, or any close relative... Shah of Iran and of certain other Iranian nationals. 535.217 Section 535.217 Money and Finance... former Shah of Iran and of certain other Iranian nationals. (a) For the purpose of protecting the rights...

  17. The MicroRNA-217 Functions as a Potential Tumor Suppressor in Gastric Cancer by Targeting GPC5.

    Directory of Open Access Journals (Sweden)

    Hui Wang

    Full Text Available Gastric cancer (GC is one of the most common malignancies worldwide. Emerging evidence has shown that aberrant expression of microRNAs (miRNAs plays important roles in cancer progression. However, little is known about the potential role of miR-217 in GC. In this study, we investigated the role of miR-217 on GC cell proliferation and invasion. The expression of miR-217 was down-regulated in GC cells and human GC tissues. Enforced expression of miR-217 inhibited GC cells proliferation and invasion. Moreover, Glypican-5 (GPC5, a new ocncogene, was identified as the potential target of miR-217. In addition, overexpression of miR-217 impaired GPC5-induced promotion of proliferation and invasion in GC cells. In conclusion, these findings revealed that miR-217 functioned as a tumor suppressor and inhibited the proliferation and invasion of GC cells by targeting GPC5, which might consequently serve as a therapeutic target for GC patients.

  18. miR-217 inhibits triple-negative breast cancer cell growth, migration, and invasion through targeting KLF5.

    Directory of Open Access Journals (Sweden)

    Wenhui Zhou

    Full Text Available Triple negative breast cancer (TNBC is one of the most aggressive breast cancers without effective targeted therapies. Numerous studies have implied that KLF5 plays an important roles in TNBC. How is KLF5 regulated by microRNAs has not been well studied. Here, we demonstrated that miR-217 down-regulates the expression of KLF5 and KLF5's downstream target gene FGF-BP and Cyclin D1 in TNBC cell lines HCC1806 and HCC1937. Consequently, miR-217 suppresses TNBC cell growth, migration, and invasion. MiR-217 suppresses TNBC, at least partially, through down-regulating the KLF5 expression. These results suggest that the miR-217-KLF5 axis might serve as a potential target for treatment of TNBC.

  19. Panel 2.17: private commercial sector partnerships for health action in crises.

    Science.gov (United States)

    Sundnes, Knut Ole; Sannerkvist, Milan; Hedger, Philip; Woodworth, Brent; Hyre, Anne; Cuddyre, Terrence; Waldman, Ronald

    2005-01-01

    This is a summary of the presentations and discussion of Panel 2.17, Private Commercial Sector Partnerships for Health Action in Crises of the Conference, Health Aspects of the Tsunami Disaster in Asia, convened by the World Health Organization (WHO) in Phuket, Thailand, 04-06 May 2005. The topics discussed included issues related to private sector partnerships for health action in crises as pertain to the responses to the damage created by the Tsunami. It is presented in the following sections: (1) key questions; (2) issues and challenges; (3) lessons learned; (4) what was done well?; (5) what could have been done better?; and (6) conclusions and recommendations.

  20. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 217, Revision 1 (FGE.217Rev1). Consideration of genotoxic potential for α,β-Unsaturated ketones and precursors from chemical subgroup 4.1 of FGE, .19: Lactones

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6-methylcouma...

  1. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)

    2015-01-02

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

  2. Quem é a vítima menor de 14 anos tutelada pelo art. 217-A?

    OpenAIRE

    Shinmi, Marina Vatanabe

    2013-01-01

    Resumo: A lei 12.015/09 foi responsável por diversas alterações no Título VI, do Código Penal, agora denominado "Crimes contra a dignidade sexual". Partindo da análise do Código de 1940, se faz necessário o estudo da figura da violência presumida para adentrar no cerne dessa contenda, o novo tipo penal autônomo "estupro de vulnerável", criado pelo art. 217-A. Observa-se que tanto na doutrina quanto na jurisprudência a vulnerabilidade dos menores de 14 anos é relativizada. O ponto nevrálgico d...

  3. Health and relationships with leisure time activities in Swedish children aged 2-17 years.

    Science.gov (United States)

    Berntsson, Leeni T; Ringsberg, Karin C

    2014-09-01

    Three cross-sectional time series studies, randomised and stratified for age and gender, were performed on children aged 2-17, studying their health and well-being. The studies were performed in the Nordic countries in 1984, 1996 and 2011. Long-term illness (LTI) and psychosomatic complaints (PSC) increased during the period. Data were collected from mailed questionnaires. Data of 1461 Swedish children from 2011 were used and compared with data from 1984 and 1996. Relationships between the health indicators (the absence of LTI, 13 diagnoses, the absence of PSC, six symptoms, six items of well-being) and 12 activities were analysed. A total of 83.2% of the children were healthy and 16.8% had at least one LTI, boys 19.1% and girls 14.5%. PSC increased from 18.6% in 1996 to 23.1% in 2011. The distribution was higher in girls. Girls were more active than boys during leisure time. 'Reading books', 'visiting friends', 'listening to music' and 'activity in organisations' were related to an absence of PSC, LTI and well-being. 'Surfing/blogging on the Internet' was negatively related to LTI, PSC and well-being. Multiple regression showed that that 'visits or is visited by friends' was related with a low probability for LTI and also with a high probability for well-being. In the logistic regression analyses, the following variables were seen as promoting health most: 'visits or is visited by friends' and 'is active in organizations' for children aged 2-17 years, especially for boys and well-being. The health of Swedish children declined between 1984 and 2011. Positive relationships were found between some activities and health as well as other activities related to ill health. The results suggest an increased focus on the activities that have positive relationships with health in order to promote health among children. © 2013 Nordic College of Caring Science.

  4. MicroRNA-217 suppresses homocysteine-induced proliferation and migration of vascular smooth muscle cells via N-methyl-D-aspartic acid receptor inhibition.

    Science.gov (United States)

    Duan, Hongyan; Li, Yongqiang; Yan, Lijie; Yang, Haitao; Wu, Jintao; Qian, Peng; Li, Bing; Wang, Shanling

    2016-10-01

    Hyperhomocysteine has become a critical risk for atherosclerosis and can stimulate proliferation and migration of vascular smooth muscle cells (VSMCs). N-methyl-D-aspartic acid receptor (NMDAR) is a receptor of homocysteine and mediates the effects of homocysteine on VSMCs. Bioinformatics analysis has shown NMDAR is a potential target of microRNA-217 (miR-217), which exerts multiple functions in cancer tumorigenesis and carotid plaque progression. In this study, we sought to investigate the role of miR-217 in VSMCs phenotype transition under homocysteine exposure and elucidate its effect on atherosclerotic plaque formation. After treating with several doses of homocysteine (0-8 × 10(-4)  mol/L) for 24 hours, the expression of miR-217 in HA-VSMCs and rat aortic VSMCs was not altered. Intriguingly, the expression of NMDAR mRNA and protein was reduced by homocysteine in a dose-dependent manner. Transfection of miR-217 mimic significantly inhibited the proliferation and migration of VSMCs with homocysteine treatment, while transfection of miR-217 inhibitor promoted VSMCs migration. Moreover, miR-217 mimic down-regulated while miR-217 inhibitor up-regulated NMDAR protein expression but not NMDAR mRNA expression. Through luciferase reporter assay, we showed that miR-217 could directly bind to the 3'-UTR of NMDAR. MiR-217 mimic transfection also released the inhibition of cAMP-response element-binding protein (CREB)-PGC-1α signalling induced by homocysteine. Additionally, restoration of PGC-1α expression via AdPGC-1α infection markedly suppressed VSMCs proliferation through the degradation of NADPH oxidase (NOX1) and reduction of reactive oxygen species (ROS). Collectively, our study identified the role of miR-217 in regulating VSMCs proliferation and migration, which might serve as a target for atherosclerosis therapy. © 2016 John Wiley & Sons Australia, Ltd.

  5. 19 CFR 351.217 - Reviews to implement results of subsidies enforcement proceeding under section 751(g) of the Act.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reviews to implement results of subsidies... Countervailing Duty Procedures § 351.217 Reviews to implement results of subsidies enforcement proceeding under... ongoing countervailing duty proceeding the results of certain subsidy-related disputes under the WTO...

  6. 5 CFR 792.217 - Are part-time Federal employees eligible for the child care subsidy program?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Are part-time Federal employees eligible... the Child Care Subsidy Program Legislation and to Whom Does It Apply? § 792.217 Are part-time Federal employees eligible for the child care subsidy program? Federal employees who work part-time are eligible for...

  7. miR-216 and miR-217 expression is reduced in transgenic mouse models of pancreatic adenocarcinoma, knockout of miR-216/miR-217 host gene is embryonic lethal.

    Science.gov (United States)

    Azevedo-Pouly, Ana Clara P; Sutaria, Dhruvitkumar S; Jiang, Jinmai; Elgamal, Ola A; Amari, Foued; Allard, David; Grippo, Paul J; Coppola, Vincenzo; Schmittgen, Thomas D

    2017-05-01

    Mice harboring a G12D activating Kras mutation are among the most heavily studied models in the field of pancreatic adenocarcinoma (PDAC) research. miRNAs are differentially expressed in PDAC from patients and mouse models of PDAC. To better understand the relationship that Kras activation has on miRNA expression, we profiled the expression of 629 miRNAs in RNA isolated from the pancreas of control, young, and old P48(+/Cre);LSL-KRAS(G12D) as well as PDX-1-Cre;LSL-KRAS(G12D) mice. One hundred of the differentially expressed miRNAs had increased expression in the advanced disease (old) P48(+/Cre);LSL-KRAS(G12D) compared to wild-type mice. Interestingly, the expression of three miRNAs, miR-216a, miR-216b, and miR-217, located within a ∼30-kbp region on 11qA3.3, decreased with age (and phenotype severity) in these mice. miR-216/-217 expression was also evaluated in another acinar-specific ELa-Kras(G12D) mouse model and was downregulated as well. As miR-216/-217 are acinar enriched, reduced in human PDAC and target KRAS, we hypothesized that they may maintain acinar differentiation or represent tumor suppressive miRNAs. To test this hypothesis, we deleted a 27.9-kbp region of 11qA3.3 containing the miR-216/-217 host gene in the mouse's germ line. We report that germ line deletion of this cluster is embryonic lethal in the mouse. We estimate that lethality occurs shortly after E9.5. qPCR analysis of the miR-216b and miR-217 expression in the heterozygous animals showed no difference in expression, suggesting haplosufficiency by some type of compensatory mechanism. We present the differential miRNA expression in Kras(G12D) transgenic mice and report lethality from deletion of the miR-216/-217 host gene in the mouse's germ line.

  8. [Physician Assisted Suicide - Survey on § 217 StGB in Germany].

    Science.gov (United States)

    Zenz, Julia; Rissing-van Saan, Ruth; Zenz, Michael

    2017-03-01

    Background In late 2015, Germany passed a law (§ 217 StGB) prohibiting persons from aiding others in committing suicide on a regular, repetitive basis. Despite intensive societal debate and surveys about assisted dying, the present study was the first to examine attitudes towards the new legal regulation among professionals. Methods In early 2016, all participants of a congress on palliative care received a one-page anonymous questionnaire to complete until the end of the conference. The questionnaire consisted of questions regarding assisted suicide and the new law. The participants were asked to express their agreement or disagreement on a 4 to 5-point Likert scale. Results 457 questionnaires (48 %) were completed, 138 from physicians, 318 from nurses, 1 non specified. More than 80 % knew about the new law. Only half of the respondents supported it. 54 % felt that the law did not sufficiently differentiate between an illegal form of assisted suicide and a form exempt from prosecution. For more than 40 % the new law made no sense. Conclusion Professionals engaged in terminal care were reluctant to support a criminal liability of "business-like" physician-assisted suicide and suspected greater uncertainty among professionals in end of life care. © Georg Thieme Verlag KG Stuttgart · New York.

  9. RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Jae-Ho, E-mail: jhjeong@kaeri.re.kr [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)

    2017-03-15

    Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel

  10. A computer program to generate equations of motion matrices, L217 (EOM). Volume 1: Engineering and usage

    Science.gov (United States)

    Kroll, R. I.; Clemmons, R. E.

    1979-01-01

    The equations of motion program L217 formulates the matrix coefficients for a set of second order linear differential equations that describe the motion of an airplane relative to its level equilibrium flight condition. Aerodynamic data from FLEXSTAB or Doublet Lattice (L216) programs can be used to derive the equations for quasi-steady or full unsteady aerodynamics. The data manipulation and the matrix coefficient formulation are described.

  11. Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

    Directory of Open Access Journals (Sweden)

    Mark Walter

    2006-08-01

    Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

  12. Host MicroRNA-217 Promotes White Spot Syndrome Virus Infection by Targeting Tube in the Chinese Mitten Crab (Eriocheir sinensis

    Directory of Open Access Journals (Sweden)

    Ying Huang

    2017-05-01

    Full Text Available MicroRNAs (miRNAs, a group of small molecule non-encoding RNAs, are key post-transcriptional regulators of gene expression that are implicated in many biological processes. In the current study, miR-217 from Eriocheir sinensis was selected for studying its roles during host–virus interaction. Overexpression or silencing of miR-217 led to considerable effects on white spot syndrome virus (WSSV replication, implying that miR-217 played a positive role in WSSV infection. In insect High Five cells, miR-217 significantly inhibited Tube gene expression by binding to the 3′-untranslated region of the Tube. Overexpression of miR-217 in crab led to downregulation of tube expression. Knockdown of Tube in vivo led to significant enhancement of WSSV infection and inhibited the expression of five antimicrobial peptide (AMP genes (Anti-lipopolysaccharide factor ALF1, ALF2, ALF3; Crustin Crus1, Crus2 in WSSV-challenged crabs. Overexpression of miR-217 also led to downregulation of these AMP genes in WSSV-challenged crabs. Our results showed that host miRNA played positive roles in virus infection by regulation of host tube gene, which is the key component of Toll signaling pathway.

  13. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

    2008-04-25

    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  14. Efficacy and safety of a 21/7-active combined oral contraceptive with continuous low-dose ethinyl estradiol.

    Science.gov (United States)

    Kroll, Robin; Ackerman, Ronald; Feldman, Robert; Howard, Brandon; Weiss, Herman; Hsieh, Jennifer; Ricciotti, Nancy

    2016-03-01

    Substituting low-dose ethinyl estradiol (EE) for the hormone-free interval in combined oral contraceptives (COCs) may enhance ovarian suppression and improve tolerability. This noncomparative phase 3 study evaluated the efficacy and safety of a 21/7-active COC regimen including 21days of desogestrel (DSG)/EE followed by 7days of EE. This multicenter, open-label, phase 3, single-arm study enrolled sexually active women aged 18-40years at risk for pregnancy. Women received up to 1year, or 13 consecutive 28-day cycles, of DSG 150mcg/EE 20mcg for 21days and EE 10mcg alone for 7days. Participants kept diaries to record compliance, bleeding/spotting and other contraceptive use. Efficacy was measured using the Pearl Index (PI) and life-table approach. Safety and tolerability were assessed primarily through reported adverse events (AEs). A total of 2858 women enrolled and 1680 completed the study. Forty-six pregnancies in 2401 women aged 18-35years occurred after COC initiation and up to 7days after last DSG/EE or EE-only tablet was taken. When cycles in which another contraceptive method was used were excluded, the PI was 2.68 [95% confidence interval (CI), 1.96-3.57]. The cumulative pregnancy rate after 1year of treatment was 2.47% (95% CI, 1.85-3.29) for all users aged 18-35years. When only cycles during which women considered compliant were included, the PI was 2.00 (95% CI, 1.39-2.80). AEs were similar to those seen with other oral contraceptives. This 21/7-active DSG/EE COC with 7days of low-dose EE was efficacious and well tolerated for pregnancy prevention. This phase 3 open-label study demonstrated that a 21/7-active COC regimen including 21days of DSG 150mcg/EE 20mcg and 7days of EE 10mcg was efficacious and well tolerated for pregnancy prevention. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. [Usefulness of stratigraphy and computerized tomography in the initial staging of osteosarcoma of the extremities. Retrospective study of 217 cases].

    Science.gov (United States)

    Pelotti, P; Ciminari, R; Bacci, G; Avella, M; Briccoli, A

    1988-01-01

    The value of stratigraphy and pulmonary CT in the initial work-up of osteosarcoma of the extremities is assessed with reference to 217 patients encountered in the Bone Tumour Centre of Rizzoli Orthopaedic Institute in May 1983-May 1986. Stratigraphy revealed lung metastases not identified by standard radiography in 4 patients (1.8%), while CT revealed metastases not identified by either standard X-rays or stratigraphy in a further 6 cases (2.7%). It is concluded that the increase in the percentage of cures (about 30%) reported in the last 10 years in osteosarcoma cases given adjuvant chemotherapy cannot be explained by any difference in initial selection due to the use of these techniques that were not adopted in the historical series.

  16. Swedish parents' activities together with their children and children's health: a study of children aged 2-17 years.

    Science.gov (United States)

    Berntsson, Leeni T; Ringsberg, Karin C

    2014-11-01

    Nordic children's health has declined. Studies show that parents' engagement in children's leisure-time activities might provide beneficial health outcomes for children. The aim of the present study was to examine the association between Swedish parents' activities together with their children, the parents' experiences of time pressure and their children's health. Data of 1461 Swedish children aged 2-17 years old that were collected in the NordChild study of 2011 were used. We analyzed physical health, diseases and disabilities, psychosomatic health and well-being, and the parents' experiences of time pressure; and we calculated the associations between parental activity together with the child and health indicators. Activities that were significantly and positively associated with children's health at ages 2-17 years of age were: playing and playing games; going to the cinema, theatre, and sporting events; reading books; playing musical instruments/singing; sports activities; watching TV/video/DVD. Playing video games or computer games, driving child to activities and going for walks were significantly and positively associated at age groups 7-12 years and 13-17 years. Activities that were negatively associated with health were: surfing/blogging on the Internet, going shopping and doing homework. Parents who were not experiencing time pressures had a higher level of activity together with their children. The parental experience of time pressure was associated with work time, with less homework activity and more symptoms in children. The family and home are important settings for the development of children's health we found eight parental activities together with their children that promoted the children's health parents' working time and their time pressure experiences affected their activities with their children there is a need for an increased focus on parental activities that are positively associated with children's health. © 2014 the Nordic Societies of

  17. Activity and expression of acetylcholinesterase in PC12 cells exposed to intermittent 1.8 GHz 217-GSM mobile phone signal.

    Science.gov (United States)

    Valbonesi, Paola; Franzellitti, Silvia; Bersani, Ferdinando; Contin, Andrea; Fabbri, Elena

    2016-01-01

    Due to its role in learning, memory and in many neurodegenerative diseases, acetylcholinesterase (AChE) represents an interesting endpoint to assess possible targets of exposure to radiofrequency electromagnetic fields (RF-EMF) generated by mobile phones. We investigated possible alterations of enzymatic activity, gene and protein expression of AChE in neuronal-like cells exposed to a 1.8 GHz Global System for Mobile Communication (GSM) modulated signal (217-GSM). Rat PC12 cells were exposed for 24 h to 1.8 GHz 217-GSM signal. Specific adsorption rate (SAR) was 2 W/kg. AChE enzyme activity was assessed spectrophotometrically by Ellman's method, mRNA expression level was evaluated by real time polymerase chain reaction, and protein expression was assessed by Western blotting. AChE enzymatic activity increased of 1.4-fold in PC12 cells exposed to 217-GSM signal for 24 h, whilst AChE transcriptional or translational pathways were not affected. Our results provide the first evidence of effects on AChE activity after in vitro exposure of mammalian cells to the RF-EMF generated by GSM mobile phones, at the SAR value 2 W/kg. The obtained evidence promotes further investigations on AChE as a possible target of RF-EMF and confirm the ability of 1.8 GHz 217-GSM signal to induce biological effects in different mammalian cells.

  18. Activation of Na+-K+-ATPase with DRm217 attenuates oxidative stress-induced myocardial cell injury via closing Na+-K+-ATPase/Src/Ros amplifier.

    Science.gov (United States)

    Yan, Xiaofei; Xun, Meng; Dou, Xiaojuan; Wu, Litao; Zhang, Fujun; Zheng, Jin

    2017-04-01

    Reduced Na+-K+-ATPase activity has close relationship with cardiomyocyte death. Reactive oxygen species (ROS) also plays an important role in cardiac cell damage. It has been proved that Na+-K+-ATPase and ROS form a feed-forward amplifier. The aim of this study was to explore whether DRm217, a proved Na+/K+-ATPase's DR-region specific monoclonal antibody and direct activator, could disrupt Na+-K+-ATPase/ROS amplifier and protect cardiac cells from ROS-induced injury. We found that DRm217 protected myocardial cells against hydrogen peroxide (H2O2)-induced cardiac cell injury and mitochondrial dysfunction. DRm217 also alleviated the effect of H2O2 on inhibition of Na+-K+-ATPase activity, Na+-K+-ATPase cell surface expression, and Src phosphorylation. H2O2-treatment increased intracellular ROS, mitochondrial ROS and induced intracellular Ca2+, mitochondrial Ca2+ overload. DRm217 closed Na+-K+-ATPase/ROS amplifier, alleviated Ca2+ accumulation and finally inhibited ROS and mitochondrial ROS generation. These novel results may help us to understand the important role of the Na+-K+-ATPase in oxidative stress and oxidative stress-related disease.

  19. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Judd, Chaeli R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2012-09-01

    This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry.

  20. The Planck-ATCA Co-eval Observations project: analysis of radio source properties between 5 and 217 GHz

    Science.gov (United States)

    Massardi, Marcella; Bonaldi, Anna; Bonavera, Laura; De Zotti, Gianfranco; Lopez-Caniego, Marcos; Galluzzi, Vincenzo

    2016-01-01

    The Planck-ATCA Co-eval Observations (PACO) project has yielded observations of 464 sources with the Australia Telescope Compact Array (ATCA) between 4.5 and 40 GHz. The main purpose of the project was to investigate the spectral properties of mm-selected radio sources at frequencies below and overlapping with the ESA's Planck satellite frequency bands, minimizing the variability effects by observing almost simultaneously with the first two Planck all-sky surveys. In this paper we present the whole catalogue of observations in total intensity. By comparing PACO with the various measures of Planck Catalog of Compact Sources (PCCS) flux densities we found the best consistency with the PCCS `detection pipeline' photometry (DETFLUX) that we used to investigate the spectral properties of sources from 5 to 217 GHz. Of our sources, 91 per cent have remarkably smooth spectrum, well described by a double power-law over the full range. This suggests a single emitting region, at variance with the notion that `flat' spectra result from the superposition of the emissions from different compact regions, self-absorbed up to different frequencies. Most of the objects show a spectral steepening above ≃30 GHz, consistent with synchrotron emission becoming optically thin. Thus, the classical dichotomy between flat-spectrum/compact and steep-spectrum/extended radio sources, well established at cm wavelengths, breaks down at mm wavelengths. The mm-wave spectra do not show indications of the spectral break expected as the effect of `electron ageing', suggesting young source ages.

  1. Status of the 7 MeV/u, 217 MHz Injector Linac for the Heidelberg Cancer Therapy Facility

    CERN Document Server

    Schlitt, B; Hutter, G; Klos, F; Lu, Y; Minaev, S A; Mühle, C; Ratzinger, U; Schlitt, B; Tiede, R; Vinzenz, W; Will, C; Zurkan, O

    2004-01-01

    A clinical synchrotron facility for cancer therapy using energetic proton and ion beams (C, He and O) is under construction and will be installed at the Radiologische Universitätsklinik in Heidelberg, Germany, starting in 2005. The status of the ECR ion source systems, the beam line components of the low energy beam transport lines, the 400 keV/u RFQ and the 20 MV IH-cavity as well as the linac rf system will be reported. Two prototype magnets of the linac quadrupole magnets have been built at GSI and have been tested successfully. A test bench for the 1.4 MW, 217 MHz cavity amplifier built by industry has been installed at GSI including a 120 kW driver amplifier which will be used also for high power tests of the RFQ. A test bench for the RFQ using proton beams is presently being set up at the IAP. RF tuning of the 1:2 scaled IH-DTL model as well as Microwave Studio simulations of the model and the power cavity have been also performed at the IAP [1].

  2. Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

    Directory of Open Access Journals (Sweden)

    Kohzad S

    2013-03-01

    Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

  3. Silencing of long noncoding RNA MALAT1 by miR-101 and miR-217 inhibits proliferation, migration, and invasion of esophageal squamous cell carcinoma cells.

    Science.gov (United States)

    Wang, Xinyu; Li, Meng; Wang, Zhiqiong; Han, Sichong; Tang, Xiaohu; Ge, Yunxia; Zhou, Liqing; Zhou, Changchun; Yuan, Qipeng; Yang, Ming

    2015-02-13

    MALAT1, a highly conserved long noncoding RNA, is deregulated in several types of cancers. However, its role in esophageal squamous cell carcinoma (ESCC) and its posttranscriptional regulation remain poorly understood. In this study we provide first evidences that a posttranscriptional regulation mechanism of MALAT1 by miR-101 and miR-217 exists in ESCC cells. This posttranscriptional silencing of MALAT1 could significantly suppress the proliferation of ESCC cells through the arrest of G2/M cell cycle, which may be due to MALAT1-mediated up-regulation of p21 and p27 expression and the inhibition of B-MYB expression. Moreover, we also found the abilities of migration and invasion of ESCC cells were inhibited after overexpression of miR-101, miR-217, or MALAT1 siRNA. This might be attributed to the deregulation of downstream genes of MALAT1, such as MIA2, HNF4G, ROBO1, CCT4, and CTHRC1. A significant negative correlation exists between miR-101 or miR-217 and MALAT1 in 42 pairs of ESCC tissue samples and adjacent normal tissues. Mice xenograft data also support the tumor suppressor role of both miRNAs in ESCCs. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  4. Hypoxia-inducible factors regulate pluripotency factor expression by ZNF217- and ALKBH5-mediated modulation of RNA methylation in breast cancer cells.

    Science.gov (United States)

    Zhang, Chuanzhao; Zhi, Wanqing Iris; Lu, Haiquan; Samanta, Debangshu; Chen, Ivan; Gabrielson, Edward; Semenza, Gregg L

    2016-10-04

    Exposure of breast cancer cells to hypoxia increases the percentage of breast cancer stem cells (BCSCs), which are required for tumor initiation and metastasis, and this response is dependent on the activity of hypoxia-inducible factors (HIFs). We previously reported that exposure of breast cancer cells to hypoxia induces the ALKBH5-mediated demethylation of N6-methyladenosine (m6A) in NANOG mRNA leading to increased expression of NANOG, which is a pluripotency factor that promotes BCSC specification. Here we report that exposure of breast cancer cells to hypoxia also induces ZNF217-dependent inhibition of m6A methylation of mRNAs encoding NANOG and KLF4, which is another pluripotency factor that mediates BCSC specification. Although hypoxia induced the BCSC phenotype in all breast-cancer cell lines analyzed, it did so through variable induction of pluripotency factors and ALKBH5 or ZNF217. However, in every breast cancer line, the hypoxic induction of pluripotency factor and ALKBH5 or ZNF217 expression was HIF-dependent. Immunohistochemistry revealed that expression of HIF-1α and ALKBH5 was concordant in all human breast cancer biopsies analyzed. ALKBH5 knockdown in MDA-MB-231 breast cancer cells significantly decreased metastasis from breast to lungs in immunodeficient mice. Thus, HIFs stimulate pluripotency factor expression and BCSC specification by negative regulation of RNA methylation.

  5. pages 217 - 225.pmd

    African Journals Online (AJOL)

    Administrator

    Sudharsanam ... samples, suggesting its use in hospitals for preliminary assessment of indoor air quality and determine pathogenic microorganisms due to particle ..... and Government Owned Hospitals in Benin City,. Nigeria. World J Med Sci ...

  6. 211–217

    Indian Academy of Sciences (India)

    Administrator

    5300 Bonn 1, FRG. Lakshmi Saripalli Joint Astronomy Programme, Department of Physics, Indian. Institute of Science, Bangalore 560012 and Radio Astronomy Centre, Tata Institute of. Fundamental Research, PO Box 1234, Bangalore 560012.

  7. pages 217 - 225.pmd

    African Journals Online (AJOL)

    Administrator

    Microorganisms were identified using standard microbiological procedures. Results: Microbial ... ascertain the influence of seasonal changes on airborne microbial loads. ... tropical climate comprising of the following seasons, namely winter ...

  8. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    Directory of Open Access Journals (Sweden)

    Mahsa Mansourian

    2012-03-01

    Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

  9. Effectiveness of live attenuated influenza vaccine and inactivated influenza vaccine in children 2-17 years of age in 2013-2014 in the United States.

    Science.gov (United States)

    Caspard, Herve; Gaglani, Manjusha; Clipper, Lydia; Belongia, Edward A; McLean, Huong Q; Griffin, Marie R; Talbot, H Keipp; Poehling, Katherine A; Peters, Timothy R; Veney, Naomi; Ambrose, Christopher S

    2016-01-02

    A postmarketing observational study was initiated to evaluate quadrivalent live attenuated influenza vaccine (LAIV) effectiveness in children aged 2-17 years in the United States. Children and adolescents aged 2-17 years seeking outpatient care for febrile acute respiratory illness Vaccination status was documented from medical records or immunization registries. Children who received ≥1 dose of influenza vaccine ≥14 days before study visit were considered vaccinated. Vaccine effectiveness (VE) was estimated as 100×(1-adjusted odds ratio), where the odds of interest are the odds of vaccine exposure among influenza cases and test-negative controls. In total, 1033 children and adolescents were included in the analysis. Influenza was detected in 14% (145/1033) of all children, with 74% (108/145) of the influenza cases due to A/H1N1pdm09 strains, 21% (31) to influenza B, and 4% (6) to influenza H3N2. LAIV did not show significant effectiveness against A/H1N1pdm09 (VE 13% [95% CI: -55 to 51]) but was effective against B/Yamagata strains (82% [95% CI: 12-96]). Inactivated influenza vaccine was effective against A/H1N1pdm09 (74% [95% CI: 50-86]) and B/Yamagata (70% [95% CI: 18-89]). LAIV provided significant protection against B/Yamagata influenza but not against A/H1N1pdm09 in children aged 2-17 years in 2013-2014, resulting in a proposed change of the 2015-2016 formulation with a new and more heat-stable A/H1N1pdm09 LAIV strain. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. ExoMol molecular line lists XIX: high-accuracy computed hot line lists for H218O and H217O

    Science.gov (United States)

    Polyansky, Oleg L.; Kyuberis, Aleksandra A.; Lodi, Lorenzo; Tennyson, Jonathan; Yurchenko, Sergei N.; Ovsyannikov, Roman I.; Zobov, Nikolai F.

    2017-04-01

    Hot line lists for two isotopologues of water, H218O and H217O, are presented. The calculations employ newly constructed potential energy surfaces (PES), which take advantage of a novel method for using the large set of experimental energy levels for H216O to give high-quality predictions for H218O and H217O. This procedure greatly extends the energy range for which a PES can be accurately determined, allowing an accurate prediction of higher lying energy levels than are currently known from direct laboratory measurements. This PES is combined with a high-accuracy, ab initio dipole moment surface of water in the computation of all energy levels, transition frequencies and associated Einstein A coefficients for states with rotational excitation up to J = 50 and energies up to 30 000 cm-1. The resulting HotWat78 line lists complement the well-used BT2 H216O line list. Full line lists are made available online as Supporting Information and at www.exomol.com.

  11. Increased Antimicrobial Resistance in a Novel CMY-54 AmpC-Type Enzyme with a GluLeu(217-218) Insertion in the Ω-Loop.

    Science.gov (United States)

    Pérez-Llarena, Francisco José; Vázquez-Ucha, Juan Carlos; Kerff, Frédéric; Zamorano, Laura; Miró, Elisenda; Cabral, María Póvoa; Fleites, Ana; Lantero, Marta; Martínez-Martínez, Luis; Oliver, Antonio; Galleni, Moreno; Navarro, Ferrán; Beceiro, Alejandro; Bou, Germán

    2017-06-30

    During a Spanish surveillance study, a natural variant of a CMY-type β-lactamase related to CMY-2 with a GluLeu(217-218) insertion in the Ω-loop (designated CMY-54) was found to increase the minimum inhibitory concentractions to β-lactams in a clinical strain of Escherichia coli. The aim of this study was to characterize CMY-54 by genetic, microbiological, and biochemical analysis. The blaCMY-54 gene is encoded by a plasmid of around 100 kb that hybridizes with K and FIB probes. The genetic context of blaCMY-54 and blaCMY-2 genes was found to be very similar. E. coli expressing CMY-54 under isogenic conditions showed a clear fourfold to eightfold increase in MICs to penicillins, cefotaxime, ceftazidime, and aztreonam compared with CMY-2. The catalytic efficiencies of pure CMY-2 and CMY-54 proteins correlated with their microbiological parameters. CMY-2 protein was more resistant to thermal denaturation than CMY-54, indicating than the Ω-loop of CMY-54 may be wider and more relaxed and probably enables better accommodation of these antimicrobials. Otherwise, the higher stabilization of CMY-2 may induce a slight reduction of the dynamics of this enzyme and primarily affect the hydrolysis of some of the bulkiest antibiotics. In summary, the GluLeu(217-218) insertion observed in CMY-54 compared to CMY-2 produces a β-lactamase with a distinctive catalytic efficacy for β-lactam antimicrobials likely caused by an increased flexibility slightly affecting the active site shape, highlighting the relevance of single mutations on the hydrolytic spectrum in class C β-lactamases.

  12. Spectroscopy of actinium-215 and (p,t) studies of the stable palladium isotopes

    Science.gov (United States)

    Winkler, Ryan

    2009-12-01

    The study of both the microscopic and macroscopic structural evolution of the atomic nucleus is presented in this work. The excited states of the N = 126 isotone 215Ac were investigated at WNSL using the gas-filled recoil separator SASSYER. Recoil-decay tagging of the gamma rays corresponding to the decay of 215Ac after production via a fusion-evaporation reaction was made possible by using the redesigned SASSYER focal plane apparatus, including the addition of a pair of DSSDs and the multi-wire avalanche counter MACY. A number of transitions feeding the 29/2+ isomeric state corresponding to the ( ph49/2 )⊗(pii13/2) configuration were observed and tentatively assigned as decays from the high-spin 35/2 +, 39/2+, and 41/2+ states. Additionally, the decay from the low-lying 13/2+ state, corresponding to a pii13/2 quasiparticle excitation, was observed at 859 keV. This excitation energy is consistent with the systematics of the lighter N = 126 isotones suggesting a decrease in the energy gap between the pih9/2 and pi i13/2 orbitals. High-resolution (p,t) spectroscopy of the stable, even-even Palladium isotopes was performed in the search for signatures of quantum phase transitional behavior. A total of 54 previously unidentified 0+, 2 +, and 4+ states below an excitation energy of 3.5 MeV were discovered in this experiment. No enhancement of the 0+ level density, a signature of first-order phase transitions in nuclei, was observed in the studied isotopes. A theoretical description of the population strengths of excited 0+ states in two-nucleon transfer reactions was investigated within the framework of the IBM. These studies reveal that an enhanced population strength is not exclusive to regions of shape-coexistence but rather is a measure of the magnitude of the "change of structure" from the initial to residual nucleus.

  13. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Simultaneous Separation of Actinium and Radium Isotopes from a Proton Irradiated Thorium Matrix.

    Science.gov (United States)

    Mastren, Tara; Radchenko, Valery; Owens, Allison; Copping, Roy; Boll, Rose; Griswold, Justin R; Mirzadeh, Saed; Wyant, Lance E; Brugh, Mark; Engle, Jonathan W; Nortier, Francois M; Birnbaum, Eva R; John, Kevin D; Fassbender, Michael E

    2017-08-15

    A new method has been developed for the isolation of (223,224,225)Ra, in high yield and purity, from a proton irradiated (232)Th matrix. Herein we report an all-aqueous process using multiple solid-supported adsorption steps including a citrate chelation method developed to remove >99.9% of the barium contaminants by activity from the final radium product. A procedure involving the use of three columns in succession was developed, and the separation of (223,224,225)Ra from the thorium matrix was obtained with an overall recovery yield of 91 ± 3%, average radiochemical purity of 99.9%, and production yields that correspond to physical yields based on previously measured excitation functions.

  15. The release of dissolved actinium to the ocean: A global comparison of different end-members

    Science.gov (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.

    2008-01-01

    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry]. Another potential mechanism of producing deviations in 227Ac/228Ra and daughter isotope ratios from the expected production value of lithogenic material is observed at reducing environments, where enrichment in uranium may occur. The presented data here may serve as a reference for including 227Ac in circulation models, and the overview provides values for some end-members that contribute to the global Ac distribution. ?? 2007 Elsevier B.V. All rights reserved.

  16. 217 000-year-old DNA sequences of green sulfur bacteria in Mediterranean sapropels and their implications for the reconstruction of the paleoenvironment.

    Science.gov (United States)

    Coolen, Marco J L; Overmann, Jörg

    2007-01-01

    Deep-sea sediments of the eastern Mediterranean harbour a series of dark, organic carbon-rich layers, so-called sapropels. Within these layers, the carotenoid isorenieratene was detected. Since it is specific for the obligately anaerobic phototrophic green sulfur bacteria, the presence of isorenieratene may suggest that extended water column anoxia occurred in the ancient Mediterranean Sea during periods of sapropel formation. Only three carotenoids (isorenieratene, beta-isorenieratene and chlorobactene) are typical for green sulfur bacteria and thus do not permit to differentiate between the approximately 80 known phylotypes. In order to reconstruct the paleoecological conditions in more detail, we searched for fossil 16S rRNA gene sequences of green sulfur bacteria employing ancient DNA methodology. 540 bp-long fossil sequences could indeed be amplified from up to 217 000-year-old sapropels. In addition, such sequences were also recovered from carbon-lean intermediate sediment layers deposited during times of an entirely oxic water column. Unexpectedly, however, all the recovered 16S rRNA gene sequences grouped with freshwater or brackish, rather than truly marine, types of green sulfur bacteria. It is therefore feasible that the molecular remains of green sulfur bacteria originated from populations which thrived in adjacent freshwater or estuarine coastal environments rather than from an indigenous pelagic population.

  17. In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

    Directory of Open Access Journals (Sweden)

    D. A. Fink

    2015-02-01

    Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

  18. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    Science.gov (United States)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Hu, Shui-Ming; Szidarovszky, Tamás; Vasilenko, Irina A.

    2014-07-01

    This paper is the fourth of a series of papers reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational-Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0-14 016, 0-7969, and 0-9108 cm-1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm-1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved.

  19. Central PresbyLASIK for Hyperopia and Presbyopia Using Micro-monovision With the Technolas 217P Platform and SUPRACOR Algorithm.

    Science.gov (United States)

    Saib, Naïma; Abrieu-Lacaille, Mélanie; Berguiga, Marouen; Rambaud, Camille; Froussart-Maille, Françoise; Rigal-Sastourne, Jean-Claude

    2015-08-01

    To analyze the refractive outcomes and satisfaction of presbyopic hyperopes treated with central presbyopicLASIK (presbyLASIK) with induced micro-monovision. This retrospective study included 74 eyes of 37 patients treated with central presbyLASIK with micro-monovision using the Technolas 217P excimer laser (Technolas Perfect Vision GmbH, Munich, Germany) between June 2011 and March 2014. Study parameters included uncorrected distance visual acuity (UDVA) and uncorrected near visual acuity (UNVA), aberrometry, the central steep zone, and patient satisfaction. Median age was 54.3±4 years (range: 46 to 63 years). Mean postoperative spherical equivalent refraction was 0.00±0.58 diopters (D) for dominant eyes and -0.51±0.54 D for non-dominant eyes. Mean binocular UDVA was 0.01±0.10 logMAR (Snellen 20/20) at 6 months and -0.01±0.05 logMAR (Snellen 20/19) at 1 year postoperatively. Mean binocular UNVA was 0.18±0.14 logMAR (Parinaud 2) (Jaeger 1) at 6 months and 0.18±0.12 logMAR (Parinaud 2) (Jaeger 1) at 1 year postoperatively. At 6 months, 79.31% of patients achieved 20/25 and could read Parinaud 2 (Jaeger 1) binocularly. At 1 year, 84.21% of patients achieved 20/25 and could read Parinaud 2 (Jaeger 1) binocularly. The mean central steep zone was 2.35±1.00 D. There were significantly more negative spherical aberration and vertical coma in the central 5 mm postoperatively (P<.05). The re-treatment rate was 6.75%. Eighty-three percent of these patients did not need any glasses for distance and near vision. This procedure may improve functional near, intermediate, and distance vision in presbyopic patients with low and moderate hyperopia. Copyright 2015, SLACK Incorporated.

  20. 217 Résumé

    African Journals Online (AJOL)

    AKA BOKO

    Fehdi Chemseddine¹*, Boudoukha Abderrahmane², Rouabhia Abdelkader¹ et Salameh Elias³. 1Centre Universitaire de Tébessa, Institut des Sciences de la Terre,. Route de Constantine, Tébessa 12002, Algérie. ²Université de Batna, Département d'Hydraulique, Batna 05000, Algérie. ³University of Jordan, Department of ...

  1. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  2. Suppression of ovarian activity with a low-dose 21/7-day regimen oral contraceptive containing ethinylestradiol 20 mcg/drospirenone 3 mg in Japanese and Caucasian women.

    Science.gov (United States)

    Anzai, Yuzuru; Heger-Mahn, Doris; Schellschmidt, Ilka; Marr, Joachim

    2012-07-01

    Two studies assessed the effect of a low-estrogen-dose 21/7-day oral contraceptive containing ethinylestradiol and drospirenone (EE 20 mcg/drsp 3 mg) on ovarian activity in Japanese and Caucasian women. Study 1 was conducted in Japanese women (20-35 years), and Study 2 was conducted in Caucasian women (18-35 years). All women received EE 20 mcg/drsp 3 mg in a 21-day active pill regimen. The primary endpoint was the proportion of women with ovulation inhibition (Hoogland score day regimen provides comparable ovarian suppression in Japanese and Caucasian women, with normal ovarian function resuming shortly after treatment end in both populations. Copyright © 2012 Elsevier Inc. All rights reserved.

  3. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells.

    Science.gov (United States)

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok

    2016-08-05

    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  4. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Directory of Open Access Journals (Sweden)

    Mary J. Eaton

    2012-01-01

    Full Text Available Effective treatment of sensory neuropathies in peripheral neuropathies and spinal cord injury (SCI is one of the most difficult problems in modern clinical practice. Cell therapy to release antinociceptive agents near the injured spinal cord is a logical next step in the development of treatment modalities. But few clinical trials, especially for chronic pain, have tested the potential of transplant of cells to treat chronic pain. Cell lines derived from the human neuronal NT2 cell line parentage, the hNT2.17 and hNT2.19 lines, which synthesize and release the neurotransmitters gamma-aminobutyric acid (GABA and serotonin (5HT, respectively, have been used to evaluate the potential of cell-based release of antinociceptive agents near the lumbar dorsal (horn spinal sensory cell centers to relieve neuropathic pain after PNS (partial nerve and diabetes-related injury and CNS (spinal cord injury damage in rat models. Both cell lines transplants potently and permanently reverse behavioral hypersensitivity without inducing tumors or other complications after grafting. Functioning as cellular minipumps for antinociception, human neuronal precursors, like these NT2-derived cell lines, would likely provide a useful adjuvant or replacement for current pharmacological treatments for neuropathic pain.

  5. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2011-03-24

    ... within 500 hours TIS since (1.130 N.m). last inspection. Less than 10 LB-IN (1.130 N.m) but One to six... TIS since (1.130 N.m). last inspection. Less than 10 LB-IN (1.130 N.m) but One to six Repeat torque... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  6. 75 FR 38052 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2010-07-01

    ... (1.130 N.m) One to six....... Repeat torque but greater than or equal to inspection within 5 LB-IN (0... TIS since last inspection. Less than 10 LB-IN (1.130 N.m) One to six....... Repeat torque but greater... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  7. Sialidosis type I carrying V217M/G243R mutations in lysosomal sialidase: an autopsy study demonstrating terminal sialic acid in lysosomal lamellar inclusions and cerebellar dysplasia.

    Science.gov (United States)

    Uchihara, Toshiki; Ohashi, Ken-ichi; Kitagawa, Masanobu; Kurata, Morito; Nakamura, Ayako; Hirokawa, Katsuiku; Kasuga, Tsutomu; Kobayashi, Takayoshi

    2010-01-01

    Autopsy findings of a patient, with sialidosis type I phenotype carrying V217M/G243R mutations in the lysosomal sialidase gene and biochemically defined isolated sialidase deficiency, who died of intractable lymphoma at the age of 32 years, are described. Perikaryal expansion of cytoplasm was evident, mostly in motor neurons (in the anterior horn and the brain stem), dorsal root ganglia, cerebellar dentate neurons and some neurons in the thalamus and nucleus basalis of Meynert. The stored material was lamellar in lysosomes and exhibited a specific affinity to wheat germ agglutinin at light and electron microscopy, which indicates the accumulation of terminal sialic acid at the non-reducing end of the sugar chain in this pathological structure. Neuronal loss in these nuclei, however, was not frequent in spite of frequent and massive cytoplasmic expansion. Neocortex exhibited a mild spongiosis with some swelling of neurons, which contained lipofuscin-like granules and small amount of lamellar structures in lysosomes. This contrast suggests a discrepancy between the storage process and vulnerability of neurons, both variable according to areas examined. In the cerebellar vermis, dysplastic features, such as abnormal layering of Purkinje cells, thinning and rarefaction of the granule cell layer, incomplete formation of synapse and disordered proliferation of Bergmann's glia, were focally accentuated, suggesting some developmental abnormality not secondary to the storage process. This is the first autopsy demonstration of sialic acid in the lamellar materials and of a developmental abnormality in isolated sialidase deficiency. Additional studies are needed to clarify how this molecular abnormality leads to these morphological and clinical manifestations.

  8. Novel deletion and a new missense mutation (Glu 217 Lys) at the catalytic site in two adenosine deaminase alleles of a patient with neonatal onset adenosine deaminase severe combined immunodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Hirschhorn, R.; Nicknam, M.N.; Eng, F.; Yang, D.R.; Borkowsky, W. (New York Univ. Medical School of Medicine, NY (United States))

    1992-11-01

    Mutations at the adenosine deaminase (ADA) locus result in a spectrum of disorders, encompassing a fulminant neonatal onset severe combined immunodeficiency (SCID) and childhood onset immunodeficiency, as well as apparently normal immune function. The extent of accumulation of the toxic metabolite, deoxyATP, correlates directly with severity of disease. The authors have now determined the mutations on both alleles of a child with fulminant, neonatal onset ADA SCID and accumulation of extremely high concentrations of deoxyATP. The genotype was consistent with the severely affected phenotype. One allele carried a large deletion that arose by non-homologous recombination and included the first five exons and promoter region. The second allele carried a missense mutation (G[sup 649]A) resulting in replacement of Glu[sup 217], an amino acid involved in the catalytic site, by Lys and predicting a major alteration in charge. Expression of the mutant cDNA on Cos cells confirmed that the mutation abolished enzyme activity. The authors have previously reported that a missense mutation at the preceding codon is similarly associated with neonatal onset ADA SCID and accumulation of extremely high deoxyATP. These findings suggest that genotype-phenotype correlations may be apparent for ADA SCID, despite the role that random variation in exposure to environmental pathogens may play in the initial phenotype. Such genotype-phenotype correlations may be important to consider in evaluating results of ongoing trials of [open quotes]gene[close quotes] and enzyme replacement therapy. 50 refs., 5 figs., 2 tabs.

  9. Comparative, open-label prospective study on the quality of life and sexual function of women affected by endometriosis-associated pelvic pain on 2 mg dienogest/30 µg ethinyl estradiol continuous or 21/7 regimen oral contraceptive.

    Science.gov (United States)

    Caruso, S; Iraci, M; Cianci, S; Fava, V; Casella, E; Cianci, A

    2016-08-01

    To evaluate the effects of a continuous regimen combined oral contraceptive (COC) containing 2 mg dienogest and 30 µg ethinyl estradiol (DNG/EE) compared to a 21/7 regimen on the quality of life (QoL) and sexual function in women affected by endometriosis-associated pelvic pain. Sixty-three women constituted the Study group treated with DNG/EE COC continuous regimen; 33 women were given DNG/EE COC in a 21/7 regimen. To define the endometriosis-associated pelvic pain, the Visual Analogic Scale was used. The Short Form-36, Female Sexual Function Index (FSFI) and the Female Sexual Distress Scale (FSDS) were used to assess QoL, sexual function and sexual distress, respectively. The study included two follow-ups. At 3 and 6 months of treatment there was an improvement in pain of the Study group (p sexual activity and their QoL that was better than the DNG/EE 21/7 conventional regimen.

  10. 22 CFR 217.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... the identical result or level of achievement for handicapped and nonhandicapped persons, but must... reach the same level of achievement, in the most integrated setting appropriate to the person's needs... have the purpose or effect of defeating or substantially impairing accomplishment of the objectives of...

  11. 27 CFR 555.217 - Lighting.

    Science.gov (United States)

    2010-04-01

    ... “National Electrical Code,” (National Fire Protection Association, NFPA 70-81), for the conditions present... also meet the standards prescribed by the National Electrical Code. (c) Copies of invoices, work orders or similar documents which indicate the lighting complies with the National Electrical Code must be...

  12. 22 CFR 217.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... attitudes of others towards such impairment; or (C) has none of the impairments defined in paragraph (i)(2..., performing manual tasks, walking, seeing, hearing, speaking, breathing, learning, and working. (iii) Has a...

  13. 14 CFR 217.10 - Instructions.

    Science.gov (United States)

    2010-01-01

    ... carriers are encouraged to use ADP equipment to reduce the manual effort of preparing Schedule T-100(f...; the aircraft type code is 8161; the 816 indicates a Boeing 747-100, and the 1 in the units position...

  14. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Within an exceptionally uncertain and dynamic vulnerability context this thesis advances proposals from the findings towards revising and developing the livelihoods inquiry. ''Resiliency perspective'' comprises people''s ability to mitigate the effects of adversity; their ability to thrive in a... CNDD-FDD in Burundi : the path from ...

  15. 22 CFR 217.13 - Employment criteria.

    Science.gov (United States)

    2010-04-01

    ... test score or other selection criterion, as used by the recipient, is shown to be job-related for the position in question, and (2) alternative job-related tests or criteria that do not screen out or tend to..., the test results accurately reflect the applicant's or employee's job skills, aptitude, or whatever...

  16. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Absence of dry season Plasmodium parasitaemia, but high rates of reported acute respiratory infection and diarrhoea in preschool-aged children in Kaédi, southern Mauritania (open access). As a ''hot spot'' for climate change, the epidemiology of malaria in the River Gorgol valley, southern Mauritania, requires particular ...

  17. 8 CFR 217.2 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ..., Japan, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Monaco, the Netherlands, New Zealand, Norway... for return passage for charter flights, and military travel orders which include military dependents for return to duty stations outside the United States on U.S. military flights. A period of validity...

  18. 48 CFR 217.7802 - Policy.

    Science.gov (United States)

    2010-10-01

    ... determination of the Under Secretary of Defense for Acquisition, Technology, and Logistics, that it is necessary... considered include— (i) Satisfying customer requirements; (ii) Schedule; (iii) Cost effectiveness (taking... acquisition for analysis. Follow the reporting requirements in Subpart 204.6. ...

  19. 22 CFR 217.47 - Nonacademic services.

    Science.gov (United States)

    2010-04-01

    ... or that operates or sponsors intercollegiate, club, or intramural athletics shall provide to... placement services to its students shall provide these services without discrimination on the basis of... permit discrimination otherwise prohibited by this subpart. ...

  20. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lessons from the old Green Revolution for the new: Social, environmental and nutritional issues for agricultural change in Africa (restricted access) ... Using surveys covering seven West African economic capitals in the early 2000s, this paper describes the labour market integration of youth with regard to their level of formal ...

  1. 22 CFR 217.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ...) Specific activities. The provisions of this subpart apply to: (1) Recruitment, advertising, and the... absence to pursue training; (8) Employer sponsored activities, including those that are social or...

  2. 22 CFR 217.44 - Academic adjustments.

    Science.gov (United States)

    2010-04-01

    ... handicapped students other rules, such as the prohibition of tape recorders in classrooms or of dog guides in... effective methods of making orally delivered materials available to students with hearing impairments...

  3. 49 CFR 107.217 - Notice.

    Science.gov (United States)

    2010-10-01

    ... State or political subdivision determines that compliance with paragraph (a) of this section would be... not impracticable, or that notice should be published in the Federal Register. Late-filed comments are...

  4. 49 CFR 397.217 - Waiver processing.

    Science.gov (United States)

    2010-10-01

    ... designation of the State, political subdivision thereof, or Indian tribe for which the determination is sought... State, political subdivision thereof, or Indian tribe has been determined by a court of competent... served by publishing a notice in the Federal Register. ...

  5. 48 CFR 252.217-7009 - Default.

    Science.gov (United States)

    2010-10-01

    ... arises from causes beyond the control and without the fault or negligence of the Contractor. Examples of such causes include acts of God or of the public enemy, acts of the Government in either its sovereign or contractual capacity, fires, floods, epidemics, quarantine restrictions, strikes, freight...

  6. Incidence of live-attenuated influenza vaccine administration beyond expiry date in children and adolescents aged 2-17 years in the UK: a population-based cohort study.

    Science.gov (United States)

    Caspard, Herve; Wise, Robert P; Steffey, Amy; Brody, Robert S

    2017-07-17

    To estimate the proportion of live-attenuated influenza vaccine (LAIV) doses administered beyond expiry date in children and adolescents during influenza seasons 2013-2014 and 2014-2015 in the UK. This was a retrospective cohort study. Two cohorts of children and adolescents who received LAIV from 1 September 2013 to 31 March 2014 and from 1 September 2014 to 31 March 2015 and aged 2-17 years at time of LAIV administration were identified from the Clinical Practice Research Datalink (CPRD). More than 500 primary care practices in the UK. Proportions of vaccine doses administered beyond expiry date were assessed among 47 396 and 67 099 LAIV recipients with a documented vaccine lot identifier in influenza seasons 2013-2014 and 2014-2015, respectively. None. Administrations of expired LAIV were ascertained by comparison of vaccination dates in CPRD records with expiration dates in AstraZeneca/MedImmune lot distribution data. Overall, 245 LAIV recipients, 80 in 2013-2014 and 165 in 2014-2015, received a dose after its expiration date, yielding proportion estimates of 1.7 per 1000 doses (95% CI 1.3 to 2.1) in season 2013-2014 and 2.5 per 1000 (95% CI 2.1 to 2.8) in season 2014-2015. This proportion increased above 1.0% after December during each season. Most (84% in influenza season 2013-2014 and 59% in influenza season 2014-2015) received an expired dose <30 days after its expiration date. The proportion was higher in London (relative risk 1.93 (95% CI 1.25 to 2.99)) and when the number of LAIV recipients registered in the practice was lower than the median number per practice (relative risk 2.69 (95% CI 1.99 to 3.62)). Administration of expired LAIV doses occurs infrequently. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  7. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

    Science.gov (United States)

    2010-10-01

    ... interior, to occupants having corrected visual acuity of 20/40 (Snellen ratio) seated in the adjacent seat... “Emergency Exit,” as appropriate, in letters at least 5 centimeters high, of a color that contrasts with its... instructions shall be in letters at least 1 centimeter high and of a color that contrasts with its background...

  8. Dicty_cDB: CHM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  9. 29 CFR 1910.217 - Mechanical power presses.

    Science.gov (United States)

    2010-07-01

    ... this section. (5) Excluded machines. Press brakes, hydraulic and pneumatic power presses, bulldozers..., or loosening and falling or release of mechanical energy (i.e. broken springs). (2) Brakes. Friction... pneumatic system of the press. A means of air lubrication shall be provided when needed. (11) Hydraulic...

  10. Dicty_cDB: CHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CD169096.1 MM1-0024G-M078-E11-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024G-M078-E11.B, mRNA...|CD169707.1 MM1-0024T-M086-B01-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M086-B01.B, mRNA...|CD169077.1 MM1-0024G-M078-D02-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024G-M078-D02.B, mRNA...|CD169818.1 MM1-0024T-M087-D03-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M087-D03.B, mRNA...|CD168683.1 MM1-0023U-M091-D09-U.B MM1-0023 Schistosoma mansoni cDNA clone MM1-0023U-M091-D09.B, mRNA

  11. 1935 15' Quad #217 Aerial Photo Mosaic Index - AZ

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. Dicty_cDB: CHD217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Chardonnay Vitis vinifera cDNA clone VVB158G03 5, mRNA sequence. 64 4e-07 2 CA813481 |CA813481.1 CA48LN10IF-E8 Caberne...B341828 |CB341828.2 CA32EN0002_IIIbF_E01 Cabernet Sauvignon Leaf - CA32EN Vitis v

  13. All projects related to | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Program: Maternal and Child Health. Total Funding: CA$ 391,650.00. Understanding Southern Influence in Cyberspace Security and Governance: Toward a Global Network of Southern-based Cyber Scholars. Project. The securitization of cyberspace - that is, making it a matter of national security - is perhaps the most ...

  14. 12038_2016_9610_Article_print 205..217

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... structure and function of the Golgi apparatus (Sigma, St. Louis, MO, USA 2003). First, cells were harvested and allowed to settle in a 35×10 mm Petri dish. Loflo medium containing BFA at a concentration of 5 μM was added. Cells were incubated for 60 min. Fluorescence from GFP and. FM®1-43 (AX4) was ...

  15. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico... Requirements For All Explosive Severance Scenarios.1 Blasting Category Configuration (Charge wt/ placement...) Post Post Det Aerial Survey (Yes/No) Waiting Period (min) BML Shelf ( 200 m) A2 (856 ft) 90 N/A N/A 30...

  16. Dicty_cDB: SHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Dictyostelium discoideum H6 gene mRNA. 131 4e-31 2 BI863585 |BI863585.1 kx46a06.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar... to SW:EF2_CAEEL P29691 ELONGATION FACTOR 2 ;, mRNA sequence. 66 3e-19 4 BI863575 |BI863575.1 kx45h07.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides tricho...ngyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cD

  17. 78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage

    Science.gov (United States)

    2013-01-02

    ..., incapacity (including disability), layoff, jury duty, military duty or leave of absence (29 CFR 2530.200b-2(a... negative impact on employees who are on longer paid leaves, such as maternity or paternity leave. In..., holiday, illness, incapacity (including disability), layoff, jury duty, military duty or leave of absence...

  18. Dicty_cDB: VHO217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ld acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_05ca09, mRNA sequence. 56 8e-...one CR_CEa01K07, mRNA sequence. 56 8e-04 1 CB293061 |CB293061.1 UCRCS01_05ca09_g1 Washington Navel orange co

  19. Page 1 Auclear Methylation of Resacetophenone 217 requires C, 65 ...

    Indian Academy of Sciences (India)

    2 g of co-methoxy resacetophenone. 3: 7-Dimethoxy-8-methylflavone from the above ketone.-An intimate mixture of the ketone (1.g.), sodium benzoate (1.5 g) and benzoic anhydride. (4.g.) was heated in an oil-bath at 200 for 4 hours under a pressure of about. 40 mm. of mercury. The residue was treated with a large excess ...

  20. 48 CFR 1252.217-76 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ... required by the Contracting Officer, the Contractor shall execute a formal assignment or transfer of the... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  1. 48 CFR 3052.217-95 - Liability and insurance (USCG).

    Science.gov (United States)

    2010-10-01

    ... Contractor shall execute a formal assignment or transfer of the claim, demand, or cause of action. (5) No... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  2. JCSC_128_2_217-226_SI_a.doc

    Indian Academy of Sciences (India)

    Absorption spectrum was measured by using JASCO V-550 UV/VIS Spectrophotometer and Fluorescence spectrum was measured by using Hitachi F-2500 Fluorescence Spectrophotometer. X-ray data for the compound were collected at room temperature using a Bruker Apex II KY CCD diffractometer with graphite ...

  3. Dicty_cDB: VSD217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kyg*liles sl*iqiqtlqlyqiqhhqlqshhllqlkifqyypl*lylevimvmvvvvplmql*vvvvq llplqi*tlq*qlhqfihrlivmvqf*tq...kyg*li lessl*iqiqtlqlyqiqhhqlqshhllqlkifqyypl*lylevimvmvvvvplmql*vv vvqllplqi*tlq*qlhqfihrlivmvqf*tq*iih**tqkiiik**kl

  4. 48 CFR 217.208-70 - Additional clauses.

    Science.gov (United States)

    2010-10-01

    ... stocks, or acquisitions made under DoD cooperative logistics support arrangements. (b) When a surge... represents in paragraph (a) of the clause to ensure adequate quantities are available to meet item...

  5. 48 CFR 217.172 - Multiyear contracts for supplies.

    Science.gov (United States)

    2010-10-01

    ... funds appropriated for a subsequent fiscal year (including an economic order quantity of such long-lead... Secretary of Defense for Acquisition, Technology, and Logistics (10 U.S.C. 2306b(i)(6)). (8) The Secretary... contract negotiated priced options for varying the quantities of end items to be procured over the life of...

  6. 5 CFR 532.217 - Appropriated fund survey jobs.

    Science.gov (United States)

    2010-01-01

    ... Air Conditioning Mechanic 10 Rigger 10 Trailer Truck Driver 8 Tool Crib Attendant 6 Painter (Finish) 9... Laundry Worker 1 Food Service Worker 2 Cook 8 (e) A lead agency must obtain prior approval of OPM to add a...

  7. 48 CFR 217.171 - Multiyear contracts for services.

    Science.gov (United States)

    2010-10-01

    ..., vehicles, and other highly complex military equipment. (iii) Specialized training requiring high quality instructor skills (e.g., training for pilots and aircrew members or foreign language training). (iv) Base..., with due consideration given to such factors as the location, specialized nature, and obsolescence of...

  8. Dicty_cDB: AFI217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SLTIV DTQTLTCSAPPGSGIKNAVSFMVKDAESKLSPPLFLDYSPPTIMSSTSVKQVEGGQVTIY GTNFENTLITVNVGSKSCEDVSVIDSTKLTCSI...SLTIV DTQTLTCSAPPGSGIKNAVSFMVKDAESKLSPPLFLDYSPPTIMSSTSVKQVEGGQVTIY GTNFENTLITVNVGSKSCEDVSVIDSTKLTCSI

  9. 217 | Page A JURISPRUDENCE OF THE RULE OF LAW: AN ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Abstract. The Rule of law is the most important concept in public law and indeed, in every democratic society. The concept considers every citizen as equal before the law. It sanctifies the priority of the law – common good, over personal, sectional and group concerns. In this way, the law is enabled to provide a common ...

  10. 1935 15' Quad #217 Aerial Photo Mosaic Index - NM

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  11. 34 CFR 685.217 - Teacher loan forgiveness program.

    Science.gov (United States)

    2010-07-01

    ... borrower— (A) Demonstrated knowledge and teaching skills in reading, writing, mathematics, and other areas... students; or (ii) At an eligible elementary or secondary school or educational service agency as a highly... serving low-income students. (2) If the school or educational service agency at which the borrower is...

  12. Dicty_cDB: SSG217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available musculus dopamine receptor 2, ... 37 0.26 X53278_1( X53278 |pid:none) R.norvegicus mRNA for D2 dopamine rece...rece... 37 0.26 ( P61168 ) RecName: Full=D(2) dopamine receptor; AltName: Full=Dop... 37 0.26 AF293964_1(...AF293964_1( AF293964 |pid:none) Canis familiaris dopamine D2 recep... 37 0.34 protein update 2009. 6.12 PSORT

  13. Publications | Page 217 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... qui est une des conséquences du... Forêts communautaires dans le Bassin Arachidier : quelles stratégies locales pour une gestion réussie?; mémoire de fin d'études (restricted access). Les forêts communautaires (jachères, bas-fonds et ressources pastorales) jouent un rôle important dans la vie des populations rurales.

  14. Dicty_cDB: CHS217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available chromosome 13. 42 1.2 3 DQ067598 |DQ067598.1 Cocksfoot streak virus isolate UK-1-04 GHCP630B HC-Pro protein...partial cds. 46 1.6 1 DQ067597 |DQ067597.1 Cocksfoot streak virus isolate UK-1-04 GHCP630A HC-Pro protein...partial cds. 46 1.6 1 DQ067593 |DQ067593.1 Cocksfoot streak virus isolate UK-1-04 GHCP619C HC-Pro protein...partial cds. 46 1.6 1 DQ067592 |DQ067592.1 Cocksfoot streak virus isolate UK-1-04 GHCP619B HC-Pro protein...partial cds. 46 1.6 1 DQ067591 |DQ067591.1 Cocksfoot streak virus isolate UK-1-04 GHCP619A HC-Pro protein

  15. 29 CFR 778.217 - Reimbursement for expenses.

    Science.gov (United States)

    2010-07-01

    ... approximate amount expended by an employee, who is traveling “over the road” on his employer's business, for... expenses, such as taxicab fares, incurred while traveling on the employer's business. (4) “Supper money”, a... normally incurs expenses in traveling to and from work, buying lunch, paying rent, and the like. If the...

  16. 7 CFR 2.17 - Under Secretary for Rural Development.

    Science.gov (United States)

    2010-01-01

    ... government finance; income development strategies; housing; social services and utilization; adjustments to..., as amended by the Resource Conservation and Recovery Act, as further amended by the Hazardous and... assets and programs related to watershed facilities, resource and conservation facilities, and water and...

  17. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2012-09-01

    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  18. Modeling relationships among 217 fires using remote sensing of burn severity in southern pine forests

    Science.gov (United States)

    Sparkle L. Malone; Leda N. Kobziar; Christina L. Staudhammer; Amr Abd-Elrahman

    2011-01-01

    Pine flatwoods forests in the southeastern US have experienced severe wildfires over the past few decades, often attributed to fuel load build-up. These forest communities are fire dependent and require regular burning for ecosystem maintenance and health. Although prescribed fire has been used to reduce wildfire risk and maintain ecosystem integrity, managers are...

  19. 48 CFR 3052.217-92 - Inspection and manner of doing work (USCG).

    Science.gov (United States)

    2010-10-01

    ... shall be in accordance with the best commercial marine practices and the rules and requirements of all... unless otherwise specifically provided in the contract, all operational practices of the Contractor and... Government may inspect and test all material and workmanship at any time during the Contractor's performance...

  20. 48 CFR 252.217-7005 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... with the best commercial marine practices and the rules and requirements of the American Bureau of... provided in the job order, all operational practices of the Contractor and all workmanship, material... workmanship. The solicitation shall prescribe the Navy standard whenever applicable. (c) The Government may...

  1. Supplement to J. Genet. 84, 217–222 (2005), V. Rodrigues ...

    Indian Academy of Sciences (India)

    rdt

    191,. 93-95. (1967). 9. CAMPOS-ORTEGA, J.A., V. NEUHOFF and P. GLEES. Ultrastructural analysis of individual layers in the lateral geniculate body of the monkey. Z. Zellforsch. 87, 82-100. (1968). 10. CAMPOS-ORTEGA, J.A., P. GLEES and M. BLANK. Die absteigenden Verbindungen der Sehrinde des Halbaffen Galago.

  2. 20 CFR 217.8 - When one application satisfies the filing requirement for other benefits.

    Science.gov (United States)

    2010-04-01

    ... employee died. (g) A child's annuity or child's full-time student annuity if the child of the employee was... divorce. (m) A divorced spouse annuity if the spouse claimant has remarried the employee during the six... effective date of the final decree of divorce and would also be entitled to a divorced spouse annuity not...

  3. 217 L'entourage d'un Fait d'expression Comme Guide a la ...

    African Journals Online (AJOL)

    Ike Odimegwu

    premier plan comme élément identificateur, C'est lui qui donne l'information la plus abondante et la plus exacte des .... froments d'informations relatifs au contexte du texte se réunissent pour construire un sens ... traduction a pour conséquences des fausses associations, des calques, insolites c'est-à-dire des traductions ...

  4. 217 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)

    FIRST LADY

    the U.S nuclear and conventional forces for its security. France and the UK also possessed their own nuclear weapons, and most Western Europe countries based their defense around man conscript armies. What was then still call the EEC could only be a civilian power because of NATO and the. US security guarantee.

  5. Crisis Management: United States Reflagging of Kuwaiti Tankers (1987 - 1988) Politics 217

    Science.gov (United States)

    1991-03-01

    Secretary of State Murphy had a poignant exchange with Mr. Torricelli , (D) of New Jersey: MR TORRICELLI . Are you convinced that American destroyers...potential aggression’in the Gulf, the Silkworm missile being the most notable recent change. MR. TORRICELLI . The reason I am raising the question is, it...bitter than drinking poison, and Speaker of the Parliament Rafsanjani blamed Iran’s decision on the willingness of the United States to exercise Its

  6. Working Paper - 217 - Capital Account Policies, IMF Programs and Growth in Developing Regions

    OpenAIRE

    Zorobabel Bicaba; Zuzana Brixiova; Mthuli Ncube

    2015-01-01

    This paper examines capital account policy choices in an innovative model with adaptive learning under uncertainty. In the model, countries’ past experiences and IMF programs influence policymakers’ beliefs about impact of capital account liberalization on growth, taking into account constraints imposed by the ‘Mundell’s trilemma’. The model, calibrated to data for Africa, Latin America and developing Asia, is consistent with capital account policies during 1980 – 2010, including the delayed ...

  7. : tous les projets | Page 217 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'établissement d'un réseau de politique étrangère à Ottawa aidera à combler certaines lacunes, à renforcer le milieu de la politique étrangère dans la région de la capitale nationale et à intégrer de jeunes professionnels aux travaux en cours. Date de début : 1 mars 2012. End Date: 28 février 2015. Sujet: FOREIGN ...

  8. 77 FR 217 - Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment; Ambulatory Surgical...

    Science.gov (United States)

    2012-01-04

    ... RIN 0938-AQ26 Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment; Ambulatory Surgical Center Payment; Hospital Value-Based Purchasing Program; Physician Self-Referral; and Patient... (CMS), HHS. ACTION: Correction of final rule with comment period. SUMMARY: This document corrects...

  9. SU-D-217A-03: Nuclear Medicine Uniformity Assessment Using 2D Noise Power Spectrum.

    Science.gov (United States)

    Nelson, J; Christianson, O; Harkness, B; Madsen, M; Mah, E; Thomas, S; Zaidi, H; Samei, E

    2012-06-01

    Nuclear medicine quality control programs require daily evaluation for the presence of potential non-uniformities by commonly utilizing a traditional pixel value-based assessment (Integral CFOVUniformity). While this method effectively captures regional non- uniformities in the image, it does not adequately reflect subtle periodic structures that are visually apparent and clinically unacceptable, therefore requiring the need for additional visual inspection of the image. The goal of this project was to develop a new uniformity assessment metric by targetingstructural patterns and more closely correlating with visual inspection. The new quantitative uniformity assessment metric is based on the 2D Noise Power Spectrum (NPS). A full 2D NPS was performed on each image. The NPS was thresholded to remove quantum noise and further filtered by the visual response function. A score, the Structure Noise Index (SNI), was then applied to each based on the average magnitude of the structured noise in the processed image. To verify the validity of the new metric, 50 daily uniformity images with varying degrees of visual structured and non-structured non-uniformity were scored by 5 expert nuclear medicine physicists. The correlation between the visual score and SNI were assessed. The Integral CFOV was also compared against the visual score. Our new SNI assessment metric compared to the Integral CFOV showed in increase in sensitivity from 67% to 100% in correctly identifying structured non-uniformities. The overall positive predictive value also increased from 55% to 72%. Our new uniformity metric correlates much more closely with visual assessment of structured non- uniform NM images than the traditional pixel-based method. Using this new metric in conjunction with the traditional pixel value-based assessment will allow a more accurate quantitative assessment of nuclear medicineuniformity. © 2012 American Association of Physicists in Medicine.

  10. 24 CFR 200.217 - Filing of previous participation certificate on prescribed form.

    Science.gov (United States)

    2010-04-01

    ... or request to change the approved lessee operating a nursing home, assisted living, or skilled care facility; (9) With a bid to purchase a project being sold at foreclosure by HUD or by a foreclosure... organization by inheritance or court decree within 30 days after said acquisition or decree, but will not be...

  11. SU-D-217BCD-01: Corrupted DICOM Image Recovering: A Clinical Experience.

    Science.gov (United States)

    Chen, L; Walz-Flannigan, A; Langer, S

    2012-06-01

    Colored DICOM secondary capture images generated from CT perfusion studies were corrupted if they were sent directly from a Siemens acquisition workstation to a GE viewing workstation. However, those images were properly displayed in the GE viewing workstation if they were transferred through a GE PACS first. The purpose of this work is to investigate the cause of image corruption and determine why passing through PACS corrected it. DICOM headers of corrupted and non-corrupted (sent through the PACS) images were compared with a free DICOM software tool (http://DVTK.org); the differences were highlighted. Certain header tags were found in non-corrupted images, but not in corrupted images. These tags were sequentially removed until the non- corrupted image became corrupted. Once a candidate tag was found, fresh corrupt images were modified by adding a 'repair' tag and tested. It was found that the absence of Planar Configuration (0028, 0006) is the cause of image corruption. This attribute is used in the DICOM color image to specify whether the color pixel data are sent color-by-plane or color-by- pixel and should be present if the Sample per Pixel (0028, 0002) tag has a value greater than 1. In our DICOM color images, the values of (0028, 0002) and Photometric Interpretation (0028, 0004) are 3 and RGB, respectively. Thus (0028, 0006) should equal 0 (color-by-pixel), which is used for uncompressed or lossless compressed transfer syntaxes. Adding this tag and setting the value to zero manually repaired corrupt images. Using open source DICOM tools and following the described process can be a valuable ally in the search for causes of image corruption. Comparing the headers and finding the handful of different tags rapidly led to an explanation that could be used by the vendor for a permanent fix. © 2012 American Association of Physicists in Medicine.

  12. 49 CFR 375.217 - How must I collect charges upon delivery?

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION OF HOUSEHOLD GOODS IN INTERSTATE COMMERCE; CONSUMER PROTECTION REGULATIONS Before Offering... service and the bill of lading. (c) Charge or credit card payments: (1) If you agree to accept payment by...

  13. 29 CFR 1603.217 - Decision of the administrative law judge.

    Science.gov (United States)

    2010-07-01

    ... PROCEDURES FOR PREVIOUSLY EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION... discrimination is found, and shall provide notice of appeal rights consistent with subpart C of this part. (b) The administrative law judge shall serve the decision promptly on all parties to the proceeding and...

  14. IIASA Reports, 6(2):217-407 (Completing Volume 6) (October-December 1982)

    OpenAIRE

    1982-01-01

    This issue, which completes Volume 6, contains the following papers and the biographies of the contributing authors: -- V.G.Chant, "Two Global Scenarios: The Evolution of Energy Use and the Economy to 2030"; -- J.C. Stone et al., "Water Demand for Generating Electricity"; -- Z. Kos, "Stochastic Supplementary Irrigation Water Requirements in Water Resources Systems".

  15. 78 FR 66418 - Eighteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    Science.gov (United States)

    2013-11-05

    ...) 377 ``Air Traffic Management''--WG 2--Aerodrome Mapping Data Helicopter Terrain and Obstacle Data... data flow (text to support the figure agreed in Dublin) Monday Thru Thursday, Dec 2 Through Dec 5...

  16. 49 CFR 232.217 - Train brake tests conducted using yard air.

    Science.gov (United States)

    2010-10-01

    ... air test device must be connected to the end of the train or block of cars that will be nearest to the... connected to other than the end nearest to the controlling locomotive. (c) Except as provided in this..., after which, a Class III brake test shall be performed as prescribed by § 232.211. (1) If the cars are...

  17. 18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).

    Science.gov (United States)

    2010-04-01

    ... proceeding, the intervening customer or other interested person must support its allegation by a prima facie case. The elements of the prima facie case shall include at a minimum: (1) Specification of the filing... present their case, including prima facie showing, on price squeeze issues. (c) Within 30 days from the...

  18. Subtask 2.17 - CO2 Storage Efficiency in Deep Saline Formations

    Energy Technology Data Exchange (ETDEWEB)

    Gorecki, Charles D. [Univ. of North Dakota, Grand Forks, ND (United States); Liu, Guoxiang [Univ. of North Dakota, Grand Forks, ND (United States); Braunberger, Jason R. [Univ. of North Dakota, Grand Forks, ND (United States); Klenner, Robert C. L. [Univ. of North Dakota, Grand Forks, ND (United States); Ayash, Scott C. [Univ. of North Dakota, Grand Forks, ND (United States); Dotzenrod, Neil W. [Univ. of North Dakota, Grand Forks, ND (United States); Steadman, Edward N. [Univ. of North Dakota, Grand Forks, ND (United States); Harju, John A. [Univ. of North Dakota, Grand Forks, ND (United States)

    2014-02-01

    As the field of carbon capture and storage (CCS) continues to advance, and large-scale implementation of geologic carbon dioxide (CO2) storage progresses, it will be important to understand the potential of geologic formations to store meaningful amounts of CO2. Geologic CO2 storage in deep saline formations (DSFs) has been suggested as one of the best potential methods for reducing anthropogenic CO2 emission to the atmosphere, and as such, updated storage resource estimation methods will continue to be an important component for the widespread deployment of CCS around the world. While there have been several methodologies suggested in the literature, most of these methods are based on a volumetric calculation of the pore volume of the DSF multiplied by a storage efficiency term and do not consider the effect of site-specific dynamic factors such as injection rate, injection pattern, timing of injection, pressure interference between injection locations, and overall formation pressure buildup. These volumetric methods may be excellent for comparing the potential between particular formations or basins, but they have not been validated through real-world experience or full-formation injection simulations. Several studies have also suggested that the dynamic components of geologic storage may play the most important role in storing CO2 in DSFs but until now have not directly compared CO2 storage resource estimates made with volumetric methodologies to estimates made using dynamic CO2 storage methodologies. In this study, two DSFs, in geographically separate areas with geologically diverse properties, were evaluated with both volumetric and dynamic CO2 storage resource estimation methodologies to compare the results and determine the applicability of both approaches. In the end, it was determined that the dynamic CO2 storage resource potential is timedependent and it asymptotically approaches the volumetric CO2 storage resource potential over very long periods of time in the two systems that were evaluated. These results indicate that the volumetric assessments can be used as long as the appropriate storage efficiency terms are used and it is understood that it will take many wells over very long periods of time to fully realize the storage potential of a target formation. This subtask was funded through the Energy & Environmental Research Center (EERC)– U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  19. Yeast Interacting Proteins Database: YHR171W, YBR217W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available th phosphatidylethanolamine, required steps in autophagosome formation Rows with ... of ubiquitin-activating enzymes; mediates the conjugation of Atg12p with Atg5p and Atg8p with phosphatidylethanolamine, required ste...ps in autophagosome formation Rows with this bait as bait (1) Rows with this bait a

  20. Progress of Recycling in the Built Environment Final report of the RILEM Technical Committee 217-PRE

    CERN Document Server

    2013-01-01

    This report is a useful tool for countries starting to recycle aggregates or construction and demolition waste. It contains the latest developments in this field, introduces a completely new approach to the procedure of proportioning concrete mixtures with recycled aggregate, references recent publications, opinions and discrepancies in relation to the durability of recycled concrete, such as freeze-thaw standards, studies of chloride penetration and diffusion, and sulfate attacks, the use of the fine fraction <4mm, quality assurance of concrete recycled aggregate, sustainability and recycling construction waste and global impact assessment of urban renewal based on sustainable recycling strategies for construction and demolition waste. This volume will be of interest to recyclers, researchers and consumers.

  1. Yeast Interacting Proteins Database: YBR217W, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific...protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific

  2. 40 CFR 63.217 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... National Emission Standards for Hazardous Air Pollutants for Polyvinyl Chloride and Copolymers Production... CFR 61.61 of this chapter, the Vinyl Chloride NESHAP; and, § 63.2, in regard to terms used in §§ 63.1...

  3. Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

    Directory of Open Access Journals (Sweden)

    Ana Claudia Camargo Gonçalves da Silva

    2012-01-01

    Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

  4. 217. Experiencia en asistencia circulatoria mecánica en nuestro centro

    Directory of Open Access Journals (Sweden)

    J. Otero

    2012-04-01

    Conclusiones: Dada la gravedad de estos pacientes, con mortalidad cercana al 100% sin asistencia, consideramos el beneficio que aporta esta técnica y la gran utilidad que representa su disponibilidad.

  5. 7 CFR 58.217 - Evaporators and/or vacuum pans.

    Science.gov (United States)

    2010-01-01

    ..., GENERAL SPECIFICATIONS FOR APPROVED PLANTS AND STANDARDS FOR GRADES OF DAIRY PRODUCTS 1 General Specifications for Dairy Plants Approved for USDA Inspection and Grading Service 1 Equipment and Utensils § 58... water with entrained solids to the waste water system. “Cow water” shall not be used for acidified or...

  6. http://journals.tbzmed.ac.ir/JARCM/Manuscript/JARCM-2-217.pdf

    Directory of Open Access Journals (Sweden)

    Ali Ghavidel

    2014-11-01

    Full Text Available Introduction: Secondary aortoenteric fistula (SAF is an uncommon, but very important complication of abdominal aortic reconstruction. The complication often occurs months to years after aortic surgery. The clinical manifestation of the aortoenteric fistula is always upper gastrointestinal bleeding. Treatment of the disease is early surgical intervention. If operative treatment is not performed promptly, the mortality is high. Case Report: A case of secondary aortoduodenal fistula found 6 years after aortic reconstructive surgery, with the clinical presentation of upper gastrointestinal bleeding because of the increasing number of elective aortic aneurysm repairs in the aging population, it is likely that more patients with SAF will present to the clinical physicians in the future. Hence, a high index of suspicion is necessary for prompt diagnosis and treatment of this lifethreatening event. The patient treated medically and finally expiration of the patient and review of the literature currently available in Medline. Conclusion: The aim of this case report is to emphasize early diagnosis and management of all gastrointestinal bleeding in patients who have a history of aortic reconstructive surgery.

  7. The 17O hyperfine interaction in V17O(H217O)52+ and Mn(H217O)62+ determined by high field ENDOR aided by DFT calculations.

    Science.gov (United States)

    Baute, Debbie; Goldfarb, Daniella

    2005-09-08

    The 17O hyperfine interaction of the water ligands and the V=O oxygen in the vanadyl aquo complex and of the water ligands in the Mn2+ aquo complex in a frozen solution were determined by W-band (95 GHz) electron-nuclear double resonance (ENDOR). Orientation selective ENDOR spectra of the vanadyl complex exhibited two distinct signals assigned to the vanadyl oxygen and the water ligands. The assignment of the signals was done based on the orientation of the principal axis system of the hyperfine interaction and through comparison with the hyperfine interaction predicted by DFT calculations. The latter showed good agreement with the experimental values thus providing clear evidence that the vanadyl oxygen is exchangeable. The interaction of the vanadyl oxygen, especially its anisotropic part, was significantly larger than that of the water oxygens due to a relatively large negative spin density on the oxygen p orbitals. The 17O hyperfine interaction of the water ligand in the Mn2+ complex was found to be similar to that of the water ligand in the vanadyl complex and was in good agreement with earlier single-crystal data. Here, due to the large thermal polarization, it was also possible to determine the absolute sign of the hyperfine coupling by selecting different EPR transitions.

  8. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar).

    Science.gov (United States)

    2010-10-01

    ... space and diverse, abundant food resources to support growth and survival; waterways that allow for free... diverse food resources to support growth and survival of Atlantic salmon parr; (viii) Freshwater and... HUC 10 Name Status Economic (E), Military (M), orTribal (T) exclusions 1 0102000101 North Branch...

  9. The Planck-ATCA Co-eval Observations (PACO) project: analysis of radio source properties between 5 and 217 GHz

    OpenAIRE

    Massardi, Marcella; Bonaldi, Anna; Bonavera, Laura; de Zotti, Gianfranco; Lopez-Caniego, Marcos; Galluzzi, Vincenzo

    2015-01-01

    The Planck-ATCA Co-eval Observations (PACO) project has yielded observations of 464 sources with the Australia Telescope Compact Array (ATCA) between 4.5 and 40 GHz. The main purpose of the project was to investigate the spectral properties of mm-selected radio sources at frequencies below and overlapping with the ESA's Planck satellite frequency bands, minimizing the variability effects by observing almost simultaneously with the first two Planck all-sky surveys. In this paper we present the...

  10. Expanding Off-Campus Enrollment Capacity at Berkeley: A Concept Paper. Research & Occasional Paper Series: CSHE.2.17

    Science.gov (United States)

    Geiser, Saul

    2017-01-01

    Like Berkeley, the UC system as a whole is quickly running out of space to accommodate the next generation of Californians who will be reaching college age by mid-century. Even with the added capacity at UC Merced, the UC system will run out of space on existing campuses in the next decade. In the normal course of events, this would trigger…

  11. In vivo emergence of Aspergillus terreus with reduced azole susceptibility and a Cyp51a M217I alteration

    DEFF Research Database (Denmark)

    Arendrup, Maiken C; Jensen, Rasmus; Grif, Katharina

    2012-01-01

    Azole resistance in Aspergillus terreus isolates was explored. Twenty related (MB) and 6 unrelated A. terreus isolates were included. CYP51A sequencing and RAPD genotyping was performed. Five MB isolates were itraconazole susceptible, whereas the minimum inhibitory concentrations (MICs) for 15 MB...... isolates were elevated (1-2 mg/L). Voriconazole and posaconazole MICs were 0.5-4 and 0.06-0.5 mg/L, respectively, for MB isolates but 0.25-0.5 and...

  12. 217. Predictores de insuficiencia renal aguda en pacientes con enfermedad aórtica sometidos a parada circulatoria

    Directory of Open Access Journals (Sweden)

    E. Sarria García

    2010-01-01

    Conclusiones: La incidencia de IRA en pacientes sometidos a PCH es elevada, presumiblemente, siendo un factor de riesgo de mortalidad. El tiempo de CEC, hematocrito bajo y diuresis durante CEC parecen ser factores pronósticos para su desarrollo, por lo que deben optimizarse las medidas preventivas.

  13. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and...

    Science.gov (United States)

    2012-03-12

    ... for document(s) update within the current schedule. Finalize the draft for release to the FRAC process... Participation Continue to prioritize in terms of ``next document release or later''. Leadership Report on the...

  14. [Galen of Pergamum (129-216/217 AD) and his contribution to urology: part I: life, work and medical system].

    Science.gov (United States)

    Marx, F J

    2013-04-01

    Galen of Pergamum was, along with Hippocrates, the most influential physician and undoubtedly the most important medical scholar of classical antiquity. His anatomy and his concept of humoral pathology dominated western medicine until the sixteenth century and influenced all fields of medicine until after the seventeenth century. After referring to some biographical data the philosophical and epistemic fundamentals of Galen's"medical system" are outlined and brought into relation with the prevailing medical sects of the second century AD. The very treatises of his enormous work which are the most relevant with reference to the issue are briefly characterized.In the second part of the paper to be published in one of the next issues of this journal, Galen's significant contributions to the speciality we today define as urology are presented and analyzed. In addition pertinent case reports based on the Greek original texts will illustrate and substantiate his theoretical and clinical approach to the urology patient. Finally the significance of Galen's thinking for the present day physician will be evaluated.

  15. 75 FR 10552 - Sixth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping...

    Science.gov (United States)

    2010-03-08

    ... requirements Allan Hart, SESAR WP9 Working Group Report Outs (Status) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials Temporality Content Connectivity Tuesday... required)--Committee Coordination SC-186 ISRA Review and Response Planning SC-214 Requirements Review and...

  16. Performance Standards and Employee Effort: Evidence from Teacher Absences. Upjohn Institute Working Paper No. 15-217

    Science.gov (United States)

    Gershenson, Seth

    2015-01-01

    The 2001 No Child Left Behind Act (NCLB) increased accountability pressure in U.S. public schools by threatening to impose sanctions on Title 1 schools that failed to make adequate yearly progress (AYP) in consecutive years. Difference-in-difference estimates of the effect of failing AYP in the first year of NCLB on teacher effort in the…

  17. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  18. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  19. WE-C-217BCD-03: Restricted Data Set Reconstruction Based on Respiration Quality to Improve Prospectively Gated in Vivo Micro-CT of Mice.

    Science.gov (United States)

    Burk, L; Lee, Y; Lu, J; Zhou, O

    2012-06-01

    Micro-CT is commonly employed for lung imaging of mice; prospective gating allows for in-vivo imaging of free-breathing subjects. While this technique is successfully executed for healthy animals, results are less consistent for some disease models whose symptoms include irregular or unstable respiration. The purpose of this work is to repair the quality of high-blur images that arise from respiration instability using a retrospective method of motion reduction which identifies the individual x-ray projection images contributing most to the motion blur. Reconstructions were performed after the exclusion of these projections (the so-called restricted set). Sixteen mice were imaged using field emission cone beam micro-CT and prospective gating with a bellows-type respiration sensor. The scanner was operated in step-and-shoot mode; 400 projection images were acquired per scan. An algorithm was developed to analyze the respiration trace file and segment the individual breath corresponding to each projection image. We tested three different criteria to define a bad breath shape (correlation, mean breath height, or mode breath height), and restricted data set reconstructions were performed using each of these criteria to exclude projections corresponding to bad breaths. Each restricted set was compared against the full unrestricted data set image; the slope perpendicular to the diaphragm was used as a quantitative assessment of motion blur. All image sets saw a reduction in motion blur with at least one restriction technique. In 22 of 27 images, improvement was measured regardless of the removal criterion. Five percent total projection removal is optimal; a more aggressive correction increases the likelihood of under-sampling artifacts. Removing a subset of bad projections from otherwise complete image sets measurably decreases motion blur in respiratory-gated imaging. An approach based on breath height generally provides the best results. The technique is applicable to a variety of imaging modalities. © 2012 American Association of Physicists in Medicine.

  20. The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9

    DEFF Research Database (Denmark)

    Makovicky, Emil; Petricek, Vaclav; Dusek, Michal

    2011-01-01

    The layer-like crystal structure of franckeite from the mine of San José, Bolivia, exhibits a pronounced one-dimensional transversal wave-like modulation and a non-commensurate layer match in two dimensions. It consists of alternating pseudohexagonal (H) layers and pseudotetragonal (Q) slabs...... and H stacking directions, and the divergence between modulation wave-front and these stacking directions are typical for the composite structures of franckeite and cylindrite. Because of the increased rigidity of the Q component, franckeite usually forms masses of curved crystals rather than...... cylindrical aggregates. The existence of this family depends critically on the radius ratios of the cations involved, especially those involving (Pb2+, Sn2+) and Sn4+. Their replacement by a Pb2+:Bi3+ combination leads to misfit layer structures of a very different type, typified by cannizzarite....

  1. SU-F-J-217: Accurate Dose Volume Parameters Calculation for Revealing Rectum Dose-Toxicity Effect Using Deformable Registration in Cervical Cancer Brachytherapy: A Pilot Study

    Energy Technology Data Exchange (ETDEWEB)

    Zhen, X; Chen, H; Liao, Y; Zhou, L [Southern Medical University, Guangzhou, Guangdong (China); Hrycushko, B; Albuquerque, K; Gu, X [UT Southwestern Medical Center, Dallas, TX (United States)

    2016-06-15

    Purpose: To study the feasibility of employing deformable registration methods for accurate rectum dose volume parameters calculation and their potentials in revealing rectum dose-toxicity between complication and non-complication cervical cancer patients with brachytherapy treatment. Method and Materials: Data from 60 patients treated with BT including planning images, treatment plans, and follow-up clinical exam were retrospectively collected. Among them, 12 patients complained about hematochezia were further examined with colonoscopy and scored as Grade 1–3 complication (CP). Meanwhile, another 12 non-complication (NCP) patients were selected as a reference group. To seek for potential gains in rectum toxicity prediction when fractional anatomical deformations are account for, the rectum dose volume parameters D0.1/1/2cc of the selected patients were retrospectively computed by three different approaches: the simple “worstcase scenario” (WS) addition method, an intensity-based deformable image registration (DIR) algorithm-Demons, and a more accurate, recent developed local topology preserved non-rigid point matching algorithm (TOP). Statistical significance of the differences between rectum doses of the CP group and the NCP group were tested by a two-tailed t-test and results were considered to be statistically significant if p < 0.05. Results: For the D0.1cc, no statistical differences are found between the CP and NCP group in all three methods. For the D1cc, dose difference is not detected by the WS method, however, statistical differences between the two groups are observed by both Demons and TOP, and more evident in TOP. For the D2cc, the CP and NCP cases are statistically significance of the difference for all three methods but more pronounced with TOP. Conclusion: In this study, we calculated the rectum D0.1/1/2cc by simple WS addition and two DIR methods and seek for gains in rectum toxicity prediction. The results favor the claim that accurate dose deformation and summation tend to be more sensitive in unveiling the dose-toxicity relationship. This work is supported in part by grant from VARIAN MEDICAL SYSTEMS INC, the National Natural Science Foundation of China (no 81428019 and no 81301940), the Guangdong Natural Science Foundation (2015A030313302)and the 2015 Pearl River S&T Nova Program of Guangzhou (201506010096).

  2. SU-D-217A-05: Auto-Registration of Cardiac PET/CT Images with a 3D Weighted Gradient Correlation Algorithm.

    Science.gov (United States)

    Ai, H; Pan, T

    2012-06-01

    To design a novel 3D automatic registration algorithm for cardiac PET/CT registration using gradient information and to evaluate the performance of the algorithm with clinical PET/CT datasets. The 512×512×47 CT images are at first resized to 128×128×47 to match the matrix size of PET. In order to maximize the gradient information at boundaries in CT, a conventional fuzzy c-means clustering algorithm (number of cluster = 7) is implemented to suppress signals from tissues that do not contribute much useful information for the registration purpose (fat, lung, and bones). The 3D Image gradient map, consisting of all three orthogonal components, is derived from the PET images and the post- clustering CT images. The mis-registration is modeled as 3D rigid body translation in this study, though it can be extended to include rotations as well. The details of the gradient-based objective function are described in the support document. Optimal registration is determined by searching for the maximum of the objective function over a range of potential translation positions (e.g. 8.2×8.2×2.8cm). This process is repeated at a higher matrix size (512×512×47) to refine the result of registration. We applied this auto registration technique on 55 patient data sets of cardiac PET/CT images. The CT images were average-CT images, and the PET images were without attenuation correction. 54 out of the 55 cases produced satisfactory registration. The proposed weighted gradient correlation algorithm is a viable solution for auto registration of cardiac PET/CT images. More work is needed to further improve the robustness of thealgorithm. © 2012 American Association of Physicists in Medicine.

  3. 26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969.

    Science.gov (United States)

    2010-04-01

    ... addition, A detours into Mexico for sightseeing. Because of the stopovers and tour into Mexico, A's travel... vehicle. Since A's excursion into Mexico is away from the usual Boston-Los Angeles route, the portion of... employment there. Thus, while a member of a railroad crew may spend most of his working time aboard a train...

  4. Melhaoui Mohammed, Peste, contagion et martyre. Histoire du fléau en Occident médiéval, Paris, Publisud, 2005, 217 p.

    Directory of Open Access Journals (Sweden)

    Stéphane Barry

    2007-07-01

    Full Text Available En France, à l’exception des études du médecin, historien et démographe Jean-Noël Biraben (1975-1976, peu de travaux existent sur la Peste noire et ses conséquences dans l’Occident musulman médiéval. On comprendra alors tout l’intérêt de l’ouvrage de Mohammed Melhaoui sur ce thème qu’il connaît bien puisqu’il lui a consacré non seulement une thèse de doctorat d’histoire, mais aussi quelques études portant notamment sur la « perception de la peste en pays chrétiens byzantins et musulman » (Co...

  5. PS2-17: Diabetes Social Support Feasibility Pilot Study: Utilizing Mobile Technology and Self-Identified Supporters to Enhance Self-Monitoring of Blood Glucose

    Science.gov (United States)

    Robinson, Brandi; Roblin, Douglas; Hipkens, James; Vupputuri, Suma; McMahon, Kevin

    2010-01-01

    Background and Aims: Self-monitoring of blood glucose (SMBG) is associated with improved glycemic control among patients with type 2 diabetes, however, the practice of daily self-monitoring is not optimal. Telecommunications technology may improve adherence to recommended self-management practices by remotely transmitting automated reminders to motivate patients, and utilizing social networking for peer support. The purpose of this pilot study is to demonstrate the feasibility and usability of mobile technology and the potential added value of social support to improve SMBG frequency and glycemic control among adults with type 2 diabetes. Methods: Adults 25–74 years of age with type 2 DM and an average HbA1c > 8.0% were recruited from Kaiser Permanente Georgia (KPGA) and Oakhurst Medical Center (OMC, a community health clinic) to participate in a 3-month study using wireless technology. Enrollment sessions with presentations on SMBG techniques, use of the wireless technology, and motivational coaching to enhance social support were conducted in November 2009. During the subsequent 3-months, both diabetes patients and their self-selected supporters will receive text messages to their cell phones summarizing a patient’s SMBG frequency and levels. Participants and their supporters will attend a disenrollment session in February 2010 when feasibility and usability will be assessed in focus groups. Results: 6 of 161 eligible diabetes patients at KPGA and 9 of 28 eligible diabetes patients at OMC, and their self-selected supporters, consented to participate. The average age of diabetes patients was 49.3 years. 86.7% (N=13) were African-American; and 33.3% (N=5) were male. Five days after enrollment, 60% (N=9) of patients had connected their wireless transmitters and had current blood glucose data. Follow-up phone calls will be made to ensure that all participants are connected to the wireless technology within 10 days of the enrollment session. Conclusion: Integrating mobile telecommunications technology with chronic disease management may empower patients in their own self-care and ease the burden on health care providers. Our study will evaluate the potential for studying the use of wireless mobile technology in a larger randomized controlled trial and will obtain participant comments on what changes might improve participant compliance.

  6. "Poor Banished Children of Eve": Tom Murphy and the syntax of historyDOI:10.5007/2175-8026.2010n58p217

    Directory of Open Access Journals (Sweden)

    Paul Murphy

    2010-01-01

    Full Text Available This essay engages with the work of playwright Tom Murphy and suggests that Murphy synthesizes the dialectic between past and present by representing history as a process of story-telling, where hegemonic Catholic bourgeois nationalist history is contradicted by repressed discourses of class and gender.   The aim is to move beyond a reading of Irish theatre grounded in identitarian paradigms of nation and nationalism, towards an engagement with ethical issues of class and gender subordination which are as much a part of Irish cultural politics as the nation is or ever was.

  7. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)

    2015-06-15

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care.

  8. O papel subestimado do interlocutor na abordagem cognitiva da metáfora DOI - 10.5752/P.2358-3428.2014v18n34p217

    Directory of Open Access Journals (Sweden)

    Ulrike Schröder

    2014-07-01

    Full Text Available Uma das maiores críticas voltadas para a Teoria da Metáfora Conceitual é que Lakoff e Johnson (2003, 1999 partem de uma constelação idealizada de interlocutores, de modo que o processo da compreensão de uma metáfora simplesmente se dá por meio da ativação de metáforas conceptuais, entrincheiradas no cérebro dos participantes (GIBBS, 2007. Procurar-se-á investigar quais as abordagens que dirigem sua atenção ao ouvinte como parte ativa por coconstruir o significado particular da expressão metafórica em dependência do contexto pragmático, social e cultural em que os interlocutores estão inseridos. A questão central é até que ponto os estudos existentes conseguem reintegrar o processo holístico da comunicação, e, para tal, distinguimos entre três linhas de pesquisa a serem aprofundadas: estudos psicolinguísticos, textual-discursivos e pragmático-interacionais.Palavras-chave: Teoria da Metáfora Conceitual. Interlocutor. Compreensão. Comunicação. Interação.

  9. The hyperfine structure in the rotational spectra of D2(17)O and HD(17)O: Confirmation of the absolute nuclear magnetic shielding scale for oxygen.

    Science.gov (United States)

    Puzzarini, Cristina; Cazzoli, Gabriele; Harding, Michael E; Vázquez, Juana; Gauss, Jürgen

    2015-03-28

    Guided by theoretical predictions, the hyperfine structures of the rotational spectra of mono- and bideuterated-water containing (17)O have been experimentally investigated. To reach sub-Doppler resolution, required to resolve the hyperfine structure due to deuterium quadrupole coupling as well as to spin-rotation (SR) and dipolar spin-spin couplings, the Lamb-dip technique has been employed. The experimental investigation and in particular, the spectral analysis have been supported by high-level quantum-chemical computations employing coupled-cluster techniques and, for the first time, a complete experimental determination of the hyperfine parameters involved was possible. The experimentally determined (17)O spin-rotation constants of D2 (17)O and HD(17)O were used to derive the paramagnetic part of the corresponding nuclear magnetic shielding constants. Together with the computed diamagnetic contributions as well as the vibrational and temperature corrections, the latter constants have been employed to confirm the oxygen nuclear magnetic shielding scale, recently established on the basis of spin-rotation data for H2 (17)O [Puzzarini et al., J. Chem. Phys. 131, 234304 (2009)].

  10. SU-F-T-217: A Comprehensive Monte-Carlo Study of Out-Of-Field Secondary Neutron Spectra in a Scanned-Beam Proton Therapy Treatment Room

    Energy Technology Data Exchange (ETDEWEB)

    Englbrecht, F; Parodi, K [LMU Munich, Department of Medical Physics, Garching / Munich, Bavaria (Germany); Trinkl, S; Mares, V; Ruehm, W; Wielunski, M [Helmholtz Zentrum Munich, Institute of Radiation Protection, Neuherberg, Bavaria (Germany); Wilkens, J [Technical University of Munich, Department of Physics, Munich, Germany, Garching, Bavaria (Germany); Klinikum rechts der Isar, Department of Radiation Oncology, Munich (Germany); Hillbrand, M [Rinecker Proton Therapy Center, Munich, Bavaria (Germany)

    2016-06-15

    Purpose: To simulate secondary neutron radiation-fields produced at different positions during phantom irradiation inside a scanning proton therapy gantry treatment room. Further, to identify origin, energy distribution and angular emission as function of proton beam energy. Methods: GEANT4 and FLUKA Monte-Carlo codes were used to model the relevant parts of the treatment room in a gantry-equipped pencil beam scanning proton therapy facility including walls, floor, metallic gantry-components, patient table and the homogeneous PMMA target. The proton beams were modeled based on experimental beam ranges in water and spot shapes in air. Neutron energy spectra were simulated at 0°, 45°, 90° and 135° relative to the beam axis at 2m distance from isocenter, as well as 11×11 cm2 fields for 75MeV, 140MeV, 200MeV and for 118MeV with 5cm PMMA range-shifter. The total neutron energy distribution was recorded for these four positions and proton energies. Additionally, the room-components generating secondary neutrons in the room and their contributions to the total spectrum were identified and quantified. Results: FLUKA and GEANT4 simulated neutron spectra showed good general agreement in the whole energy range of 10{sup −}9 to 10{sup 2} MeV. Comparison of measured spectra with the simulated contributions of the various room components helped to limit the complexity of the room model, by identifying the dominant contributions to the secondary neutron spectrum. The iron of the bending magnet and counterweight were identified as sources of secondary evaporation-neutrons, which were lacking in simplified room models. Conclusion: Thorough Monte-Carlo simulations have been performed to complement Bonner-sphere spectrometry measurements of secondary neutrons in a clinical proton therapy treatment room. Such calculations helped disentangling the origin of secondary neutrons and their dominant contributions to measured spectra, besides providing a useful validation of widely used Monte-Carlo packages in comparison to experimental data. Cluster of Excellence of the German Research Foundation (DFG) “Munich-Centre for Advanced Photonics (MAP)”.

  11. 47 CFR 95.217 - (R/C Rule 17) May I operate my R/C station transmitter by remote control?

    Science.gov (United States)

    2010-10-01

    ... records. See R/C Rule 24, § 95.224. (c) Remote control means operation of an R/C transmitter from any place other than the location of the R/C transmitter. Direct mechanical control or direct electrical control by wire from some point on the same premises, craft or vehicles as the R/C transmitter is not...

  12. Production of neutron-rich nuclides in the heavy-element region via /sup 3/He-induced reactions

    Energy Technology Data Exchange (ETDEWEB)

    Chu, Y.Y.; Zhou, M.L.

    1982-01-01

    We have measured the production cross sections for /sup 233/Th and /sup 231/Th from the bombardment of /sup 238/U with /sup 3/He ions at 46-, 53-, and 60-MeV at the Brookhaven 60-in. isochronous cyclotron. We have also attempted to observe the decay of /sup 233/Ac produced via /sup 238/U(/sup 3/He,/sup 8/B) or equivalent reactions using 61 MeV /sup 3/He ions by first separating thorium from actinium and then performing chemical purifications on the second thorium sample into which the actinium has decayed. In the four experiments we performed, three gave results consistent with the ..beta.. half-life of /sup 233/Ac somewhat longer than 120 s and the production cross section from this target-projectile combination in the order of 1 to 2 ..mu..b.

  13. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  14. Protein (Cyanobacteria): 52368 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007318423.1 1117:958 1118:14 217161:217 1173032:217 1173020:217 multimeric flavodoxin WrbA Chamaes...iphon minutus PCC 6605 MGSVAIIYFSGTGNTHLMAEAIASGVRHADTRVDLLRIEGIQIKDGRWFDEKFMESLQMADAILFGS

  15. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NCEI Accession 0069501)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  16. WE-C-217BCD-07: Best in Physics (Joint Eyiaging-Therapy) - Direct Imaging of the Uptake of Platinum Anticancer Agents Using X-Ray Stimulated Fluorescence: A Proof-Of-Concept Study.

    Science.gov (United States)

    Kuang, Y; Pratx, G; Qian, J; Meng, B; Bazalova, M; Xing, L

    2012-06-01

    Platinum-based (Pt) chemotherapy has greatly improved the initial response rate of different cancers. However, relapse of a drug-resistant tumor occurs with a high frequency, resulting in poor long term survival. The most common phenotype of Pt chemoresistance is decreased Pt drug accumulation in the tumor region due to either decreased influx or increased efflux, which is invisible for current imaging modalities. The inability of imaging methods to directly image the Pt drug uptake has resulted in a very unfavorable scenario for early assessment of chemotherapeutic efficacy as well as for personalized treatment planning. In this study, we investigated the feasibility of imaging the uptake and retention of Pt drugs using x-ray stimulated fluorescence CT (XSF-CT). Pt is a high atomic number element, and it emits XSF photons when excited by ionizing photons. Therefore, the alteration of spatial distribution and concentration of Pt drugs in the cancer region could be monitored with XSF-CT. In this study, a polychromatic X-ray source was used to stimulate emission of XSF photons from the Pt drugs. XSF-CT used a first-generation CT geometry. The data were collected using a cadmium telluride detector to sort out a set of spectra. The spectra were then used to generate sinogram. The bio distribution and concentration of each element were reconstructed with the ML-EM algorithm. The reconstructed images clearly identified the distributions of cisplatin. A good linearity between XSF intensities and the concentrations of cisplatin was also observed, suggesting that XSF-CT is capable of quantitative imaging. The X-ray dose for stimulating the XSF photon was 0.25 cGy per projection. XSF-CT has the potential to be a promising modality for monitoring the intervention processes within X-ray scanners. It would afford a powerful way to reliably modify an ineffective treatment regimen in nearly real time. This work was supported by NIH/NCI grants (CA133474, CA153587), an NSF grant (0854492) and a grant from the Friends for an Earlier Breast Cancer Test Foundation. © 2012 American Association of Physicists in Medicine.

  17. High Personal Activity and its Sociological MeasurementReview of the book:Muzykant V.L. Psychology and Sociologyin Advertising. M.: RIOR-INFRA-M, 2012. 217 p.

    Directory of Open Access Journals (Sweden)

    I B Lapshin

    2012-09-01

    Full Text Available This article is a review of the book Psychology and Sociology in Advertising, systematizing the latest developments in sociology and psychology, which can be used in designing and applying the strategy of brand building.

  18. Multibeam collection for KN217: Multibeam data collected aboard Knorr from 2014-04-07 to 2014-04-19, departing from Woods Hole, MA and returning to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Science.gov (United States)

    2012-01-01

    technology [207]. Any consortium would evaluate how these novel ethical issues in emerging technologies are ad- dressed under current oversight and...animal care, and euthanasia were performed in accordance with the Laboratory Animal Welfare Act, Guide for the Care and Use of Laboratory Animals (National...rat chow and water ad lib on a 12/12 hr light/dark cycle. All surgical interventions, pre- and postsurgical animal care, and euthanasia were performed

  20. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069177)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  1. Toxicidad, acumulación y efectos fisiológicos del colorante premetalizado C.I. Acid Violet 66 y su base azoica C.I. Acid Red 217 en la trucha Arcoiris Salmo Gairdneri R.

    OpenAIRE

    Riva Juan, Mª del Carmen

    1989-01-01

    El objetivo fundamental de esta Tesis ha sido una ampliación de conocimientos sobre toxicidad y efectos de los colorantes premetalizados en la trucha arcoiris Salmogairdneri. Se ha dedicado especial atención a la toxicocinética del colorante premetalizado (acumulación y eliminación, tanto de colorante como de cromo y base azoica, en diferentes órganos y partes del cuerpo de los animales), así como a los efectos a nivel sanguíneo y en algunas características histológicas. The main objective...

  2. Incidence of live-attenuated influenza vaccine administration beyond expiry date in children and adolescents aged 2-17 years in the UK: a population-based cohort study

    National Research Council Canada - National Science Library

    Herve Caspard; Robert P Wise; Amy Steffey; Robert S Brody

    2017-01-01

    Objectives To estimate the proportion of live-attenuated influenza vaccine (LAIV) doses administered beyond expiry date in children and adolescents during influenza seasons 2013-2014 and 2014-2015 in the UK...

  3. 217 YAP Is Ready to Rac and Rho: Elucidation of a Novel YAP-Driven Network That Potentiates Brain Cancer Cell Dispersal and Confers Poor Survival in Patients.

    Science.gov (United States)

    Shah, Sagar R; Tippens, Nathaniel; Park, JinSeok; Mohyeldin, Ahmed; Vela, Guillermo; Martinez-Gutierrez, Juan Carlos; Margolis, Seth S; Schmidt, Susanne; Levchenko, Andre; Quinones-Hinojosa, Alfredo

    2016-08-01

    Molecular pathways linking cell polarization and migration to extracellular cues regulate many pathological processes, including progression of aggressive and infiltrative cancers. Glioblastoma (GBM), the most common and lethal form of primary brain cancer, is characterized by its pronounced ability to disseminate into the intricate microenvironment of the human brain, confounding surgical excision and radiotherapy, leading to a median patient survival of 14 months. Progression results from defects in molecular pathways linking cell migration and invasion into surrounding tissue. However, the molecular engines are not known. Using patient-derived GBM tissues and cells, we profiled the expression of network moieties via Western blotting, quantitative real-time polymerase chain reaction and performed live cell time-lapse microscopy, bioinformatics analyses, in vivo intracranial GBM experiments using genetic and pharmacological inhibitors to delineate a prodispersal mechanism for management and treatment of GBMs. Yes-associated protein (YAP), a transcriptional coactivator, is overexpressed and hyperactive in 78% of GBMs and 50% of metastatic tumors to the brain (P < .05). Our studies demonstrate that YAP activates a Rho-GTPase switch to potentiate migratory speed by interacting with canonical pathways through direct transcriptional control. In addition, YAP mediates a proinvasive genetic network by direct posttranslational regulation. By coupling the regulation of migration and invasion, YAP drives tumor cell dispersal in vitro and in vivo (P < .05). Hyperactivation of this YAP-driven network in GBM confers poor patient outcome in clinical biopsies and The Cancer Genome Atlas (P < .05), suggesting a new signature in clinical prognosis of this aggressive and infiltrative cancer. Targeting this network using a proprietary pharmacological inhibitor attenuates tumor dispersal and growth (P < .05). YAP can critically control cellular locomotion through direct interaction with canonical molecular pathways controlling invasion and migration. Understanding the molecular underpinnings of this network is vital to the development of imperative prognostic and treatment approaches for cancer such as the new proprietary pharmacological inhibitor presented in this study.

  4. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in adjuvant with PF-3512676 and GM-CSF in metastatic melanoma.

    Science.gov (United States)

    Tarhini, Ahmad A; Leng, Siyang; Moschos, Stergios J; Yin, Yan; Sander, Cindy; Lin, Yan; Gooding, William E; Kirkwood, John M

    2012-05-01

    The effectivenes of cancer vaccines in inducing CD8(+) T-cell responses remains a challenge, resulting in a need for testing more potent adjuvants. Our objective was to determine the safety and immunogenicity of vaccination against melanoma-related antigens employing MART-1, gp100, and tysosinase paptides combined with the TLR9 agonist PF-3512676 and local granulocyte macrophage-colony stimulating factor in oil emulsion. Using continuous monitoring of safety and a 2-stage design for immunologic efficacy, 20 immune response evaluable patients were targetted. Vaccinations were given subcutaneously on days 1 and 15 per cycle (1cycle=28 d) for up to 13 cycles. Interferon-γ enzyme-linked immunosorbent spot was used as the primary assay measuring the frequency of peripheral antigen-specific CD8(+) T cells at days 50 and 90 compared with baseline (target ≥ 9/20 immunologic responses). Clinical responses were measured by Response Evaluation Criteria In Solid Tumors every 8 weeks. Twenty-two (including 20 immune response evaluable) melanoma patients were enrolled. All had American Joint Committe on Cancer stage IV (5M1a, 6M1b, 11M1c) and most had previously received therapy. Eight had previously treated brain metastases. An average of 3.5 cycles of vaccination per patient was administered. Clinical response data were available for 21 patients. There were 2 partial response and 8 stable disease lasting 2-7 months. One patient with ongoing partial response continued on treatment. At a median follow-up of 7.39 months (range, 3.22-20.47 mo), median progression-free survival was 1.9 months (90% confidence interval, 1.84-3.68) and median overall survival was 13.4 months (90% confidence interval,11.3-∞). No regimen-related grade 3/4/5 toxicities were observed. There were 9/20 patients with positive enzyme-linked immunosorbent spot at day 50 and/or day 90. Our adjuvant regimen combining PF-3512676 and granulocyte macrophage-colony stimulating factor was safe and is worthy of further testing with these or alternative peptides, potentially in combination with antibodies that target immunoregulatory checkpoints.

  6. Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte - DOI: 10.4025/actascianimsci.v29i2.217 Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations - DOI: 10.4025/actascianimsci.v29i2.217

    Directory of Open Access Journals (Sweden)

    Jorge Vitor Ludke

    2007-11-01

    Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre o tratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations. The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. An experiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC and characteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up to 13.31%, to improve the feed conversion.

  7. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  8. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  9. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available A] ... Length = 217 ... Query: 65 ... FLVAACAANDASRNQASYHYQMGLSHLGENDTTRALIEFIEAEKITPDDPILLNSLGLAY 124 ... FLVAACAANDA...SRNQASYHYQMGLSHLGENDTTRALIEFIEAEKITPDDPILLNSLGLAY Sbjct: 1 ... FLVAACAANDA

  10. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GMGGHEGGDIASRILVDTVEQAVVRLGKE 60 ... Query: 158 QVLIQKSKDHSQVMEMVEQGLIGARDAEDHPMANVITRAVGVDRYLMIDQLSGSILPNDQ 21...7 ... QVLIQKSKDHSQVMEMVEQGLIGARDAEDHPMANVITRAVGVDRYLMIDQLSGSILPNDQ Sbjct: 121 QVLIQKSKDHSQVMEMVEQGLIGARDAEDHPMANVITRAVGVDRYLMIDQLSGSILPNDQ 180 ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-11-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-11-0019 ref|ZP_01036200.1| hypothetical protein ROS217_04295 [Roseovarius... sp. 217] gb|EAQ25283.1| hypothetical protein ROS217_04295 [Roseovarius sp. 217] ZP_01036200.1 3.2 28% ...

  12. NCBI nr-aa BLAST: CBRC-PABE-26-1117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-26-1117 ref|ZP_01033920.1| hypothetical protein ROS217_18782 [Roseovarius... sp. 217] gb|EAQ26601.1| hypothetical protein ROS217_18782 [Roseovarius sp. 217] ZP_01033920.1 2.5 28% ...

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-0852 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0852 ref|ZP_01035335.1| hypothetical protein ROS217_14576 [Roseovarius... sp. 217] gb|EAQ26410.1| hypothetical protein ROS217_14576 [Roseovarius sp. 217] ZP_01035335.1 0.003 28% ...

  14. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TGIINGDPIRERGTQAARSVVLVEMVNRHNQPLAFCTGTLIAPQ 60 ... Query: 158 DIAIATFDGGIPEGYSTVSIDTDTKGNYSERSVYVYGYGRSKDYTGKP...NEDLFAYLGQLR 217 ... DIAIATFDGGIPEGYSTVSIDTDTKGNYSERSVYVYGYGRSKDYTGKPNEDLFAYLGQLR Sbjct: 121 DIAIATFDGGIPEGYSTVSIDTDTKGNYSERSVYVYGYGRSKDYTGKPNEDLFAYLGQLR 180 ...

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC217 (Link to dictyBase) - - - Contig-U15331-1 VFC217P (Link... to Original site) VFC217F 363 VFC217Z 478 VFC217P 841 - - Show VFC217 Library VF (Link to library) Clone ID VFC217 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original site URL http://dict...6.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> predict

  16. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  17. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  18. Gclust Server: 27462 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available HSA_7656955 Cluster Sequences - 217 NP_056537.1 dopamine receptor D1 interacting protein ; no annotation...length 217 Representative annotation NP_056537.1 dopamine receptor D1 interacting protein ; no annotation

  19. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tive (ubiA-2) [Flavobacterium sp. MED217] gb|EAQ50082.1| 4-hydroxybenzoate octaprenyltransferase , putative (ubiA-2) [Leeuwenhoekiella blandensis MED217] ZP_01060587.1 2e-31 33% ...

  20. ORF Alignment: NC_006055 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DDFKK Sbjct: 1 ... KFLKKNYKTTPLSVIYKWLRKGDIKINGKRIKDKDYLIKANDEIIVYDNNKPVLRDDFKK 60 ... Query: 158 IHRLDKLTSGLIMYA...KNKQTHDIMVEAIQDKEKIEKYYRCRIDVPVTESLIAKGWIKYDP 217 ... IHRLDKLTSGLIMYAKNKQTHDIMVEAIQDKEKIEKYYRCRIDVPVT...ESLIAKGWIKYDP Sbjct: 121 IHRLDKLTSGLIMYAKNKQTHDIMVEAIQDKEKIEKYYRCRIDVPVTESLIAKGWI

  1. Presentation of child sexual abuse cases to Queen Elizabeth ...

    African Journals Online (AJOL)

    Results. Between January 2005 and February 2007, 217 children presented with alleged CSA. This is an average of 3 more per month since the previous year. The results of the physical examination in 60% (130/217) of the cases showed signs of trauma. 63% (137/217) of the cases presented within 72 hours of defilement.

  2. Book Review: Controversy and consensus in nuclear beta decay 1911-1934 by Carsten Jensen. Finn Aaserud, Helge Kragh, Erik Rüdinger, Roger H. Stuewer (Eds.), Burkhaüser-Verlag, Basel, 2000, xv+217 pp., US 79.95, ISBN 3-7643-5319-9

    Science.gov (United States)

    Brown, Laurie M.

    This book is the doctoral dissertation of Carsten Jensen, researched at the University of Copenhagen under the supervision of Erik Rüdinger, who was the director of the Niels Bohr Institute until Finn Aaserud succeeded him in 1989. A few months after receiving his Ph.D. in 1990, Jensen passed away. The two mentioned directors, together with Helge Kragh and Roger H. Stuewer, edited Jensen's dissertation and ten years later brought it to publication. Some newer historical references have been added, quotations were translated or paraphrased, some photographs included but-according to the editors-they made "few changes of substance." Jensen taught in a Danish Gymnasium while writing his dissertation, which is a rather complete study of a central episode in early nuclear physics. It is well worth the efforts of the distinguished corps of editors to make it available to historians of science.

  3. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  4. The chemistry of the actinide elements, Volume II

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is an exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  5. Chemistry of the actinide elements. Vol. 2. 2. Ed

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Morss, L.R.; Seaborg, G.T. (eds.)

    1986-01-01

    This is a comprehensive, exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven transuranium elements. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermodynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive list of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  6. Chemistry of the actinide elements. Vol. 1, 2nd Ed

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Morss, L.R.; Seaborg, L.R. (eds.)

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven transuranium elements. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermodynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  7. The chemistry of the actinide elements. Volume I

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  8. Gold-coated lanthanide phosphate nanoparticles for an {sup 225}Ac in vivo alpha generator

    Energy Technology Data Exchange (ETDEWEB)

    McLaughlin, M.F. [Missouri Univ., Columbia, MO (United States). Dept. of Chemistry; Oak Ridge National Lab., TN (United States); Woodward, J.; Boll, R.A.; Rondinone, A.J.; Mirzadeh, S. [Oak Ridge National Lab., TN (United States); Robertson, J.D. [Missouri Univ., Columbia, MO (United States). Dept. of Chemistry

    2013-11-01

    Retaining radioactive daughter products at a clinically relevant target site remains one of the major challenges in development of in vivo {alpha} generators with radionuclides such as {sup 225}Ac and {sup 223}Ra. In this work, we examine the ability of layered nanoparticle constructs to retain {sup 225}Ac and the first decay daughter, {sup 221}Fr. Actinium-225 is cocrystalized in a lanthanide phosphate nanoparticle consisting of varying amounts of La and Gd. Additional lanthanide phosphate layers improve retention capability while an outer layer of gold facilitates the attachment of targeting moieties for in vivo use. Retention of {sup 225}Ac in the nanoparticles is near quantitative while the {sup 221}Fr retention varies from 60-89% as a function of time, the number of layers, and nanoparticle composition. Decay corrected radiochemical yield in the multi-shell syntheses are high (76%) and comparable to or better than existing delivery approaches. (orig.)

  9. Uranium decay products found on Mir space blanket mitt.

    Science.gov (United States)

    Grismore, R; Rosen, A Z; Llewellyn, R A; Taylor, J S

    2001-01-01

    The space blanket mitt which covered the Trek detector on Mir during four years of orbital flight has been measured for gamma radiation with HPGe and multidimensional spectrometers. Difference spectra from very-long-period spectrometer runs on the mitt and on a similar non-deployed mitt from the same manufacturer show that the mitt has acquired small but significant amounts of gamma radioactivity during orbital flight. Twelve gamma-ray peaks have been measured in the difference spectra, including peaks identified as due to 214Bi and 214Pb from the uranium-radium alpha decay series, and others possibly due to the uranium-actinium series. This implies the presence of a sparse population of uranium decay products in lower orbital space which can only have come from nuclear explosions, burned-up satellite nuclear batteries, the solar wind, or supernova fragments in the local interstellar medium.

  10. Balloon Dilation of Sinus Ostia in the Department of Defense: Diagnoses, Actual Indications, and Outcomes

    Science.gov (United States)

    2016-05-18

    3.7%, 8/217), sinus barotrauma (3.2%, 7/217), headache (1.8%, 4/217), nasal airway obstruction (1.4%, 3/217), and allergic rhinitis (0.5%, 1/217...docs/pdf7 /k07304 1.pdf 7. Wang F, Song Y, Zhang X, Tan G. Sinus balloon catheter dilation in pediatric chronic rhinosinusitis resistant to medical...Endoscopic Techniques in Pediatric Sinus Surgery. Otolaryngol Head Neck Surg 2014; 151 (5):852-60. 16. Batra PS, Ryan MW, Sindwani R, Marple BF

  11. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  12. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  13. Evaluation of total effective dose due to certain environmentally placed naturally occurring radioactive materials using a procedural adaptation of RESRAD code.

    Science.gov (United States)

    Beauvais, Z S; Thompson, K H; Kearfott, K J

    2009-07-01

    Due to a recent upward trend in the price of uranium and subsequent increased interest in uranium mining, accurate modeling of baseline dose from environmental sources of radioactivity is of increasing interest. Residual radioactivity model and code (RESRAD) is a program used to model environmental movement and calculate the dose due to the inhalation, ingestion, and exposure to radioactive materials following a placement. This paper presents a novel use of RESRAD for the calculation of dose from non-enhanced, or ancient, naturally occurring radioactive material (NORM). In order to use RESRAD to calculate the total effective dose (TED) due to ancient NORM, a procedural adaptation was developed to negate the effects of time progressive distribution of radioactive materials. A dose due to United States' average concentrations of uranium, actinium, and thorium series radionuclides was then calculated. For adults exposed in a residential setting and assumed to eat significant amounts of food grown in NORM concentrated areas, the annual dose due to national average NORM concentrations was 0.935 mSv y(-1). A set of environmental dose factors were calculated for simple estimation of dose from uranium, thorium, and actinium series radionuclides for various age groups and exposure scenarios as a function of elemental uranium and thorium activity concentrations in groundwater and soil. The values of these factors for uranium were lowest for an adult exposed in an industrial setting: 0.00476 microSv kg Bq(-1) y(-1) for soil and 0.00596 microSv m(3) Bq(-1) y(-1) for water (assuming a 1:1 234U:238U activity ratio in water). The uranium factors were highest for infants exposed in a residential setting and assumed to ingest food grown onsite: 34.8 microSv kg Bq(-1) y(-1) in soil and 13.0 microSv m(3) Bq(-1) y(-1) in water.

  14. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein ... FtsH [Propionibacterium acnes KPA171202] ... Length = 253 ... Query: 158 SKDTPKSTFADVAGCQEAIDEL...QEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTGKTLLA 217 ... SKDTPKSTFADVAGCQEAIDEL...QEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTGKTLLA Sbjct: 1 ... SKDTPKSTFADVAGCQEAIDELQEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTG

  15. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  16. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities in Support of Marine and Hydrokinetic Energy Deployment

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Copping, Andrea E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Van Cleve, Frances B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2011-09-01

    This fiscal year 2011 progress report summarizes activities carried out under DOE Water Power Task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the marine and hydrokinetic (MHK) energy industry, including regulatory and resource management agencies, tribes, nongovernmental organizations, and industry.

  17. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|ZP_01061096.1| copper/silver efflux P-type ATPase [Flavobacte...rium sp. MED217] gb|EAQ49147.1| copper/silver efflux P-type ATPase [Leeuwenhoekiella blandensis MED217] ZP_01061096.1 1e-128 60% ...

  18. Resonance Capture in Unbalanced Dual-Spin Spacecraft

    Science.gov (United States)

    1994-03-01

    York, 1989. 22. Wittenburg, Jens. "Beitrige zur dynamik von gyrostaten." In Convegno Inter- nazaionale sul Tema: Metodi Valutativi Nella Fisica ...Matematica, Roma, 15-19 dicembre 1972, Problemi Attuali di Scienza e di Cultura , Quaderno N. 217, pages 217-354. Accademia Nazionale dei Lincei, 1975. 23

  19. 48 CFR 3017.9000 - Clauses (USCG).

    Science.gov (United States)

    2010-10-01

    ... will involve, or is reasonably expected to involve, increased costs, such facts and the reasons for the... (HSAR) 48 CFR 3052.217-95(b)(6) and (c)(1) consistent with contract size, inflation, and other..., inflation, and other circumstances. (c) The clause at (HSAR) 48 CFR 3052.217-100, Guarantee, shall be used...

  20. Planck 2015 results: VII. High Frequency Instrument data processing: Time-ordered information and beams

    DEFF Research Database (Denmark)

    Adam, R.; Ade, P. A R; Aghanim, N.

    2016-01-01

    The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the d...

  1. Mrp2 is essential for estradiol-17 beta(beta-D-glucuronide)-induced cholestasis in rats

    NARCIS (Netherlands)

    Huang, LY; Smit, JW; Meijer, DKF; Vore, M

    The present study evaluates the roles of the multidrug resistance-1 P-glycoprotein, Mdr1a/1b, the bile salt export pump (Bsep), and the multidrug resistance-associated protein-2 (Mrp2) in mediating cholestasis induced by estradiol-17 beta(beta-D-glucuronide) (E(2)17G). Administration of [H-3]E(2)17G

  2. NCBI nr-aa BLAST: CBRC-TTRU-01-0165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0165 ref|XP_710009.1| CTA217 antisense protein [Candida albicans SC531...4] gb|EAK90732.1| CTA217 antisense protein [Candida albicans SC5314] XP_710009.1 2e-04 36% ...

  3. Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

    African Journals Online (AJOL)

    PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 27; Issue 3. Issue front cover thumbnail. Volume 27, Issue 3. June 2004, pages 217-322. pp 217-220 Synthesis. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique · Y S Malghe A V Gurjar S R Dharwadkar.

  5. Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B.S; Ansari, Z.A; Parulekar, A

    stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 217 of 217 ... Vol 10, No 2 (2013), Urachal Adenocarcinoma, Abstract PDF. S Nguku, N Twahirwa, P Mburugu, K Rukaria, J Etabale, F Githae, M Tharao. Vol 4 (2009), Ureteric injuries following laparoscopic hysterectomy: A report of three cases, Abstract PDF. RB Parkar, Y Patel, A Chudasama,. Vol 11, No 1 (2014) ...

  7. GETDB: 103857 [GETDB

    Lifescience Database Archive (English)

    Full Text Available (SG) ubiquitous epi, fb, gut no specific pattern - - comment1:A, comment2:17C5 - ...GFP no specific pattern Lethality - Also known as - Original Comments comment1:A, comment2:17C5 Disc (Image)

  8. Biochemical composition of zooplankton from the northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, K.L.; Sreepada, R.A; Ansari, Z.A

    stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  9. 77 FR 61593 - North American Natural Resources, Inc. Complainant v. PJM Interconnection, L.L.C, American...

    Science.gov (United States)

    2012-10-10

    ... interconnection costs as Network Upgrades and allocate those costs to AEP and its customers, failed to update AEP's Regional Transmission System Expansion (RTEP) and wrongfully foisted the costs of the Network... sections 1.7A.02, 1.3A, 1.17A, 1.26, 212.4, 217.3, 205, 206 and 217 of PJM's Open Access Transmission...

  10. NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-01-0068 ref|ZP_01038050.1| Nitric oxide reductase large subunit, cytochrome b [Rose...ovarius sp. 217] gb|EAQ23442.1| Nitric oxide reductase large subunit, cytochrome b [Roseovarius sp. 217] ZP_01038050.1 2.6 29% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0832 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-0513 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0513 ref|ZP_01059110.1| transporter, NRAMP family protein [Leeuwenhoek...iella blandensis MED217] gb|EAQ50942.1| transporter, NRAMP family protein [Leeuwenhoekiella blandensis MED217] ZP_01059110.1 0.15 26% ...

  14. AcEST: BP915861 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LAO Cell division protein ftsZ OS=Leeuwenhoek... 33 7.0 tr|B2VQY7|B2VQY7_PYRTR Predicted protein OS=Pyrenoph...NKTDS 168 >tr|A3XI85|A3XI85_9FLAO Cell division protein ftsZ OS=Leeuwenhoekiella blandensis MED217 GN=MED217

  15. AcEST: BP913978 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 5.0 tr|A3XJS4|A3XJS4_9FLAO Pseudouridine synthase OS=Leeuwenhoekiell... 33 6.5...udouridine synthase OS=Leeuwenhoekiella blandensis MED217 GN=MED217_04192 PE=3 SV=1 Length = 265 Score = 33.

  16. NCBI nr-aa BLAST: CBRC-TTRU-01-1191 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1191 ref|ZP_01059110.1| transporter, NRAMP family protein [Leeuwenhoek...iella blandensis MED217] gb|EAQ50942.1| transporter, NRAMP family protein [Leeuwenhoekiella blandensis MED217] ZP_01059110.1 0.81 28% ...

  17. NCBI nr-aa BLAST: CBRC-TTRU-01-0751 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0751 ref|ZP_01059110.1| transporter, NRAMP family protein [Leeuwenhoek...iella blandensis MED217] gb|EAQ50942.1| transporter, NRAMP family protein [Leeuwenhoekiella blandensis MED217] ZP_01059110.1 0.086 28% ...

  18. AcEST: BP915836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available udouridine synthase OS=Leeuwenhoekiell... 33 5.8 tr|A8L3M4|A8L3M4_FRASN Acyltransferase 3 OS=Frankia sp. (st...9FLAO Pseudouridine synthase OS=Leeuwenhoekiella blandensis MED217 GN=MED217_04192 PE=3 SV=1 Length = 265 Sc

  19. NCBI nr-aa BLAST: CBRC-TTRU-01-1149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1149 ref|ZP_01061727.1| putative transmembrane ion channel [Leeuwenhoe...kiella blandensis MED217] gb|EAQ48690.1| putative transmembrane ion channel [Leeuwenhoekiella blandensis MED217] ZP_01061727.1 0.025 32% ...

  20. Parameters. US Army War College Quarterly. Volume 25. Number 1. Spring 1995,

    Science.gov (United States)

    1995-01-01

    Massacre de notre Infanterie 1914-1918 (Paris: Albin Michel, 1921), pp. 10, 13-14, 217-18. 16. Ibid., pp. 217-18. 17. Shelford Bidwell and Dominick...rather the way that college sports teams are suspended for improper recruiting activities or that scientific research teams are subjected to rigorous

  1. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.

    2016-03-09

    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  2. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  3. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

    2011-03-15

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

  4. Review of radionuclide source terms used for performance-assessment analyses; Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ``uranium`` and 4n+3 ``actinium`` decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides.

  5. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  6. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  7. Measurements of gamma radiation levels and spectra in the San Francisco Bay Area

    Science.gov (United States)

    Lo, B. T.; Brozek, K. P.; Angell, C. T.; Norman, E. B.

    2011-10-01

    Much of the radiation received by an average person is emitted by naturally-occurring radioactive isotopes from the thorium, actinium, and uranium decay series, or potassium. In this study, we have measured gamma radiation levels at various locations in the San Francisco Bay Area and the UC Berkeley campus from spectra taken using an ORTEC NOMAD portable data acquisition system and a large-volume coaxial HPGe detector. We have identified a large number of gamma rays originating from natural sources. The most noticeable isotopes are 214Bi, 40K, and 208Tl. We have observed variations in counting rates by factors of two to five between different locations due to differences in local conditions - such as building, concrete, grass, and soil compositions. In addition, in a number of outdoor locations, we have observed 604-, 662-, and 795-keV gamma rays from 134,137Cs, which we attribute to fallout from the recent Fukushima reactor accident. The implications of these results will be discussed. This work was supported in part by a grant from the U. S. Dept. of Homeland Security.

  8. Rapid Column Extraction Method for Actinides and Sr-89/90 in Water Samples

    Energy Technology Data Exchange (ETDEWEB)

    MAXWELL III, SHERROD L.

    2005-06-15

    The SRS Environmental Laboratory analyzes water samples for environmental monitoring, including river water and ground water samples. A new, faster actinide and strontium 89/90 separation method has been developed and implemented to improve productivity, reduce labor costs and add capacity to this laboratory. This method uses stacked TEVA Resin{reg_sign}, TRU Resin{reg_sign} and Sr-Resin{reg_sign} cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), curium (Cm) and thorium (Th) using a single multi-stage column combined with alpha spectrometry. By using vacuum box cartridge technology with rapid flow rates, sample preparation time is minimized. The method can be used for routine analysis or as a rapid method for emergency preparedness. Thorium and curium are often analyzed separately due to the interference of the daughter of Th-229 tracer, actinium (Ac)-225, on curium isotopes when measured by alpha spectrometry. This new method also adds a separation step using DGA Resin{reg_sign}, (Diglycolamide Resin, Eichrom Technologies) to remove Ac-225 and allow the separation and analysis of thorium isotopes and curium isotopes at the same time.

  9. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  10. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  11. Two genes required for meiotic recombination in Drosophila are expressed from a dicistronic message.

    Science.gov (United States)

    Liu, H; Jang, J K; Graham, J; Nycz, K; McKim, K S

    2000-04-01

    We have isolated two alleles of a previously unidentified meiotic recombination gene, mei-217. Genetic analysis of these mutants shows that mei-217 is a typical "precondition" gene. The phenotypes of the mutants are meiosis specific. The strongest allele has <10% of the normal level of crossing over, and the residual events are distributed abnormally. We have used double mutant analysis to position mei-217 in the meiotic recombination pathway. In general, mutations causing defects in the initiation of meiotic recombination are epistatic to mutations in mei-41 and spnB. These two mutations, however, are epistatic to mei-217, suggesting that recombination is initiated normally in mei-217 mutants. It is likely that mei-217 mutants are able to make Holliday junction intermediates but are defective in the production of crossovers. These phenotypes are most similar to mutants of the mei-218 gene. This is striking because mei-217 and mei-218 are part of the same transcription unit and are most likely produced from a dicistronic message.

  12. Adjunctive levetiracetam in children, adolescents, and adults with primary generalized seizures: Open-label, noncomparative, multicenter, long-term follow-up study.

    LENUS (Irish Health Repository)

    Delanty, Norman

    2012-02-01

    Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive

  13. EST Table: CN211768 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CN211768 rzhswab0_001664 10/09/28 88 %/215 aa ref|NP_001040385.1| pelota-like prote...in [Bombyx mori] gb|ABF51295.1| pelota-like protein [Bombyx mori] 10/09/01 70 %/217 aa FBpp0253329|DwilGK241...|gene:AGAP008269 10/09/10 65 %/217 aa gnl|Amel|GB10750-PA 10/09/10 65 %/217 aa gi|91095145|ref|XP_967126.1| PREDICTED: similar to pelota [Tribolium castaneum] FS917768 L12 ...

  14. Teadlasena poliitikas - võimalused ja piirid = Als Wissenschaftler in der Politik - Chancen und Grenzen / Eiki Berg

    Index Scriptorium Estoniae

    Berg, Eiki, 1970-

    2005-01-01

    Autori hinnangul lasub teadlasel poliitikas suurem vastutus kui mistahes valdkonna esindajal, sest teaduslikult argumenteeritud poliitilised otsused on teadmiste jõu ja poliitilise võimu sümbioos. Vt. ka kommentaare lk. 217-222,467-472

  15. 78 FR 3882 - Endangered Species; File No. 13543

    Science.gov (United States)

    2013-01-17

    ... South Carolina Department of Natural Resources, 217 Ft. Johnson Rd., Charleston, SC 29412, has requested... be appropriate. FOR FURTHER INFORMATION CONTACT: Amy Hapeman or Kristy Beard, (301) 427-8401...

  16. Drug: D03328 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03328 Drug Carperitide (genetical recombination) (JAN); Carperitide (USAN/INN); Ha...l organs 21 Cardiovascular agents 217 Vasodilators 2179 Others D03328 Carperitide (genetical recombination)

  17. Index-2015

    Indian Academy of Sciences (India)

    IAS Admin

    ) (FT). Annona muricata L. (6) (FT). Answers (1) 73 (CR). Antibiotic (8) 711 (GA). Arduino microcontroller (5) 458 (CR). Aspirin (12) 1136 (GA). Assignment of stereochemical configuration by comparison of acid ionization con stants (3) 217 (GA).

  18. Cognitive Behaviour Therapy in the Management of Eating Disorder ...

    African Journals Online (AJOL)

    , SD = 4.56; t = 2.17, p < .05). The modified Cognitive Behaviour Therapy employed in the study may be helpful in reversing this trend. Keywords: Eating disorders, Anorexia nervosa, Bulimia nervosa, Obesity, Cognitive Behaviour therapy ...

  19. 77 FR 25166 - EPA-New England Region I; Massachusetts Marine Sanitation Device Standard; Receipt of Petition

    Science.gov (United States)

    2012-04-27

    ...) of Public Law 92-500 as amended by Public Law 95-217 and Public Law 100-4, that adequate facilities..., including soft- shell clams, surf clams, blue mussels, oysters, ocean quahogs, and the state's only...

  20. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... 2,403 views 5:31 Investigator Insights: Using Service Connected Disability Hearings as Gateway to Pain Management ... VA Community Care Network - Duration: 2:17. Veterans Health Administration ...

  1. Drug: D00251 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 217.2853 D00251.gif Antihypertensive; Enzyme inhibitor [angiotensin-converting] Therapeutic category: 2144 ...category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihypertensive

  2. Growdon Gate/Road Relocation and Property Acquisition Environmental Assessment. Volume 1

    Science.gov (United States)

    2012-11-01

    Metropolitan San Antonio Interstate AQCR 217, which consists of the counties of Atascosa, Bandera , Bexar, Comal, Dimmitt, Edwards, Frio, Gillespie... Bandera , Bexar, Comal, Guadalupe, Kendall, Medina, and Wilson Counties (Bexar County 2010). The installation generates economic activity in the region

  3. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  4. Neuropsychiatric manifestations in patients with systemic lupus erythematosus: A study from Iran

    Directory of Open Access Journals (Sweden)

    Fatemeh Hajighaemi

    2016-01-01

    Conclusions: We identified NPSLE manifestations in 21.7% of patients; headache and CVD were the most frequent neurological manifestations. Continued studies into the pathogenesis of neurological involvement in patients with SLE are warranted.

  5. Hopelessness and suicidal behavior among Chinese, Thai and Korean college students and predictive effects of the World Health Organization's WHOQOL-BREF

    National Research Council Canada - National Science Library

    Kay, Noy; Li, Kaigang; Xiao, Xia; Nokkaew, Nattiporn; Park, Bock-Hee

    2009-01-01

    ...-BREF instrument among college students (n=1,217) in China, Thailand, and Korea. Results showed 3.7% Thai, 10% Chinese, and 13.2% Korean students exhibited suicidal behavior in the past 12 months...

  6. Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

    Czech Academy of Sciences Publication Activity Database

    Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.

    2015-01-01

    Roč. 285, 1 July (2015), s. 217-226 ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.333, year: 2015

  7. AcEST: BP918906 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LVKLMDRSGPVIDQLSNEVASETLHACCP 390 Query: 217 LLRQQKYFEICFAWIQQVADLVVS---DGMDFSENVKKELLLSLQE-RVATSMIADSSGT 50...ANELLHTVAH 218 W+ W + ++ DM+SA++EVLST D +LV+LM R+GPV DQL++ A+E LH Sbjct: 331 WTSWTNAMDAFSVGDMDSAFSEVLSTGDDFL

  8. 77 FR 64409 - Designation of Taiwan for the Visa Waiver Program

    Science.gov (United States)

    2012-10-22

    ... regulatory philosophy and principles set forth in Executive Orders 12866 and 13563. DHS does not consider..., 1187; 8 CFR part 2. 0 2. In Sec. 217.2 the definition of the term ``Designated country'' in paragraph...

  9. Field Plot and Observation Points for Dinosaur National Monument Vegetation Mapping Project

    Data.gov (United States)

    National Park Service, Department of the Interior — This point file displays the 727 vegetation plots and 217 observation points visited in 2002, 2003 and 2004 as part of the vegetation mapping project. Plots and...

  10. Effectiveness of Technolas torsional eye tracking system on visual outcomes after photorefractive keratectomy

    Directory of Open Access Journals (Sweden)

    Hamid Gharaee

    2015-09-01

    Conclusion: Our study findings suggest that applying ‘Technolas 217z’ eye tracker system (Bausch and Lomb Advanced results in a more regular anterior surface of cornea. Therefore, we recommend it for surface laser refractive surgery.

  11. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  12. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  13. Drug: D10347 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 85'-90', 157'-217', 263'-321'; glycosylation sites (N) :Asn23, Asn46, Asn-193) Peptide Treatment of disea...ses that involve loss of skeletal muscle mass, strength, integrity Myostatin inhibi

  14. Download this PDF file

    African Journals Online (AJOL)

    cadewumi

    carbon nanotube and layered double hydroxide as a drug delivery system especially in ... Material and Methods: Transmission and field emission scanning electron ..... Handbook: Pages217–234; Inorganic Nanostructures for Drug Delivery.

  15. 75 FR 28019 - Resmethrin; Notice of Receipt of Requests to Voluntarily Cancel Certain Pesticide Registrations

    Science.gov (United States)

    2010-05-19

    ..., recreational, and residential areas to control flying and crawling insects. All remaining resmethrin end use... reproduction 2.1.7 Hershberger (rat) 2.1.8 Female Pubertal (rat) 2.1.9 Male pubertal (rat) 2.1.10...

  16. Human factors issues in motorcoach emergency egress

    Science.gov (United States)

    2009-08-01

    FMVSS 217, Bus Emergency Exits and Window Retention and Release specifies a series of dimensional and physical requirements : for emergency exits. The intent of NHTSA is to minimize the likelihood of occupants being ejected from the bus and to pro...

  17. Hastings Center

    Science.gov (United States)

    ... of the Affordable Care Act. I see this debate as having ended—as of this writing—in a draw. After months of repeal efforts, Republicans in the House barely passed in early May, with a 217- ...

  18. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Meenakshi Bhat. Articles written in Journal of Biosciences. Volume 40 Issue 2 June 2015 pp 217-220 Perspectives. Social and cultural issues in genetic counselling · Meenakshi Bhat · More Details Fulltext PDF ...

  19. 32 CFR 536.2 - Claims authorities.

    Science.gov (United States)

    2010-07-01

    ... this part). The Westfall Act, 28 U.S.C. 2679, an integral part of the FTCA, provides absolute immunity... Reserve Officers Training Corps (ROTC) cadets, respectively, (see DA Pam 27-162, paragraph 2-17d(2)). (4...

  20. Data of evolutionary structure change: 1CKDA-2G4ND [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CKDA-2G4ND 1CKD 2G4N A D KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...TKCEVFRELKDL--KGYGGVSLPEWVCTTFHTSGYDTQAIVQNN--DSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDK-VGINYWLA... 217 1CKD A GLU CA 401 TYR CA 433 1CKD A 1CKDA VNYNAGDRS

  1. The Effects of Internal Tides on Acoustic Propagation in the Philippine Sea

    Science.gov (United States)

    2013-09-01

    seismic field in the seabed and sound propagation in the water column (Worcester 2013). This thesis focuses on the data collected during the 2009...midpoint. Equations 2.17 and 2.18 were used to implement the model in Matlab . (2.17) (2.18) Of note, the model is a data driven model that was...experiment in order to conduct a statistical analysis of the eigenrays. The Matlab findpeaks function was used on the SNR data to isolate receptions

  2. Support Net for Frontline Providers

    Science.gov (United States)

    2016-03-01

    With a multidisciplinary team that included an external evaluator (Dr. Robert Durham), and an extended research team (Drs. Alan Peterson and Bret...21.7%) indicated being single. The sample of providers included 13 clinical psychologists (21.7%), 17 counselors or psychotherapists (28.3%), three...a sample of service members from Iraq and Afghanistan. Military Medicine, 172, 359–363. Figley, C. R. (2002). Compassion fatigue: Psychotherapists

  3. Earth observation scientific workflows in a distributed computing environment

    CSIR Research Space (South Africa)

    Van Zyl, TL

    2011-09-01

    Full Text Available infrastructure a reality, pages 217?250, 2003. URL http://books.google.com/books?hl=en&lr=&id=b4LWXLRBRLsC&oi=fnd&pg=PA217&dq=The+Physiology+of+the+Grid&ots=GRSfF6W5UU&sig=voJQ77c-xm5Z1Za9tfImoKFDC7I. A. Gibson, M. Gamble, K...

  4. Drug: D07560 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07560 Drug Adrenalone hydrochloride; Stryphnasal (TN) C9H11NO3. HCl 217.0506 217.6...ICAL PREPARATIONS A01AD Other agents for local oral treatment A01AD06 Adrenalone D07560 Adrenalone hydr...ER HEMOSTATICS B02BC Local hemostatics B02BC05 Adrenalone D07560 Adrenalone hydrochloride CAS: 62-13-5 PubCh

  5. Advanced Computational Methods for Optimization of Non Periodic Inspection Intervals for Aging Infrastructure

    Science.gov (United States)

    2017-01-05

    Research (AFOSR)/ IOA Arlington, Virginia 22203 Air Force Research Laboratory Air Force Materiel Command a. REPORT Unclassified b. ABSTRACT...0 −′] −1 ′⁄ (2-16) as: = + 1 ′ ( −′ − 0 −′) . (2-17) Differential dtc can be calculated as: d...Approved for public release: distribution unlimited. 10 Substituting tc of eq. (2-17) and dtc of eq. (2-18) into eq. (2-19), the probability is

  6. Laser Hazards Bibliography - October 1984,

    Science.gov (United States)

    1984-10-31

    complications of photocoagulations by argon laser. Discussion of a case, Bull Soc Ophth France’, 75(4): 368-373 (1975) (French). 217. Haut, J., Bernard , J...induced glaucoma in rabbits, J Med Liban, 27(5): 567-574 (1974). 244. Kidwell , T. P., Priebe, L. A., and Welsh, A. J., The measurement of ocular...I 217. Kidwell , T. P., Priebe, L. A., and Welch, A. 3., The measurement of ocular transmittance and irradiation distribution in argon laser

  7. AcEST: BP917913 [AcEST

    Lifescience Database Archive (English)

    Full Text Available M88|A3XM88_9FLAO Acetyltransferase OS=Leeuwenhoekiella bla... 33 5.4 tr|Q9U0Z7|Q9U0Z7_LEIMA Hypothetical tra...88|A3XM88_9FLAO Acetyltransferase OS=Leeuwenhoekiella blandensis MED217 GN=MED217_07986 PE=4 SV=1 Length = 1

  8. Improved (225)Ac daughter retention in InPO4 containing polymersomes.

    Science.gov (United States)

    de Kruijff, R M; Drost, K; Thijssen, L; Morgenstern, A; Bruchertseifer, F; Lathouwers, D; Wolterbeek, H T; Denkova, A G

    2017-10-01

    Alpha-emitting radionuclides like actinium-225 ((225)Ac) are ideal candidates for the treatment of small metastasised tumours, where the long half-life of (225)Ac enables it to also reach less accessible tumours. The main challenge lies in retaining the recoiled alpha-emitting daughter nuclides, which are decoupled from targeting agents upon emission of an alpha particle and can subsequently cause unwanted toxicity to healthy tissue. Polymersomes, vesicles composed of amphiphilic block copolymers, are capable of transporting (radio)pharmaceuticals to tumours, and are ideal candidates for the retention of these daughter nuclides. In this study, the Geant4 Monte Carlo simulation package was used to simulate ideal vesicle designs. Vesicles containing an InPO4 nanoparticle in the core were found to have the highest recoil retention, and were subsequently synthesized in the lab. The recoil retention of two of the daughter nuclides, namely francium-221 ((221)Fr) and bismuth-213 ((213)Bi) was determined at different vesicle sizes. Recoil retention was found to have improved significantly, from 37 ± 4% and 22 ± 1% to 57 ± 5% and 40 ± 2% for (221)Fr and (213)Bi respectively for 100nm polymersomes, as compared to earlier published results by Wang et al. where (225)Ac was encapsulated using a hydrophilic chelate (Wang et al. 2014). To better understand the different parameters influencing daughter retention, simulation data was expanded to include vesicle polydispersity and nanoparticle position within the polymersome. The high retention of the recoiling daughters and the (225)Ac itself makes this vesicle design very suitable for future in vivo verification. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Efforts to control the errant products of a targeted in vivo generator.

    Science.gov (United States)

    Jaggi, Jaspreet Singh; Kappel, Barry J; McDevitt, Michael R; Sgouros, George; Flombaum, Carlos D; Cabassa, Catalina; Scheinberg, David A

    2005-06-01

    Alpha-particle immunotherapy by targeted alpha-emitters or alpha-emitting isotope generators is a novel form of extraordinarily potent cancer therapy. A major impediment to the clinical use of targeted actinium-225 (225Ac) in vivo generators may be the radiotoxicity of the systemically released daughter radionuclides. The daughters, especially bismuth-213 (213Bi), tend to accumulate in the kidneys. We tested the efficacy of various pharmacologic agents and the effect of tumor burden in altering the pharmacokinetics of the 225Ac daughters to modify their renal uptake. Pharmacologic treatments in animals were started before i.v. administration of the HuM195-225Ac generator. 225Ac, francium-221 (221Fr), and 213Bi biodistributions were calculated in each animal at different time points after 225Ac generator injection. Oral metal chelation with 2,3-dimercapto-1-propanesulfonic acid (DMPS) or meso-2,3-dimercaptosuccinic acid (DMSA) caused a significant reduction (P < 0.0001) in the renal 213Bi uptake; however, DMPS was more effective than DMSA (P < 0.001). The results with DMPS were also confirmed in a monkey model. The renal 213Bi and 221Fr activities were significantly reduced by furosemide and chlorothiazide treatment (P < 0.0001). The effect on renal 213Bi activity was further enhanced by the combination of DMPS with either chlorothiazide or furosemide (P < 0.0001). Competitive antagonism by bismuth subnitrate moderately reduced the renal uptake of 213Bi. The presence of a higher target-tumor burden significantly prevented the renal 213Bi accumulation (P = 0.003), which was further reduced by DMPS treatment (P < 0.0001). Metal chelation, diuresis with furosemide or chlorothiazide, and competitive metal blockade may be used as adjuvant therapies to modify the renal accumulation of 225Ac daughters.

  10. A survey of arsenic, manganese, boron, thorium, and other toxic metals in the groundwater of a West Bengal, India neighbourhood.

    Science.gov (United States)

    Bacquart, Thomas; Bradshaw, Kelly; Frisbie, Seth; Mitchell, Erika; Springston, George; Defelice, Jeffrey; Dustin, Hannah; Sarkar, Bibudhendra

    2012-07-01

    Around 150 million people are at risk from arsenic-contaminated groundwater in India and Bangladesh. Multiple metal analysis in Bangladesh has found other toxic elements above the World Health Organization (WHO) health-based drinking water guidelines which significantly increases the number of people at risk due to drinking groundwater. In this study, drinking water samples from the Bongaon area (North 24 Parganas district, West Bengal, India) were analyzed for multiple metal contamination in order to evaluate groundwater quality on the neighbourhood scale. Each sample was analyzed for arsenic (As), boron (B), barium (Ba), chromium (Cr), manganese (Mn), molybdenum (Mo), nickel (Ni), lead (Pb), and uranium (U). Arsenic was found above the WHO health-based drinking water guideline in 50% of these tubewells. Mn and B were found at significant concentrations in 19% and 6% of these tubewells, respectively. The maps of As, Mn, and B concentrations suggest that approximately 75% of this area has no safe tubewells. The concentrations of As, Mn, B, and many other toxic elements are independent of each other. The concentrations of Pb and U were not found above WHO health-based drinking water guidelines but they were statistically related to each other (p-value = 0.001). An analysis of selected isotopes in the Uranium, Actinium, and Thorium Radioactive Decay Series revealed the presence of thorium (Th) in 31% of these tubewells. This discovery of Th, which does not have a WHO health-based drinking water guideline, is a potential public health challenge. In sum, the widespread presence and independent distribution of other metals besides As must be taken into consideration for drinking water remediation strategies involving well switching or home-scale water treatment.

  11. An aerial radiological survey of the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Hendricks, T J; Riedhauser, S R

    1999-12-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys.

  12. Does rarity mean imparity? Biological characteristics of osteosarcoma cells originating from the spine.

    Science.gov (United States)

    Zhou, Zhenhua; Li, Yan; Yan, Xu; Wang, Xudong; Yang, Cheng; Wei, Haifeng; Yang, Xinghai; Xiao, Jianru

    2017-10-01

    Osteosarcoma is one of the most common malignancies in bones and is often found in limbs. Until now, it is not clear why osteosarcoma is rare in the spine. On the other hand, previous biological characteristics study about osteosarcoma of spine was also rare because of its low incidence. To explore the biology of spinal osteosarcoma, a stable osteosarcoma cell line derived from spine is necessary. A novel osteosarcoma cell line named NEO217 was established from spinal osteosarcoma tissues obtained from a Chinese male patient. We performed a series of experiments to investigate the biological properties of NEO217, including cell morphology, the kinetics of cell growth, biomarkers and tumorigenicity. The cell line NEO217 was passaged in vitro for more than 50 generations. Ultramicroscopic structural features of these cells were consistent with the pleomorphism characteristic of cancer cells. The average cell doubling time was 26 h. The chromosomal morphology was that of a human karyotype, with the number of chromosomes more than 80. NEO217 cells and available osteosarcoma cell lines such as MG-63 and MNNG/HOS were all CD29+CD59+ phenotype as detected by flow cytometry. Inoculation of NEO217 cells to immunodeficient mice led to tumor formation. The biological and molecular properties of NEO217 cell line are not exactly the same as some human osteosarcoma cell lines derived from the extremities. We have established a novel osteosarcoma cell line NEO217 derived from the spine, which will provide a useful model for biological or therapeutical studies of spinal osteosarcoma.

  13. Biochemical control of CARM1 enzymatic activity by phosphorylation.

    Science.gov (United States)

    Feng, Qin; He, Bin; Jung, Sung-Yun; Song, Yongcheng; Qin, Jun; Tsai, Sophia Y; Tsai, Ming-Jer; O'Malley, Bert W

    2009-12-25

    Coactivator-associated arginine methyltransferase 1 (CARM1) is a dual functional coregulator that facilitates transcription initiation by methylation of Arg(17) and Arg(26) of histone H3 and also dictates the subsequent coactivator complex disassembly by methylation of the steroid receptor coactivator family coactivators and p300/cAMP-response element-binding protein-binding protein. However, the regulation of CARM1 enzymatic activity and substrate specificity remains largely unknown. In this study, we report that CARM1 function is regulated by phosphorylation at Ser(217), a residue completely conserved in the type I protein arginine methyltransferase (PRMT) family of enzymes. Comparative analysis of the published CARM1 crystal structures reveals that the hydroxyl group of Ser(217) forms a strong hydrogen bond with the carbonyl oxygen atom of Tyr(154) to lock the cofactor S-adenosylmethionine inside the binding cavity. Phosphorylation of Ser(217) disrupts this hydrogen bond and subsequently abolishes S-adenosylmethionine binding and its methyltransferase activity. Importantly, Tyr(154) is also conserved in the type I PRMT family of enzymes, suggesting a general role of this hydrogen bond in maintaining the holo structure of the type I PRMT catalytic domain. Moreover, we found that phosphorylation at Ser(217) also promoted CARM1 cytoplasmic localization and that this translocation occurred mainly during mitosis. We propose that phosphorylation at Ser(217) serves as a molecular switch for controlling CARM1 enzymatic activity during the cell cycle.

  14. Control system for detection of the illegal use of naturally occurring steroids in calves.

    Science.gov (United States)

    Arts, C J; van Baak, M J; den Hartog, J M

    1991-04-05

    Within the scope of the National Plan for Hormone Control in The Netherlands, a study was performed to develop a system for control of the illegal use of three naturally occurring hormones [oestradiol-17 beta (E2-17 beta), testosterone (T), progesterone (P)] for fattening purposes in animal production. Using a specific high-performance liquid chromatographic-radioimmunoassay method, reference values were established for concentrations of E2-17 beta, T and P and some of their metabolites in blood plasma and urine from untreated male and female veal calves. E2-17 beta levels of both male and female calves were less than 0.01 microgram/l in blood plasma and less than 0.2 microgram/l in urine. For male veal calves levels of T and epitestosterone (epiT) in blood plasma and urine varied widely. The P levels were less than 0.1-0.3 micrograms/l in blood plasma and less than 0.6-10 micrograms/l in urine from both male and female calves. To investigate the effect of anabolic treatment on the hormone levels in plasma and excreta, male veal calves were injected, subcutaneously into the dewlap, with a solution containing 20 mg of E2-17 beta benzoate and 200 mg of T propionate in 5 ml of arachis oil. Only the levels of E2-17 beta and E2-17 alpha in blood plasma and excreta were elevated until about one week after injection, compared with the untreated control calves and the reference values. T and epiT levels were similar in plasma and excreta from both untreated and treated animals.

  15. Statistics of the fractional polarization of extragalactic dusty sources in Planck HFI maps

    Science.gov (United States)

    Bonavera, L.; González-Nuevo, J.; De Marco, B.; Argüeso, F.; Toffolatti, L.

    2017-11-01

    We estimate the average fractional polarization at 143, 217 and 353 GHz of a sample of 4697 extragalactic dusty sources by applying stacking technique. The sample is selected from the second version of the Planck Catalogue of Compact Sources at 857 GHz, avoiding the region inside the Planck Galactic mask (fsky ˜ 60 per cent). We recover values for the mean fractional polarization at 217 and 353 GHz of (3.10 ± 0.75) per cent and (3.65 ± 0.66) per cent, respectively, whereas at 143 GHz we give a tentative value of (3.52 ± 2.48) per cent. We discuss the possible origin of the measured polarization, comparing our new estimates with those previously obtained from a sample of radio sources. We test different distribution functions and we conclude that the fractional polarization of dusty sources is well described by a log-normal distribution, as determined in the radio band studies. For this distribution we estimate μ217GHz = 0.3 ± 0.5 [that would correspond to a median fractional polarization of Πmed = (1.3 ± 0.7) per cent] and μ353GHz = 0.7 ± 0.4 (Πmed = (2.0 ± 0.8) per cent), σ217GHz = 1.3 ± 0.2 and σ353GHz = 1.1 ± 0.2. With these values we estimate the source number counts in polarization and the contribution given by these sources to the Cosmic Microwave Background B-mode angular power spectrum at 217, 353, 600 and 800 GHz. We conclude that extragalactic dusty sources might be an important contaminant for the primordial B-mode at frequencies >217 GHz.

  16. Presentation of child sexual abuse cases to Queen Elizabeth Central Hospital following the establishment of an HIV post-exposure prophylaxis programme.

    Science.gov (United States)

    Chesshyre, Emily L D; Molyneux, Elizabeth M

    2009-06-01

    To review the presentation and management of child sexual abuse cases presenting to Queen Elizabeth Central Hospital (QECH), Blantyre, since the introduction of an HIV postexposure prophylaxis programme. Demographic and medical data was collected from all children presenting to Queen Elizabeth Central Hospital, Blantyre, Malawi between January 2005 and February 2007 with alleged child sexual abuse (CSA). Between January 2005 and February 2007, 217 children presented with alleged CSA. This an average of 3 more per month since the previous year, a 57 percent increase. Physical examination showed signs of trauma 60% (130/217) of cases. 63% (137/217) of the cases presented within 72 hours of defilement. Overall in 42% (92/217) of children a one month course of HIV PEP was indicated and given. In 58% (125/217) HIV PEP was not indicated in view of normal examination, presentation too late (>72 hrs after abuse), multiple abuse episodes in the last 6 months, HIV test positive or HIV test refused. In 66% (144/217) of assessed children antibiotic treatment was given for the prevention and/ or treatment of sexually transmitted infections (STIs). The introduction of an HIV PEP programme for victims of CSA has lead to increased numbers presenting and being treated. In conclusion it is likely that a significant number of children have been prevented from acquiring HIV and other STIs following CSA. The key area where our service needs to be improved is in establishing documented follow up of all cases to monitor medication compliance, side effects and rates of HIV seroconversion following CSA.

  17. Differences between users and non-users of emergency contraception after a recognized unprotected intercourse

    DEFF Research Database (Denmark)

    Sørensen, M B; Pedersen, B L; Nyrnberg, L E

    2000-01-01

    Knowledge of emergency contraception is crucial but might not transform into use. Factors influencing decision-making related to use of emergency contraception after an unprotected intercourse and the characteristics of users of emergency contraception (EC) were assessed. In an abortion clinic...... setting, 217 women referred for termination of pregnancy were asked to fill in a questionnaire. Of the 217 women, 139 (64%) were aware of pregnancy risk but only 9 (4%) had used EC after the unprotected intercourse. 42% were estimated to have sufficient knowledge to use hormonal emergency contraception...

  18. Statistics of the fractional polarisation of extragalactic dusty sources in Planck HFI maps

    OpenAIRE

    Bonavera, L.; Gonzalez-Nuevo, J.; De Marco, B.; Argüeso, F.; Toffolatti, L.

    2017-01-01

    We estimate the average fractional polarisation at 143, 217 and 353 GHz of a sample of 4697 extragalactic dusty sources by applying stacking technique. The sample is selected from the second version of the Planck Catalogue of Compact Sources at 857 GHz, avoiding the region inside the Planck Galactic mask (fsky ~ 60 per cent). We recover values for the mean fractional polarisation at 217 and 353 GHz of (3.10 \\pm 0.75) per cent and (3.65 \\pm 0.66) per cent, respectively, whereas at 143 GHz we g...

  19. Four marine-derived fungi for bioremediation of raw textile mill effluents

    Digital Repository Service at National Institute of Oceanography (India)

    Verma, A.K.; Raghukumar, C.; Verma, P.; Shouche, Y.S.; Naik, C.G.

    stream_size 62026 stream_content_type text/plain stream_name Biodegradation_21_217a.pdf.txt stream_source_info Biodegradation_21_217a.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 1 Author... of both the effluents in the presence of culture supernatants from basidiomycetes than the ascomycetes. Culture supernatants from laccase-hyper-producing isolate #2a and commercial laccase preparation of Tremetes versicolor, at varying concentrations...

  20. Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity

    DEFF Research Database (Denmark)

    Sorensen, Anders B.; Madsen, Jesper Jonasson; Svensson, L. Anders

    2016-01-01

    -ray crystallography, we show that the introduced 170 loop from trypsin directly interacts with the FVIIa active site, stabilizing segment 215-217 and activation loop 3, leading to enhanced activity. Molecular dynamics simulations and novel fluorescence quenching studies support that segment 215-217 conformation...... is pivotal to the enhanced activity of the FVIIa variants. We speculate that the allosteric regulation of FVIIa activity by TF binding follows a similar path in conjunction with protease domain N terminus insertion, suggesting a more complete molecular basis of TF-mediated allosteric enhancement of FVIIa...

  1. Diagnostic value of a coagglutination procedure using monoclonal antibodies to Bacteroides gingivalis.

    Science.gov (United States)

    Shklair, I L; Simonson, L G; Bial, J J

    1988-01-01

    A specific monoclonal antibody against Bacteroides gingivalis was bound to particles coated with protein A and evaluated for use in a coagglutination test. B. gingivalis was the only organism tested which gave a specific positive reaction with the CoA reagent. Subgingival plaque samples were collected from 217 patients diagnosed as having periodontitis. Organisms that gave biochemical reactions which indicated they were B. gingivalis were isolated from eleven of the 217 gingival pockets. These eleven strains were the only organisms which gave a positive reaction using the CoA test.

  2. Indice botánico

    OpenAIRE

    2015-01-01

    Achiote: 91, 94, 198 Aguaje: 156 Aji: 59, 74, 171 Alamo: 171 Algodón: 94, 110, 124 Aliso: 52 Alnus acuminata: ver aliso Aloes: 171 Altramuce: 44 Arachis hypogaea: ver maní Arracacha esculenta: 69 Arveja: 74 Asaí: ver palmera Bactris gasipaes: 141 Balsa palo de: 180 Befaría ledifolia: 64 Bertholetia excelsa: 154 Bixa orellana: ver achiote Bombax: 178 Bombonax: ver palmera Barbasco: 199 Cabeza de negro: ver Humiro Cacao: 194, 217 Café: 175, 179, 217 Camote: 62, 69, 74, 97, 182, 192 Caña de azúc...

  3. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  4. Drug: D01573 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01573 Drug Etilefrine hydrochloride (JP16); Etilefrine hydrochloride (TN) C10H15NO...2. HCl 217.087 217.6925 D01573.gif Antihypotensive; Sympathomimetic Therapeutic category: 2119 ATC code: C01CA01 alpha1-adr...tion hsa04270(146+147+148) Vascular smooth muscle contraction hsa04970(146+147+148) Salivary secretion Therapeutic category of dr... 211 Cardiotonics 2119 Others D01573 Etilefrine hydrochloride (JP16) Anatomical T...AC STIMULANTS EXCL. CARDIAC GLYCOSIDES C01CA Adrenergic and dopaminergic agents C01CA01 Etilefrine D01573 Etilefrine hydr

  5. Luteinizing hormone secretion as affected by hypophyseal stalk transection and estradiol-17beta in ovariectomized gilts.

    Science.gov (United States)

    Ford, J J; Berardinelli, J G; Christenson, R K; Anderson, L L

    2000-11-01

    The objectives were to determine hypothalamic regulation of pulsatile luteinizing hormone (LH) secretion in female pigs and the biphasic feedback actions of estradiol-17beta (E(2)-17beta). In the first study, the minimum effective dosage of E(2)-17beta that would induce estrus in ovariectomized gilts was determined to be 20microg/kg body weight. In the second study, ovariectomized gilts were assigned randomly on day 0 to treatments: (a) hypophyseal stalk transection (HST), (b) cranial sham-operated control (SOC), and (c) unoperated control (UOC). On day 3, gilts from each group received a single i.m. injection of either E(2)-17beta (20microg/kg body weight) or sesame oil. Blood was collected from an indwelling jugular cannula at 15min intervals for 3h before (day -2) and after treatment (day 2) from HST, SOC and UOC gilts. On day 3, blood was collected at 2h intervals for 12h after E(2)-17beta or sesame oil injection and at 4h intervals thereafter for 108h. Pulsatile LH secretion in all gilts 2 days after ovariectomy exhibited a frequency of 0.9+/-0.06peaks/h, amplitude of 1.3+/-0.13ng/ml, baseline of 0.8+/-0.07. Serum LH concentrations from SOC and UOC gilts were similar on day 2 and profiles did not differ from those on day -2. In HST gilts pulsatile LH release was abolished and mean LH concentration decreased compared with controls (0 versus 0.9+/-0. 06peaks/h and 0.77+/-0.03 versus 1.07+/-0.07ng/ml, respectively; Pgilts, and LH remained constant throughout 120h (0.7+/-0. 07ng/ml). In SOC and UOC control gilts, E(2)-17beta induced a 60% decrease (Pgilts compared with controls (228 versus 332mg, Pgilts. The third and fourth studies determined that hourly i. v. infusions of LHRH (2microg) and a second injection of E(2)-17beta 48h after the first had no effect on the positive feedback action of estrogen in UOC. However, in HST gilts that received LHRH hourly, the first injection of E(2)-17beta decreased (Pfeedback action of E(2)-17beta on LH secretion depend on

  6. DNA double strand breaks as predictor of efficacy of the alpha-particle emitter Ac-225 and the electron emitter Lu-177 for somatostatin receptor targeted radiotherapy.

    Directory of Open Access Journals (Sweden)

    Franziska Graf

    Full Text Available RATIONALE: Key biologic effects of the alpha-particle emitter Actinium-225 in comparison to the beta-particle emitter Lutetium-177 labeled somatostatin-analogue DOTATOC in vitro and in vivo were studied to evaluate the significance of γH2AX-foci formation. METHODS: To determine the relative biological effectiveness (RBE between the two isotopes (as - biological consequence of different ionisation-densities along a particle-track, somatostatin expressing AR42J cells were incubated with Ac-225-DOTATOC and Lu-177-DOTATOC up to 48 h and viability was analyzed using the MTT assay. DNA double strand breaks (DSB were quantified by immunofluorescence staining of γH2AX-foci. Cell cycle was analyzed by flow cytometry. In vivo uptake of both radiolabeled somatostatin-analogues into subcutaneously growing AR42J tumors and the number of cells displaying γH2AX-foci were measured. Therapeutic efficacy was assayed by monitoring tumor growth after treatment with activities estimated from in vitro cytotoxicity. RESULTS: Ac-225-DOTATOC resulted in ED50 values of 14 kBq/ml after 48 h, whereas Lu-177-DOTATOC displayed ED50 values of 10 MBq/ml. The number of DSB grew with increasing concentration of Ac-225-DOTATOC and similarly with Lu-177-DOTATOC when applying a factor of 700-fold higher activity compared to Ac-225. Already 24 h after incubation with 2.5-10 kBq/ml, Ac-225-DOTATOC cell-cycle studies showed up to a 60% increase in the percentage of tumor cells in G2/M phase. After 72 h an apoptotic subG1 peak was also detectable. Tumor uptake for both radio peptides at 48 h was identical (7.5%ID/g, though the overall number of cells with γH2AX-foci was higher in tumors treated with 48 kBq Ac-225-DOTATOC compared to tumors treated with 30 MBq Lu-177-DOTATOC (35% vs. 21%. Tumors with a volume of 0.34 ml reached delayed exponential tumor growth after 25 days (44 kBq Ac-225-DOTATOC and after 21 days (34 MBq Lu-177-DOTATOC. CONCLUSION: γH2AX-foci formation, triggered

  7. TINGKAT KANDUNGAN UNSUR RADIOAKTIF AIR SUNGAI AYUNG DI DENPASAR BALI

    Directory of Open Access Journals (Sweden)

    Dewa Nyoman Alit Ardana

    2012-11-01

    Full Text Available Ayung river is one of the longest rivers in Bali. The upstream of the river is in regency of Bangli, Badung, Buleleng, Tabananand downstream is located in Padang Galak beach, East Denpasar Sub-regency. As the sample of the study, the water of the river wastaken from the stream entering the city of Denpasar. The sample was taken in five different points and for each point was taken twice. Thefirst was taken at 5 p.m, and the second was at 6 a.m. This study aims at finding out the rate of radioactive content of Ayung river water inthe city of Denpasar.The water sample was analyzed in Radiometry Analysis Group of Radiation Physics and environmental research centre andNuclear Technique Development, Jalan Taman Sari 71 Bandung – 40132. The process of counting was conducted in this place in order toknow the rate of the element activities and then identification of elements contens in the sample. The result of the counting and identifyingwas compered with standard grade of radioactivity in the area.The element of identification result and the amount of activity rate found showed that the element were natural radioactiveelements, the content: 40K (Kalium-40, 234Th (Thorium-234, 233Th (Thorium-233, 228Ac (Actinium-288, 114mIn (Indium-114m. Thehighest activity of radioactive elements in each sample point: in E2 point content element 40K with the activity 2.08 Bq/lt, in point A1 234Thwith the activity 16.34 Bq/lt, in point E1 containts 233Th with activity 598.29 Bq/lt, in point E1 and E2 contain 228Ac with the activity939.63 Bq/lt. The height of activity value of the counting and identifying elements was still under the rate of the highest level.The result of the study showed that radioactive elements 40K had the tendency of increasing radioactivity. The same thinghappened to 233Th at the peak of energi 185.00 keV. The content of its radioactive tends to exist in each point of sample point and theactivity tends to increase. Though the rate of

  8. Study of the production of residual evaporation nuclei issued from the spallation reaction of uranium-238 by 1 GeV protons; Etude de la production de noyaux residuels d'evaporation issus de la reaction de spallation de l'uranium-238 par des protons a 1 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Taieb, J

    2000-10-01

    The spallation reaction by high energy protons is one of the envisaged nuclear reactions for production of exotic nuclei. We have measured the production of more than 300 different evaporation residues issued by the spallation reaction of Uranium-238 by 1 GeV protons. We used the reverse kinematics technique in order to produce the relativistic nuclei and therefore to be able to detect those nuclides within a very short time, shorter in most cases than the radioactive disintegration period. The achieved nuclear charge and mass resolution are excellent. They allow a good accuracy on the values of the measured cross-sections (10 to 15%). We have observed for the first time the nuclide Actinium-235 obtained consequently to the loss of 3 protons by the projectile. The measured isotopic distribution are strongly influenced by the mechanism of fission which leads to a strong reduction of the production of the heavy neutron deficient isotopes. We have compared our results to some other measurements achieved with radio-chemical methods at a similar energy. We observed a systematic disagreement of about 40%. Some comparison with the available systematics show that those are presently not able to reproduce the data with a reasonable precision. We could also measure the recoil momentum distribution for each studied isotopes. We show that Goldhaber's model agrees very well with the experiment in case. of 'cold' channels where the evaporation of particles never occurs. On the other hand, when the produced pre-fragment is excited the data show that Goldhaber's model does not reproduce.the data showing the limitation of such an approach. We finally tried to reproduce the measurement of evaporation residue cross-section thanks to the coupling of intra-nuclear cascade and statistical evaporation codes. The influence of the fission process is rather important is the system p+U; we therefore had to account for the dynamical aspect of the fission. We also showed

  9. The Effects of Gender and Loneliness Levels on Ways of Coping among University Students

    Science.gov (United States)

    Cecen, A. Rezan

    2008-01-01

    The purpose of this study is to determine the effects of gender differences and levels of loneliness on ways of coping. The sample of the study is composed of 462 university students (245 male, 217 female) from different departments from the Education Faculty at Cukurova University. In this study to collect data related to loneliness as an…

  10. NJP VOLUME 41 NO 2

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-01-03

    Jan 3, 2014 ... Department of Pediatrics,. Garandawa H, Isa A, Ngamdu YB. Department of ENT Surgery,. Mustapha Z. Department of Radiology,. Tahir C. Burns and Plastic Unit,. Department of Surgery,. University of Maiduguri Teaching. Hospital. Maiduguri, Borno State, Nigeria. DOI:http://dx.doi.org/10.4314/njp.v41i2,17.

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 217 ... Vol 6 (2010), Pediatric Burns at The Rift Valley Provincial General Hospital, Nakuru, Kenya, Abstract PDF. PR Oduor. Vol 9 (2012), Periduodenal Tuberculosis masquerading as Annular Pancreas, Abstract PDF. K Ongeti, A Pulei, P Mandela, P Kimpiatu. Vol 13, No 2 (2016), Plummer-Vinson Syndrome ...

  12. Questions

    DEFF Research Database (Denmark)

    Larsen, Steen Nepper

    2012-01-01

    Bidrag til festskrift til Jesper Hoffmeyer i anledning af hans 70 års dag i Don Favineau, Paul Cobley & Kalevi Kull (eds.): "A More Developed Sign. Interpreting the Work of Jesper Hoffmeyer". Antologien udg. som særnummer af Tartu Semiotics Library Nr. 10 og mit bidrag forefindes på p. 217-220....

  13. High and Mighty: Implicit Associations between Space and Social Status

    Science.gov (United States)

    2011-10-10

    e.g., Piaget , 1927/1969; Tversky et al., 1991). To date, dozens of experiments across a wide range of disciplines, from psychology to anthropol- ogy...The Psychology of Learn- ing and Motivation, ed. B. H. Ross (Burlington: Academic Press), 217–248. Piaget , J. (1927/1969). The Child’s Con- ception of

  14. Schlieren Movies of the 8-Inch Diameter Rigid Parachute Model of the Cook Research Laboratory Taken During the Fourth Phase of Testing in the Langley Unitary Plan Wind Tunnel

    Science.gov (United States)

    1958-01-01

    Canopy Model IV was tested in four different configuration series. Shroud lines were used in the first three series of tests; none were used in the fourth series. Other variables were Mach number (1.77, 2.17, 2.76), dynamic pressure (290, 250, 155 lb per sq ft), camera speed, and attitude.

  15. A Survey of Knowledge Management in Law Firms in Botswana ...

    African Journals Online (AJOL)

    This article provides an empirical assessment of knowledge management in law firms in Botswana. It employs survey research methodology and triangulation of qualitative and quantitative methods of data collection. Data were collected mainly through a questionnaire administered to the 217 lawyers in all the law firms ...

  16. Indilinga: African Journal of Indigenous Knowledge Systems - Vol 12 ...

    African Journals Online (AJOL)

    On the development of uniquely African management theory · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Geoff A Goldman, 217-230. Leadership practices among the Lamba people of Zambia: some implications for school leadership · EMAIL FULL TEXT EMAIL FULL TEXT

  17. Compaction-Based Deformable Terrain Model as an Interface for Real-Time Vehicle Dynamics Simulations

    Science.gov (United States)

    2013-04-16

    Dimensional Terrain Surfaces," J. of Terramechanics, 47(4), pp. 209-217. [10] Bekker , M. G., 1956, Theory of land locomotion; the mechanics of...for all applications related to vehicle dynamics," Vehicle System Dynamics, 45(139-151). [18] Bekker , M. G., 1960, Off-the-road locomotion; research

  18. 78 FR 49978 - Airworthiness Directives; the Boeing Company Airplanes

    Science.gov (United States)

    2013-08-16

    ... x $85 per $0 $340 per inspection $142,460 per hour = $340 per cycle. inspection cycle. inspection... Costs Action Labor cost Parts cost Cost per product Repair Up to 136 work-hours x $85 per $5,217 Up to... pressure chord, pressure chord radius, ] forward and aft sides of the angle stiffener, forward and aft...

  19. Regulatory ecotoxicity testing of nanomaterials – proposed modifications of OECD test guidelines based on laboratory experience with silver and titanium dioxide nanoparticles

    DEFF Research Database (Denmark)

    Hund-Rinke, Kerstin; Baun, Anders; Cupi, Denisa

    2016-01-01

    of the sediment-living worm Lumbriculus variegatus (TG 225), activity of soil microflora (TGs 216, 217), and reproduction of the invertebrates (Enchytraeus crypticus, Eisenia fetida, TGs 220, 222). Additionally, test descriptions for two further test systems (root elongation of plants in hydroponic culture; test...

  20. The effect of anxiety and depression scores of couples who ...

    African Journals Online (AJOL)

    Objective: The aim of this study was to determine the effect of anxiety and depression scores of couples who underwent Assisted Reproductive Techniques (ART) on pregnancy outcomes. Method: This study was conducted as a prospective and comparative study with 217 couples. The study data was collected by using a ...

  1. A Longitudinal Daily Diary Study of Family Assistance and Academic Achievement among Adolescents from Mexican, Chinese, and European Backgrounds

    Science.gov (United States)

    Telzer, Eva H.; Fuligni, Andrew J.

    2009-01-01

    A longitudinal daily diary method was employed to examine the implications of family assistance for the academic achievement of 563 adolescents (53% female) from Mexican (n = 217), Chinese (n = 206), and European (n = 140) backgrounds during the high school years (mean age 14.9 years in 9th grade to 17.8 years in 12th grade). Although changes in…

  2. Re-Victimization Patterns in a National Longitudinal Sample of Children and Youth

    Science.gov (United States)

    Finkelhor, David; Ormrod, Richard K.; Turner, Heather A.

    2007-01-01

    Objective: To understand to the degree to which a broad variety of victimizations, including child maltreatment, conventional crime, peer, and sexual victimizations, persist for children from 1 year to the next. Design: A national sample of 1467 children aged 2-17 recruited through random digit dialing and assessed via telephone interviews (with…

  3. 75 FR 60694 - Taking and Importing Marine Mammals; Naval Explosive Ordnance Disposal School Training Operations...

    Science.gov (United States)

    2010-10-01

    ... threats in all world environments. Mine Countermeasures (MCM) detonations is one function of the U.S. Navy... National Oceanic and Atmospheric Administration 50 CFR Part 217 RIN 0648-AY64 Taking and Importing Marine... AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA...

  4. Oedema (exudative diathesis) in Ostriches in Kenya | Ngatia | Kenya ...

    African Journals Online (AJOL)

    In 10 chicks, the oedema was subcutaneous and severe, in 5 it was only serous effusions in body cavities and in 217 it was manifested as wetness of subcutaneous tissues. Adult and juvenile ostriches originated from three farms, where they were kept as pets. Of 22 birds, 16 (72.7%) developed a general sickness and 10 ...

  5. PM Mumo Holistic Healing, An Analytical Review of Medicine-men ...

    African Journals Online (AJOL)

    PM Mumo

    on the profession to his son or other younger relative (Mbiti 1969, 167). Yet others received their calls through visions or dreams (Magesa1997,217). .... For example, Simon Kimbangu in Congo used prophetic and healing ministries to eradicate witchcraft, wicked spirits and bad medicine (Ngewa 1998, 291). Through the ...

  6. Caregivers' Suffix Frequencies and Suffix Acquisition by Language Impaired, Late Talking, and Typically Developing Children

    Science.gov (United States)

    Warlaumont, Anne S.; Jarmulowicz, Linda

    2012-01-01

    Acquisition of regular inflectional suffixes is an integral part of grammatical development in English and delayed acquisition of certain inflectional suffixes is a hallmark of language impairment. We investigate the relationship between input frequency and grammatical suffix acquisition, analyzing 217 transcripts of mother-child (ages 1 ; 11-6 ;…

  7. Enhanced lipase production by mutation induced Aspergillus ...

    African Journals Online (AJOL)

    ... the HNO2 mutant (AHN3) and 217% higher than the UV mutant (AUV3) and 276% higher lipase activity than the parent strain. The results indicated that UV, HNO2 and NTG treatment were effective physical and chemical mutagenic agents for strain improvement of Aspergillus japonicus for enhanced lipase productivity.

  8. Distribution of phosphorus and phosphatisation along the western continental margin of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, Ch.M.; Paropkari, A.L.; Mascarenhas, A.; Murty, P.S.N.

    Phosphate content in the bulk sediments range from 0.02 to 2.17% and on carbonate free basis it varies from 0.03 to 6.5%. The partition studies indicate that contribution from the acid resistant detrital minerals (HCl insolubles) is negligible...

  9. Relationship between Subtypes of Restricted and Repetitive Behaviors and Sleep Disturbance in Autism Spectrum Disorder

    Science.gov (United States)

    Hundley, Rachel J.; Shui, Amy; Malow, Beth A.

    2016-01-01

    We examined the association of two types of restricted and repetitive behaviors, repetitive sensory motor (RSM) and insistence on sameness (IS), with sleep problems in children with autism spectrum disorder (ASD). Participants included 532 children (aged 2-17) who participated in the Autism Speaks Autism Treatment Network research registry.…

  10. Journal of Genetics, Volume 84, 2005

    Indian Academy of Sciences (India)

    and their host nuclear genes in four plant species. 55. Genetics of adult plant stripe rust resistance in CSP44, a ... Campos-Ortega (Special feature). 217. Journal of Genetics, Volume 84, 2005. AUTHOR ... Ghosh, Saurabh. Dissecting the correlation structure of a bivariate phenotype: common genes or shared environment?

  11. Hyperfine splitting in positronium to O({alpha}{sup 7}m{sub e}). One-photon annihilation contribution

    Energy Technology Data Exchange (ETDEWEB)

    Baker, M. [Alberta Univ., Edmonton, AB (Canada). Dept. of Physics; Marquard, P. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Penin, A.A. [Alberta Univ., Edmonton, AB (Canada). Dept. of Physics; Karlsruher Institut fuer Technologie (Germany). Inst. fuer Theoretische Teilchenphysik; Piclum, J. [Technische Univ. Muenchen, Garching (Germany). Physik-Department; RWTH Aachen (Germany). Inst. fuer Theoretische Teilchenphysik und Kosmologie; Steinhauser, M. [Karlsruher Institut fuer Technologie (Germany). Inst. fuer Theoretische Teilchenphysik

    2014-02-15

    We present the complete result for the O({alpha}{sup 7}m{sub e}) one-photon annihilation contribution to the hyperfine splitting of the ground state energy levels in positronium. Numerically it increases the prediction of quantum electrodynamics by 217{+-}1 kHz.

  12. Differences in injury risk and characteristics between Dutch amateur and professional soccer players

    NARCIS (Netherlands)

    Beijsterveldt, A.M.C. van; Stubbe, J.H.; Schmikli, S.L.; Port, I.G.L. van de; Backx, F.J.G.

    2015-01-01

    Objectives: To compare the incidence and characteristics of injuries between Dutch amateur and professional male soccer players during one entire competition season. Design: A prospective two-cohort design. Methods: During the 2009-2010 season, 456 Dutch male amateur soccer players and 217

  13. Storytelling Slide Shows to Improve Diabetes and High Blood Pressure Knowledge and Self-Efficacy: Three-Year Results among Community Dwelling Older African Americans

    Science.gov (United States)

    Bertera, Elizabeth M.

    2014-01-01

    This study combined the African American tradition of oral storytelling with the Hispanic medium of "Fotonovelas." A staggered pretest posttest control group design was used to evaluate four Storytelling Slide Shows on health that featured community members. A total of 212 participants were recruited for the intervention and 217 for the…

  14. Prevalence and correlates of aggression among psychiatric in ...

    African Journals Online (AJOL)

    The prevalence of aggression in this study was 19.5%. Of the 58 aggressive patients, 35 (21.7%) and 23 (16.8%) were male and female, respectively. Schizophrenic patients (31%) exhibited aggression more than any other diagnostic category. Most of the aggressive behavior occurred without provocation (63.3%).

  15. occurrence of some maastrichtian dinoflagellate cysts from the ...

    African Journals Online (AJOL)

    Admin

    more understanding of the paleogeography of the Bida basin with respect to possible connection between the. Tethys and the south Atlantic in the Late Cretaceous and also may also help resolve more resolutely the precise age of the Patti sediments. 217. J. Ojo, Olusola, Department of Geology, University of Ilorin, Ilorin, ...

  16. Climate change and cashew (Anacardium occidentale L ...

    African Journals Online (AJOL)

    217 RESULTS ... 2Integrated Soil and Crop Management Research Unit, Laboratory of Soil Sciences, School of Science and. Technic of Crop ... This study aimed at analyzing the perceptions of cashew producers of the climate change, climate change effect on ... Benin are the most vulnerable to climate risks: drought, late and ...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 217 ... Vol 42, No 3 (2015), Emancipation and “the Great Wheel of Labour”: Enduring Liminality in Rayda Jacobs's The Slave Book (1988) and a Painting of Two Slave Women (1859) by Thomas Baines ... Vol 41, No 3 (2014), Feral Whispering: Conservation, Community and the Reach of the Literary, Abstract.

  18. partial molecular characterization of cowpea stunt isolates of ...

    African Journals Online (AJOL)

    USER

    2University of Arkansas, Department of Plant Pathology, 217 PTSC Bldg, Fayetteville, ARKANSAS (USA) 72701. ... I and differ at eight nucleotides positions, resulting in two amino acids difference. There was only one amino acid difference for the Blackeye Cowpea Mosaic Virus (BlCMV) isolates from both locations.

  19. Comparing large-scale hydrological model predictions with observed streamflow in the Pacific Northwest: effects of climate and groundwater

    Science.gov (United States)

    Mohammad Safeeq; Guillaume S. Mauger; Gordon E. Grant; Ivan Arismendi; Alan F. Hamlet; Se-Yeun Lee

    2014-01-01

    Assessing uncertainties in hydrologic models can improve accuracy in predicting future streamflow. Here, simulated streamflows using the Variable Infiltration Capacity (VIC) model at coarse (1/16°) and fine (1/120°) spatial resolutions were evaluated against observed streamflows from 217 watersheds. In...

  20. 75 FR 9223 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2010-03-01

    ... increasing absenteeism among students or staff that impacted at least 824,966 students and 53,217 teachers... including the number of students and teachers impacted by the outbreak. Illness among school-aged students... of students and teachers impacted by the school dismissals. CDC will use the summary data to fully...

  1. 75 FR 14163 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2010-03-24

    ... dismissals nationwide including the number of students and teachers impacted by the outbreak. Illness among... rapidly increasing absenteeism among students or staff that impacted at least 824,966 students and 53,217 teachers. Although a system was put in place to track school closures in conjunction with the Department of...

  2. 78 FR 18598 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2013-03-27

    ... resulted in at least 1,351 school dismissals due to rapidly increasing absenteeism among students or staff. These dismissals impacted at least 824,966 students and 53,217 teachers. During that time, the U.S... requests about the overall number of school dismissals nationwide and the number of students and teachers...

  3. 77 FR 71797 - Proposed Data Collections Submitted for Public Comment and Recommendations

    Science.gov (United States)

    2012-12-04

    ... cities resulted in at least 1,351 school dismissals due to rapidly increasing absenteeism among students or staff. These dismissals impacted at least 824,966 students and 53,217 teachers. During that time... students and teachers impacted by the school dismissals. CDC and ED recognized the importance of having a...

  4. Insectos paisas

    Directory of Open Access Journals (Sweden)

    Arturo Acero Pizarro

    1989-07-01

    Full Text Available Guía para el estudio de los macroinvertebrados acuáticos del departamento de Antioquia. Gabriel Roldán Pérez. Fondo FEN Colombia / Colciencias / Universidad de Antioquia, Bogotá, 1988, xi-217 págs.

  5. 76 FR 58077 - RTCA Program Management Committee

    Science.gov (United States)

    2011-09-19

    .... 153-11/PMC-909, prepared by SC-217. Final Draft, New Document, Aircraft Secondary Barriers and..., Revised DO-178B, Software Considerations in Airborne Systems and Equipment Certification, RTCA Paper No... Paper No. 156-11/PMC-912, prepared by SC-205. Final Draft, New Document, Software Tool Qualification...

  6. AcEST: BP919608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available richa nova PE=3 SV=1 95 4e-23 sp|O00937|ACT_HISCA Actin OS=Histriculus cavicola PE=3 SV=2 94 8e-23 sp|P53468...-VRDIKEKLC 216 Query: 504 AVADDYAAIMQ 536 VA DY A M+ Sbjct: 217 FVALDYEAAMK 227 >sp|O00937|ACT_HISCA Actin OS=Histriculus cavicola

  7. Ionic identity of pore water influences pH preference in Collembola.

    NARCIS (Netherlands)

    Salmon, S.; Ponge, J.F.; van Straalen, N.M.

    2002-01-01

    A test system described by Van Straalen and Verhoef [J Appl Ecol 34 (1997) 217] was used in order to check whether the endogeic Collembolan Heteromurus nitidus was repelled by acid pH. In each of the eight experimental runs 16 naive animals were allowed to select sectors in a circular pH gradient

  8. Predicting mobility outcome one year after stroke: a prospective cohort study.

    NARCIS (Netherlands)

    Port, I.G. van de; Kwakkel, G.; Schepers, V.P.; Lindeman, E.

    2006-01-01

    OBJECTIVE: To develop a prognostic model to predict mobility outcome one year post-stroke. DESIGN: Prospective cohort study in patients with a first-ever stroke admitted for inpatient rehabilitation. PATIENTS: A total of 217 patients with stroke (mean age 58 years) following inpatient rehabilitation

  9. Politikberatung aus den Staatswissenschaften = Riigiteadus poliitikanõustajana / Jürgen Backhaus

    Index Scriptorium Estoniae

    Backhaus, Jürgen

    2005-01-01

    Teadmistepõhine poliitika eeldab, et teadmised, millele poliitika peab tuginema, on tõepoolest ka olemas ja et on olemas keegi, kes oskab neid poliitikuile efektiivselt edastada. Sotsiaalteaduste puhul kerkib esile probleem, et vastav kommunikatsioon on üha puudulikum, leiab autor. Vt. ka kommentaare lk. 217-222,467-472

  10. Dicty_cDB: Contig-U15405-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tugueseWaterDog Canis familiar... 44 0.80 1 ( BV312740 )...s troglodyt... 44 0.80 1 ( BV495481 ) S217P61918FE2.T0 Noemie Pan troglodytes troglodyt... 44 0.80 1 ( BV436248 ) S237P6495RF5.T0 Por

  11. Academic Inbreeding in the Portuguese Academia

    Science.gov (United States)

    Tavares, Orlanda; Cardoso, Sónia; Carvalho, Teresa; Sousa, Sofia Branco; Santiago, Rui

    2015-01-01

    This paper analyses the inbreeding phenomena in Portuguese public universities. Inbreeding is defined as the recruitment of academics by the same institution that awarded their PhDs. Focusing on 1,217 PhD-holding Portuguese academics, belonging to four public universities and to six disciplinary areas, inbreeding is analysed in order to understand…

  12. AcEST: BP912285 [AcEST

    Lifescience Database Archive (English)

    Full Text Available utative uncharacterized protein YHR217C OS... 31 4.6 sp|P08411|POLN_SFV Non-structural polyprotein OS=Semliki forest...ural polyprotein OS=Semliki forest virus PE=1 SV=2 Length = 2432 Score = 30.0 bits (66), Expect = 7.9 Identi

  13. Experiment list: SRX014770 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available on=Bone Marrow|Tissue Diagnosis=Leukemia 14403159,71.1,32.3,217 GSM468200: RAR ChIPseq NB4 24hoursATRA JM21 ...source_name=NB4 cells || agent=24 hours ATRA || antibody=RAR http://dbarchive.biosciencedbc.jp/kyushu-u/hg19

  14. The effect of anxiety and depression scores of couples who ...

    African Journals Online (AJOL)

    sisted Reproductive Techniques (ART) on pregnancy outcomes. Method: This study was conducted as a prospective and comparative study with 217 couples. The study data was collected by using a semi-structured questionnaire and the Turkish version of the State-Trait Anxiety Inventory (STAI), and Beck Depression.

  15. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R.S.; Noronha, R.J.; Fondekar, S.P.; SenGupta, R.

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  16. The Ophthalmic status manifestations of nutritional and lifestyle ...

    African Journals Online (AJOL)

    The dietary intakes of vitamin A rich food were so low that they could not be represented quantitatively. About 71.0% of the men were habitual users of alcoholic beverages and 22.0% smoked tobacco. About 21.7% of men had Bitot's spot while 4.3% had keratomalacia. The logistic regression analysis predicted that alcohol ...

  17. Neighbourhood facilities for sustainability

    CSIR Research Space (South Africa)

    Gibberd, Jeremy T

    2013-01-01

    Full Text Available . Dev. 15, pp.160–173, 2007. [5] Button, K., City management and urban environmental indicators. Ecological Economics, 40(2), pp. 217–233, 2002. [6] World Wild Life Fund, The Living Planet Report, Accessed from www.panda...

  18. Bacterial utilization of size-fractionated dissolved organic matter

    Digital Repository Service at National Institute of Oceanography (India)

    Khodse, V.B.; Bhosle, N.B.

    ), dissolved uronic acid (DURA), delta13C, bacterial abundance (BA), and bacterial production (BP). The LMW fraction was isotopically heavier (delta13C = −23.7 to −21.7ppt) than the HMW fraction (delta13C = −27.0 to −26.2ppt), and the initial TDCHO content...

  19. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:53 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 59,483 views 5: ... Medway CCG 173,217 views 27:40 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  20. Resonance Special Issue - World Year of Physics -RE ...

    Indian Academy of Sciences (India)

    Amit Roy. 176. Ludwig Boltzmann and Entropy. Sriram Ramaswamy. 179 The Case of Missing Solar Neutrinos with their Split Personalities. S M Chitre. 193. Dirac's Conception of the Magnetic Monopole, and its Modern Avatars. Sunil Mukhi. 203. Magnetic Resonance Imaging: Window to a Watery World. Kavita Dorai. 217.

  1. Tartu biomeditsiiniettevõtluse võimalused ja riiklikud poliitikad = Über die Möglichkeiten von Biomedizin-Unternehmen in Tartu und die staatliche Politik / Garri Raagmaa

    Index Scriptorium Estoniae

    Raagmaa, Garri, 1966-

    2005-01-01

    Teadmistepõhisest majandusest on küll palju räägitud, kuid selle sisu on jätkuvalt segane ja seetõttu ähvardab devalveeruda. Autori hinnangul on vaja enam kommunikatsiooni ning vastastikku arusaamist teadlaste, poliitikute ja ettevõtjate vahel. Vt. ka kommentaare lk. 217-222,467-472

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ed Lorenz: Father of the 'Butterfly Effect' · G Ambika · More Details Fulltext PDF. pp 206-216 General Article. Multivariable Chinese Remainder Theorem · B Sury · More Details Fulltext PDF. pp 217-234 General Article. C-II Acid and the Stereochemistry of Abietic Acid · S N Balasubrahmanyam · More Details Fulltext PDF.

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 217 ... Vol 41 (2013), Applying the design process to apparel prototype development: Students' experiences of a community service-learning project, Abstract PDF. M Strydom, TJ Tselepis. Special Edition. Food and nutrition challenges in Southern Africa. Vol 2 (2017), Assessment of dietary challenges faced by ...

  4. Developing Quality Strategic Plan in Secondary Schools for Successful School Improvement

    Science.gov (United States)

    Chukwumah, Fides Okwukweka

    2015-01-01

    The study examined the extent to which development of quality strategic plans for Anambra State secondary schools' improvement had been done by schools. The research design used was a descriptive survey. Respondents comprised 217 principals. There was no sampling since all the principals were used. Data were collected using "Schools'…

  5. Problems of Implementation of Strategic Plans for Secondary Schools' Improvement in Anambra State

    Science.gov (United States)

    Chukwumah, Fides Okwukweka; Ezeugbor, Carol Obiageli

    2015-01-01

    This study investigated the extent of problems of strategic plans implementation for secondary schools' improvement in Anambra State, Nigeria for quality education provision. The study used a descriptive survey design paradigm. Respondents comprised 217 principals. There was no sampling. All the principals were used. Data were collected using…

  6. Extending Campus Life to the Internet: Social Media, Discrimination, and Perceptions of Racial Climate

    Science.gov (United States)

    Tynes, Brendesha M.; Rose, Chad A.; Markoe, Suzanne L.

    2013-01-01

    Despite the fact that more college student interaction now takes place online, researchers have yet to examine the role the Internet plays in perceptions of campus racial climate. Using an online survey of a sample of 217 African American and European American college students, this study explored online factors including intergroup interaction as…

  7. Occupational Gender Stereotypes and Problem-Solving in Italian Adolescents

    Science.gov (United States)

    Ginevra, Maria Cristina; Nota, Laura

    2017-01-01

    The first purpose of the study was to establish how Italian adolescents perceive jobs in the newly emerging economy sectors as well as more traditional jobs from gender-stereotyped and gender-segregated perspectives. The second purpose was to verify the role of problem-solving and gender in gender-role stereotyping. A total of 217 Italian high…

  8. Ischaemic heart disease in Aminu Kano Teaching Hospital, Kano ...

    African Journals Online (AJOL)

    Forty six patients were diagnosed to have IHD giving it a prevalence of 0.9% of medical conditions and 3.4% of all cardiovascular cases. There were 33 males and 13 females (M: F = 2.5:1). Twenty two patients (47.8%) had myocardial infarction, 14(30.4%) had ischemic cardiomyopathy and 10 (21.7%) had angina.

  9. Math. $0033 (1986) 307—318. '

    Indian Academy of Sciences (India)

    [7] Khandem-Maboudi A A and Pourabdollah M A, Almost periodic type function spaces on. I weighted semitopological semigroups, Far East J. Math. Sci. Special Volume (1998) part I,. 107-116. [8] Lashkarizadeh Batni M, Function algebras on weighted topological semigroups, Math. Japonica 47 (1998) 217—227.

  10. Untitled

    African Journals Online (AJOL)

    previous growth of the wood species in the trials. This enables careful thought— out plan of action of how the experiment may be carried out. Such an approach .... an apprwliate -0 1. tone: QISBIIS whizhcenbeeaslz 'Iihfgh. References. Begg, J. E., and Turner, N. C (1976) Crop. Water Deficits. Adv. Agron., 28: 161-217.

  11. heavy metal profiles in various matrices of the bonny/new calabar ...

    African Journals Online (AJOL)

    PROF EKWUEME

    J. of Appl. Toxico. (13): 217–224. Nwilo, P. C and Badejo, O. T., 2008. Impacts and management of oil spill in Nigerian coastal environment. Proceedings of the. International Conference on the Nigerian. State, Oil Industry and the Niger Delta. 1217-1232. Obasohan, E. E., 2008. Heavy metals in the. Sediment of Ibiekuma ...

  12. Differential responses of two rubber tree clones to chilling stress ...

    African Journals Online (AJOL)

    Chilling stress is one of the most important environmental factors that limit the growth, distribution and yield of rubber tree in China. The effects of chilling stress on the grated plants of two rubber trees clones, GT1 and Wenchang217, were studied by physiological methods in controlled light chamber in order to explore the ...

  13. FILOSOFIA THEORETICA FORMATED Vol 2 No. 1. Final 1docx

    African Journals Online (AJOL)

    JONATHAN

    Filosofia Theoretica: Journal of African Philosophy, Culture and Religion. 217. Editorial. The issues concerning African studies addressed in this volume are quite diverse and original. As we continue to develop, propagate and promote a new phase of African philosophy, culture, history and religion where creative originality ...

  14. A tale of three cities: Insight into the impacts of holiday rentals in ...

    African Journals Online (AJOL)

    Greater freedom offered by rented apartments is important, though the favourable costs when compared with hotel stays was also valued. In Paris, the rented accommodation spend by tourists is estimated to be as much as €217 140 000. Côte d'Azur in rented properties generates an average accommodation expenditure of ...

  15. Predictors of Changes in Body Image Concerns of Chinese Adolescents

    Science.gov (United States)

    Chen, Hong; Jackson, Todd

    2009-01-01

    This nine-month prospective study tested the extent to which risk factors implicated in recent accounts of body dissatisfaction predicted changes in body image concerns of adolescent boys and girls in China. A sample of 593 Chinese adolescents (217 boys, 376 girls) completed measures of weight esteem, appearance esteem and physical stature concern…

  16. Exploring the African cassava (Manihot esculenta Crantz ...

    African Journals Online (AJOL)

    Development to torpedo stage took between 55 to 65 days. Higher success was achieved with leaf lobes (21.7%) than axillary meristem (13.8%). There was a significant (p<0.01) genotype x explant interaction, indicating that ability of the cassava genotypes to undergo somatic embryogenesis was influenced by the explant.

  17. Self-Regulation Mediates the Link between Family Context and Socioemotional Competence in Turkish Preschoolers

    Science.gov (United States)

    Gündüz, Gizem; Yagmurlu, Bilge; Harma, Mehmet

    2015-01-01

    Research Findings: In this study, we examined self-regulatory skills, namely, effortful control and executive function, in Turkish preschoolers (N = 217) and their mediating roles in the associations between parenting and children's socioemotional competence. We also investigated the role of family socioeconomic status and maternal psychological…

  18. Gclust Server: 44444 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 44444 HSA_46409332 Cluster Sequences Related Sequences(39) 217 NP_997232.1 hypothetical protein LOC284739...1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 44444 Cluster ID 44444 Sequence ID HSA_46409332 Link to cluster

  19. Evaluation of toxicity of pesticides and their biodegradation products using human cells

    Czech Academy of Sciences Publication Activity Database

    Forman, S.; Novák, Jaroslav; Tykva, Richard; Káš, J.; Wimmer, Zdeněk; Ruml, T.

    2002-01-01

    Roč. 46, - (2002), s. 209-217 ISSN 0045-6535 R&D Projects: GA ČR GA203/99/1447 Institutional research plan: CEZ:AV0Z4055905 Keywords : juvenile hormone Subject RIV: CE - Biochemistry Impact factor: 1.461, year: 2002

  20. Mass distributions of a macromolecular assembly based on ...

    Indian Academy of Sciences (India)

    Unknown

    quaternary structures are virtually identical at a resolution of ~ 2 nm (Cejka ... low resolution crystallographic structure of Lumbricus Er ...... 1433 217–228. Vinogradov S N and Kolodziej P 1988 The molecular mass of the extracellular hemoglobin of Lumbricus terrestris deter- mined by electron microscopy; Comp. Biochem.

  1. Computable majorants of the limit load in Hencky's plasticity problems

    Czech Academy of Sciences Publication Activity Database

    Repin, S.; Sysala, Stanislav; Haslinger, Jaroslav

    2018-01-01

    Roč. 75, č. 1 (2018), s. 199-217 ISSN 0898-1221 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : computable bounds * divergence free fields * Hencky's plasticity * limit load * penalization Subject RIV: BA - General Mathematics Impact factor: 1.531, year: 2016 http://www.sciencedirect.com/science/article/pii/S0898122117305552

  2. Detrimental effect of clomipramine on hippocampus-dependent learning in an animal model of obsessive-compulsive disorder induced by sensitization with d2/d3 agonist quinpirole

    Czech Academy of Sciences Publication Activity Database

    Hatalová, Hana; Radostová, Dominika; Pištíková, Adéla; Valeš, Karel; Stuchlík, Aleš

    2017-01-01

    Roč. 317, Jan 15 (2017), s. 210-217 ISSN 0166-4328 R&D Projects: GA MZd(CZ) NV15-34524A; GA MŠk(CZ) LH14053 Institutional support: RVO:67985823 Keywords : obsessive-compulsive disorder * antipsychotics * antidepressant * animal model * quinpirole * rat Subject RIV: FH - Neurology Impact factor: 3.002, year: 2016

  3. Protective role of a methanolic extract of spinach (Spinacia oleracea L.) against Pb toxicity in wheat (Triticum aestivum L.) seedlings: beneficial effects for a plant of a nutraceutical used with animals.

    Science.gov (United States)

    Lamhamdi, Mostafa; Bakrim, Ahmed; Bouayad, Noureddin; Aarab, Ahmed; Lafont, René

    2013-10-01

    Spinach extracts contain powerful natural antioxidants and have been used to improve the response of animal cells to various stress factors. The aim of the present study was to assess the effects of a methanolic extract of spinach (SE) used at two concentrations (21.7 and 217 ppm) on the growth, certain enzymes and antioxidant systems in wheat seedlings under lead stress. When wheat seedlings were grown for 7 days in a solution containing Pb(NO3)2 (3 mM), germination and growth were impaired, while signs of oxidative stress were observed. SE (217 ppm) pretreatment was able to protect seedlings from Pb toxicity by both reducing Pb uptake and Pb-induced oxidative stress. As a consequence, almost normal germination, elongation, biomass and α-amylase activity were restored by SE (217 ppm) pretreatment of wheat seedlings, in spite of the presence of Pb. Our results support the protective role and the antioxidant effect of SE against Pb. These results show an amazing similarity to the effects of SE in animals, which suggests that providing "nutraceuticals" to plants could improve their "health" status.

  4. Production of Ogi from germinated sorghum supplemented with ...

    African Journals Online (AJOL)

    Similarly, supplementation of Ogi with 30% (w/w) soya-flour generally resulted in increase in fat contents (approx. 130%), ash (approx. 54.9%) and fibre (approx. 217%). A panel of evaluators showed greatest preference for soya- supplemented Ogi porridge made from S. vulgare, while soya-supplemented Ogi porridge from ...

  5. Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions

    DEFF Research Database (Denmark)

    Pendle, Alison F; Clark, Gillian P; Boon, Reinier

    2005-01-01

    analysis of plant (Arabidopsis thaliana) nucleoli, in which we have identified 217 proteins. This allows a direct comparison of the proteomes of an important nuclear structure between two widely divergent species: human and Arabidopsis. The comparison identified many common proteins, plant...

  6. Prevalence of concurrent use of antipsychotic drugs and herbal ...

    African Journals Online (AJOL)

    Participants were recruited randomly and intermittently until a sample size of 217 was attained. Data on the use of herbal medicines, type of antipsychotic drug, compliance with dosage regimen, duration of antipsychotic therapy, side effects of antipsychotic drugs and some socio-demographic characteristics were collected ...

  7. Analysis of Pacific Enroute Structure in Support of C-5M Super Galaxy

    Science.gov (United States)

    2015-06-19

    optimization problem is the vehicle routing problem ( VRP ), which seeks to minimize the total cost between a single origin and several customer delivery...destinations by a fleet of vehicles (Dantzig, 1959:217-222). A special sub-set of the classic VRP is the strategic airlift problem (Toth, 2001). The

  8. Effectiveness of liquid organic-nitrogen fertilizer in enhancing ...

    African Journals Online (AJOL)

    user

    2011-03-21

    Mar 21, 2011 ... 2Department of Forest Management, Faculty of Forestry, Universiti Putra Malaysia,43400 UPM Serdang Selangor,. Malaysia. Accepted 21 January ... Previous data showed that, uptake of P by corn increased more ..... Prentice Hall, Inc. Upper Saddle River, New Jersey, United. State of America, pp. 217-244.

  9. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A Ghosh. Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 217-220 Synthesis. Effect of sillimanite beach sand composition on mullitization and properties of Al2O3–SiO2 system · H S Tripathi B Mukherjee S K Das A Ghosh G Banerjee.

  10. 76 FR 14829 - Safety Zone; 2011 Hylebos Bridge Restoration, Hylebos Waterway, Tacoma, WA

    Science.gov (United States)

    2011-03-18

    ... Anthony P. LaBoy, USCG Sector Puget Sound Waterways Management Division, Coast Guard; telephone 206-217..., which will then become highlighted in blue. In the ``Document Type'' drop down menu select ``Proposed... assistance at the public meeting, contact Ensign Anthony P. LaBoy at the telephone number or e-mail address...

  11. 77 FR 5747 - Security Zones, Seattle's Seafair Fleet Week Moving Vessels, Puget Sound, WA

    Science.gov (United States)

    2012-02-06

    ... Anthony P. LaBoy, Sector Puget Sound, Waterways Management Division, U.S. Coast Guard; telephone (206) 217..., which will then become highlighted in blue. In the ``Document Type'' drop down menu select ``Proposed... have questions concerning its provisions or options for compliance, please contact Ensign Anthony P. La...

  12. Economic evaluation of the successful biological control of Azolla filiculoides in South Africa

    CSIR Research Space (South Africa)

    McConnachie, AJ

    2003-09-01

    Full Text Available -user) was 2.17 ha, with an expansion rate of 1.33 ha per year. The frond-feeding weevil Stenopelmus rufinasus was released as a biological control agent at the end of 1997. Within 3 years, the weevil had reduced the weed population to the point...

  13. The Effect of Type and Concentration of Modifier in Supercritical Carbon Dioxide on Crystallization of Nanocrystalline Titania Thin Films.

    Czech Academy of Sciences Publication Activity Database

    Sajfrtová, Marie; Cerhová, Marie; Jandová, Věra; Dřínek, Vladislav; Daniš, E.; Matějová, L.

    2018-01-01

    Roč. 133 (2018), s. 211-217 ISSN 0896-8446 R&D Projects: GA ČR GA14-23274S Institutional support: RVO:67985858 Keywords : titania thin film * supercritical carbon dioxide * crystallization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.991, year: 2016

  14. PEDIATRIC OPHTHALMLOGY AND STRABISMUS

    African Journals Online (AJOL)

    The most common diagnosis was simple myopic astigmatism (41.1%), then myopia, anisometropia, and compound myopic astigmatism with 21.7%, 10.6%, and 8.9%, respectively [Tables 1 and 2]. Conclusion: A good percentage of these children (females than males) have significant error which was correctable by glasses.

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 217 ... JG Kabugi. Vol 8 (2011), “Non-functioning” Kidneys in Excretory Urography: Caution is the word! Abstract PDF. AA Ajape, M ... Vol 3 (2008), Breast self examination and breast cancer: Knowledge and practice among female medical students in a Kenyan university, Abstract PDF. S.M Kimani, E Muthumbi.

  16. Planck 2013 results. XVII. Gravitational lensing by large-scale structure

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

    2013-01-01

    On the arcminute angular scales probed by Planck, the cosmic microwave background (CMB) anisotropies are gently perturbed by gravitational lensing. Here we present a detailed study of this eect, detecting lensing independently in the 100, 143, and 217 GHz frequency bands with an overall significa...

  17. Deteriorated Concrete from Liner of WIPP Waste Shaft

    Science.gov (United States)

    1992-06-01

    for US Department of Energy. Bensted, J. 1989. "Novel Cements - Sorel and Related Chemical Cements," il Cemento , Vol 86, No. 4, pp 217-228. Ben-Yair, M...Waste Isolation Pilot Plant. Massazza, F. 1985. "Concrete Resistance to Sea Water and Marine Environment," il Cemento , Vol 82, No. 1, pp 3-26. Mather

  18. Profiling Students' Capacities to Link Number and Algebra in Years 5, 6 and 7 in Nanjing, China

    Science.gov (United States)

    Xu, Wenbin; Stephens, Max; Zhang, Qinqiong

    2012-01-01

    This study investigates how 217 students in Years 5, 6 and 7 from three schools in Nanjing, China, link number and algebra (called relational thinking in this study). It categorizes their performances in terms of five levels, and uses these levels to create profiles of algebraic thinking across Years 5, 6, and 7. The study examines the…

  19. Folklore Epistemology: How Does Traditional Folklore Contribute to Children's Thinking and Concept Development?

    Science.gov (United States)

    Agbenyega, Joseph S.; Tamakloe, Deborah E.; Klibthong, Sunanta

    2017-01-01

    This research utilised a "stimulated recall" methodology [Calderhead, J. 1981. "Stimulated Recall: A Method for Research on Teaching." "British Journal of Educational Psychology" 51: 211-217] to explore the potential of African folklore, specifically Ghanaian folk stories in the development of children's reflective…

  20. Occurrence of indoor wood decay basidiomycetes in Europe

    Czech Academy of Sciences Publication Activity Database

    Gabriel, Jiří; Švec, Karel

    2017-01-01

    Roč. 31, č. 4 (2017), s. 212-217 ISSN 1749-4613 R&D Projects: GA ČR(CZ) GA17-05497S Institutional support: RVO:61388971 Keywords : Basidiomycetes * Fungi * Serpula lacrymans Subject RIV: EE - Microbiology, Virology Impact factor: 3.231, year: 2016

  1. Mining of expressed sequence tag libraries of cacao for ...

    Indian Academy of Sciences (India)

    leaves were used to screen a representative set of 12 accessions of cacao. [Riju A., Rajesh M. K., Sherin P. T. P. F., Chandrasekar A., Apshara S. E. and Arunachalam V. 2009 Mining of expressed sequence tag libraries of cacao for microsatellite markers using five computational tools. J. Genet. 88, 217–225]. Introduction.

  2. Movement patterns of red steenbras Petrus rupestrus tagged and ...

    African Journals Online (AJOL)

    ... fish tagged and released in the Tsitsikamma National Park, South Africa. Of 217 fish tagged, 38 were recaptured. Juveniles (700 mm FL) migrated in a north-easterly direction towards the Transkei coast. Keywords: marine protected areas, movement, tag and release, sparids

  3. 75 FR 57261 - Request for Comments on Incentivizing Humanitarian Technologies and Licensing Through the...

    Science.gov (United States)

    2010-09-20

    ... (USPTO) is considering pro-business strategies for incentivizing the development and widespread... reexamination be offered for technologies addressing humanitarian needs? Are there other pro-business strategies... filings should be directed to the Patents Electronic Business Center (EBC) at 866-217-9197. SUPPLEMENTARY...

  4. 46 CFR 13.111 - Restricted tankerman endorsement.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Restricted tankerman endorsement. 13.111 Section 13.111... TANKERMEN General § 13.111 Restricted tankerman endorsement. (a) An applicant may apply at an REC listed in § 10.217 of this chapter for a tankerman endorsement restricted to specific cargoes, specific vessels...

  5. 1151-IJBCS-Article-Ayuba Samali

    African Journals Online (AJOL)

    pc

    2,5-Dihydroxy-4,3-di (ß-D-glucopyrano- syloxy)-trans-stilbene from. Morus bombycis Koidzumi root. Phytother. Res.,. 21(7): 605-608. Kathryn LN, Tracy W, Ashley SM, Brown. Susan ED, Graeme JMA. 2010. Hepatocellular carcinoma in patients with chronic hepatitis C virus infection without cirrhosis. World J. Gastroenterol.,.

  6. DMPD: Translational mini-review series on Toll-like receptors: recent advances inunderstanding the role of Toll-like receptors in anti-viral immunity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 17223961 Translational mini-review series on Toll-like receptors: recent advances i...147(2):217-26. (.png) (.svg) (.html) (.csml) Show Translational mini-review series on Toll-like receptors: r...nity. PubmedID 17223961 Title Translational mini-review series on Toll-like receptors: recent advances inund

  7. EVIDENCE FOR THE EXISTENCE OF LIPID-DIFFUSION BARRIERS IN THE EQUATORIAL SEGMENT OF HUMAN SPERMATOZOA

    NARCIS (Netherlands)

    ARTS, EGJM; JAGER, S; HOEKSTRA, D

    1994-01-01

    Liposomes consisting of negatively charged phospholipids interact almost exclusively with the equatorial segment (ES) of human spermatozoa provided the cells have undergone the acrosome reaction (AR) [Arts, Kuiken, Jager and Hoekstra (1993) Eur. J. Biochem. 217, 1001-1009]. Using fluorescently

  8. Predicting site productivity of the timber tree Pterocarpus angolensis ...

    African Journals Online (AJOL)

    Indicators of productivity used at the local scale were basal area, proportional basal area and site form, which were derived from 217 forest inventory plots in Namibia and Angola. The productivity measures were modelled with abiotic site factors; biotic factors were added for the local scale. Results indicated that the most ...

  9. West African Journal of Applied Ecology

    African Journals Online (AJOL)

    Turacos were restricted to the more pristine parts of the KCA than in secondary forest, where the encounter rates were also relatively lower (0 and 2.17 individuals/h in primary and secondary forests, respectively). The relative abundance and encounter rates of turaco species also varied between the seasons of the year, ...

  10. Identifying the Challenging Factors in the Transition from Colleges of Engineering to Employment

    Science.gov (United States)

    Baytiyeh, Hoda; Naja, Mohamad

    2012-01-01

    The transition from university to a career in engineering is a challenging process. This study examined the perceptions of engineering graduates regarding the difficulties they encountered in their transition from the university to the workplace. Lebanese practising engineers (n=217), living around the world, were surveyed to identify their…

  11. Intrinsic Remediation Engineering Evaluation/Cost Analysis for Car Care Center at Bolling Air Force Base, Washington, DC

    Science.gov (United States)

    1997-01-01

    thicken to the southeast and dip toward the east ( Darton , 1950). The Coastal Plain sediments feather onto crystalline igneous and metamorphic Piedmont...16. Darton , N.H., 1950, Configuration of the Bedrock Surface of the District of Columbia and Vicinity, Geological Survey Professional Paper 217

  12. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    User

    1Department of Pharmacology, 2Department of Herbal Medicine, Faculty of Pharmacy and Pharmaceutical Sciences, College of Health. Sciences ..... Internal Medicine. McgrawHill Co., New York, pp. 1088-1089. Vigar Z (1984). Atlas of Medical Parasitology, 2nd Edi- tion. P.G. Publishing House, Singapore, pp. 216-. 217.

  13. Microaneurysm count as a predictor of long-term progression in diabetic retinopathy in young patients with type 1 diabetes

    DEFF Research Database (Denmark)

    Rasmussen, Malin Lundberg; Broe, R; Frydkjaer-Olsen, U

    2015-01-01

    ), and incident diabetic macula edema (DME). RESULTS: We included 138 patients (138 eyes). Of these, 58 had no retinopathy and 80 had MAs only. At follow-up, rates of two-step progression of DR, progression to PDR and incident DME were 52.9, 21.7, and 10.1 %, respectively. In logistic regression models, MA count...

  14. Cross-Lagged Relationships between Career Aspirations and Goal Orientation in Early Adolescents

    Science.gov (United States)

    Creed, Peter; Tilbury, Clare; Buys, Nick; Crawford, Meegan

    2011-01-01

    We surveyed 217 students (145 girls; average age = 14.6 years) on two occasions, twelve months apart, on measures of career aspirations (job aspirations, job expectations, educational aspirations) and goal orientation (learning, performance-prove, performance-avoid), and tested the causal relationship between goal orientation and aspirations. We…

  15. Nutritional status and laboratory parameters among internal ...

    African Journals Online (AJOL)

    2015-03-19

    Mar 19, 2015 ... Nutritional screening of geriatric patients, close follow‑up and providing earlier health care would contribute rehabilitation of chronic .... Male. 145 (50). Female. 145 (50). Admission diagnosis. Anemia. 47 (16.2). Endocrinology. 94 (32.4). Gastroenterology. 39 (13.4). Oncology. 63 (21.7). Cardiology. 13 (4.5).

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 32; Issue 3. Issue front cover thumbnail. Volume 32, Issue 3. June 2009, pages 215-367. pp 215-215. Foreword · S B Krupanidhi H L Bhat · More Details Fulltext PDF. pp 217-225. Molecule-based magnets · J V Yakhmi · More Details Abstract Fulltext PDF.

  17. Attitudes Aren’t Free: Thinking Deeply about Diversity in the US Armed Forces

    Science.gov (United States)

    2010-02-01

    Paschon, USAF (ret.) Brig Gen Terry L. Paul, USMC (ret.) Brig Gen Frederick R. Payne , USMC (ret.) Brig Gen Gary H. Pendleton, USA (ret.) Brig Gen...Medicine 174, no. 3 (2009): 217. Simon, Cecilia Capuzzi. “Bringing the War Home.” Psychotherapy Networker 31, no. 1 ( January/February 2007): 28–37

  18. Planck early results. XVIII. The power spectrum of cosmic infrared background anisotropies

    DEFF Research Database (Denmark)

    Poutanen, T.; Natoli, P.; Polenta, G.

    2011-01-01

    Using Planck maps of six regions of low Galactic dust emission with a total area of about 140 deg2, we determine the angular power spectra of cosmic infrared background (CIB) anisotropies from multipole = 200 to = 2000 at 217, 353, 545 and 857 GHz. We use 21-cm observations of Hi as a tracer of t...

  19. The outcome at 12 months of very-Iow-birth-weight infants ventilated ...

    African Journals Online (AJOL)

    1995-07-07

    Jul 7, 1995 ... neural deafness, intraventricular haemorrhage (IVH), retinopathy of ... suffer from the consequences of therapy received during the neonatal period or .... NICU and total hospitalisation for the different weight groups are shown in Table 11. MeanlPPV. 9,41. 21,7ab. (days). MeanO,therapy. 17,7. 41,3a. (days).

  20. Disasters, Victimization, and Children's Mental Health

    Science.gov (United States)

    Becker-Blease, Kathryn A.; Turner, Heather A.; Finkelhor, David

    2010-01-01

    In a representative sample of 2,030 U.S. children aged 2-17, 13.9% report lifetime exposure to disaster, and 4.1% report experiencing a disaster in the past year. Disaster exposure was associated with some forms of victimization and adversity. Victimization was associated with depression among 2- to 9-year-old disaster survivors, and with…

  1. The stretch zone of automotive steel sheets

    Indian Academy of Sciences (India)

    This study brings new material properties which are necessary for modelling and simulation the crash behaviour of automotive sheets. ... The specimens were loaded by eccentric tension on a tensile testing machine (FP 100/1) at two crosshead-rates: 0.0217 and 2.17 mm/s. The videoextensometry technique enables us to.

  2. Dicty_cDB: SSI190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1e-13 BT076915_1( BT076915 |pid:none) Caligus rogercresseyi clone crog-e... 77 8e-13 CR382131_1062( CR382131...7e-12 BT077060_1( BT077060 |pid:none) Caligus rogercresseyi clone crog-e... 73 9e-12 FM992689_217( FM992689

  3. Photosymbiotic Giant Clams are Transformers of Solar Flux

    Science.gov (United States)

    2014-01-01

    3059–3066. (doi:10.1242/ jeb .009597) 31. Ainsworth TD , Hoegh-Guldberg O. 2008 Cellular processes of bleaching in the Mediterranean coral Oculina...light transfer ensures efficient resource distribution in symbiont-bearing corals. J. Exp. Biol. 217, 489–498. (doi:10.1242/ jeb . 091116) 33. Cuzzi JN

  4. AcEST: DK951868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -30 tr|Q43412|Q43412_BIDPI Calmodulin OS=Bidens pilosa PE=2 SV=1 133 5e-30 tr|A9NPT3|A9NPT3_PICSI Putative u...EKLTDEEVDEMIREADVDGDGQINYEEFV 143 Query: 217 SVMV 228 VM+ Sbjct: 144 KVMM 147 >tr|Q43412|Q43412_BIDPI Calmodulin OS=Bidens

  5. A ribosomal S-6 kinase-mediated signal to C/EBP-beta is critical for the development of liver fibrosis.

    Directory of Open Access Journals (Sweden)

    Martina Buck

    Full Text Available BACKGROUND: In response to liver injury, hepatic stellate cell (HSC activation causes excessive liver fibrosis. Here we show that activation of RSK and phosphorylation of C/EBPbeta on Thr217 in activated HSC is critical for the progression of liver fibrosis. METHODOLOGY/PRINCIPAL FINDINGS: Chronic treatment with the hepatotoxin CCl(4 induced severe liver fibrosis in C/EBPbeta(+/+ mice but not in mice expressing C/EBPbeta-Ala217, a non-phosphorylatable RSK-inhibitory transgene. C/EBPbeta-Ala217 was present within the death receptor complex II, with active caspase 8, and induced apoptosis of activated HSC. The C/EBPbeta-Ala217 peptides directly stimulated caspase 8 activation in a cell-free system. C/EBPbeta(+/+ mice with CCl(4-induced severe liver fibrosis, while continuing on CCl(4, were treated with a cell permeant RSK-inhibitory peptide for 4 or 8 weeks. The peptide inhibited RSK activation, stimulating apoptosis of HSC, preventing progression and inducing regression of liver fibrosis. We found a similar activation of RSK and phosphorylation of human C/EBPbeta on Thr266 (human phosphoacceptor in activated HSC in patients with severe liver fibrosis but not in normal livers, suggesting that this pathway may also be relevant in human liver fibrosis. CONCLUSIONS/SIGNIFICANCE: These data indicate that the RSK-C/EBPbeta phosphorylation pathway is critical for the development of liver fibrosis and suggest a potential therapeutic target.

  6. Comparative Genomics and an Insect Model Rapidly Identify Novel Virulence Genes of Burkholderia mallei

    Science.gov (United States)

    2008-04-01

    splicing by overlap extension. Methods Enzymol. 217:270–279. 33. Jander, G., L. G. Rahme, and F. M. Ausubel . 2000. Positive correlation between...Spring Harbor, NY. 46. Miyata, S., M. Casey, D. W. Frank, F. M. Ausubel , and E. Drenkard. 2003. Use of the Galleria mellonella caterpillar as a model host

  7. Author Index

    Indian Academy of Sciences (India)

    user1

    see Röttgering, Huub,. 557. Bhattacharya, D. see Marthi, V. R.,. 451. Bi, X. W.. Optical Spectra Evolution of BL Lac ... Estimation of Black Hole Masses from. Steep Spectrum Radio Quasars. 269. Chen, Z.-F. see Wang, Ting-Ting ..... Ray Light Curves of Blazars. 147 see Rani, B.,. 217. Wise, Michael see Röttgering, Huub,. 557.

  8. ECAJS 2009 VOL 14 No 1 FINAL EDIT doc

    African Journals Online (AJOL)

    user

    Rodriguez J, Cuadrado JM, Frances A High-flow priapism as a complication of veno-occlusive priapism: two case reports. Int J Impot Res 2006;18:215-217. 4. Liguori G, Garaffa G, Trombetta C et al. High- flow priapisim(HFP) secondary to. Nesbit operation: management by percutaneous embolization and colour Doppler-.

  9. 76 FR 24022 - Massachusetts Marine Sanitation Device Standard-Receipt of Petition

    Science.gov (United States)

    2011-04-29

    ..., pursuant to Section 312(f)(3) of Public Law 92-500 as amended by Public Law 95- 217 and Public Law 100-4... covering over thirty miles of coastline. The area contains known habitat for soft shelled clam, surf clam...

  10. 75 FR 28245 - Massachusetts Marine Sanitation Device Standard-Receipt of Petition

    Science.gov (United States)

    2010-05-20

    .... Environmental Protection Agency, pursuant to Section 312(f)(3) of Public Law 92-500 as amended by Public Law 95-217 and Public Law 100-4, that adequate facilities for the safe and sanitary removal and treatment of... in the area, including soft- shell clams, surf clams, blue mussels, razor clams, oysters, and ocean...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 217 ... D Livingstone. Vol 40, No 1 (2013), Stereotypes and Subversions: Reading Queer Representations in Two Contemporary South African Novels, Abstract. J Murray ... Vol 35, No 1 (2008), The history of the book in French-speaking Africa: Where the research stands at present, Abstract. D Cooper-Richet.

  12. Establishing the potential dependent equilibrium oxide coverage on platinum in alkaline solution and its influence on the oxygen reduction

    DEFF Research Database (Denmark)

    Wiberg, Gustav; Arenz, Matthias

    2012-01-01

    Publication year: 2012 Source:Journal of Power Sources, Volume 217 Gustav K.H. Wiberg, Matthias Arenz The oxidation process of polycrystalline platinum subjected to alkaline solution is re-examined using a combination of cyclic voltammetry and potential hold techniques in Ar, H2 and O2 purged 0.1 M...

  13. Assessment of Body Weight Standards in Male and Female Army Recruits

    Science.gov (United States)

    1989-12-29

    217-225. 41. Malcom GT, AK Bhattacharyya, M Velez -Duran, MA Guzman, MC Oalmann, JP Strong (1989). Fatty acid composition of adipose tissue In humans...77 ----------------- 151 254 267 267 2C4 256 2488 . . ------- -153 260 275 273 271 4 Tnble 11. Ta~o!e o ita -ity Arreptable Weight (in Potinds) as

  14. time of presentation of stroke patients for ct imaging in a nigerian ...

    African Journals Online (AJOL)

    Challenges in developing countries like Nigeria often lead to delayed presentation of stroke ... haemorrhagic stroke. However, 18 (21.7%) patients had apparently normal CT findings. The mean presentation time for CT imaging was 70 hours (SD ±94 hours). ..... Stroke Nursing; Council on Epidemiology and. Prevention ...

  15. Descriptive epidemiology of Cornelia de Lange syndrome in Europe

    DEFF Research Database (Denmark)

    Barisic, Ingeborg; Tokic, Visnja; Loane, Maria

    2008-01-01

    /106), and terminations of pregnancy following prenatal diagnosis 5.7% (6/106). The most frequent associated congenital malformations were limb defects (73.1%), congenital heart defects (45.6%), central nervous system malformations (40.2%), and cleft palate (21.7%). In the last 11 years, as much as 68% of cases...

  16. Living Together: The Impact of the Intifada and the Peace Negotiations on Attitudes toward Coexistence of Arab and Jewish Pupils in Ethnically Segregated and Mixed Schools in Jaffa.

    Science.gov (United States)

    Zuzovsky, Ruth

    1997-01-01

    Changes in the willingness of Jews and Arabs to coexist were studied in 1989 with 217 12-year-olds and in 1994 with 194 in Jaffa (Israel), where both Jews and Arabs live. Separatist attitudes increased and faith in coexistence decreased, but mixed schools seemed to improve attitudes toward coexistence. (SLD)

  17. The Physician Values in Practice Scale-Short Form: Development and Initial Validation

    Science.gov (United States)

    Rogers, Mary E.; Creed, Peter A.; Searle, Judy; Hartung, Paul J.

    2011-01-01

    The authors conducted two studies to develop and test a short form of the 60-item Physician Values in Practice Scale (PVIPS). The PVIPS, which draws on the theory of work adjustment for its theoretical base, measures personal values specific to medical occupations. In Study 1, 217 first- and final-year medical students completed a Web-based…

  18. Measurement of neutron-induced activation cross-sections using ...

    Indian Academy of Sciences (India)

    which were also found in good agreement with the Monte-Carlo calculations per- formed by Barashenkov et al [8] using Dubna Cascade Code. In ref. [7] one .... B217, 352 (2004). [9] V S Barashenkov, Comp. Phys. Comm. 126, 28 (2000). [10] D E Cullen, PREPRO 2000:2000 ENDF/B Pre-processing Codes, Report IAEA-.

  19. Organization of Hospital Nursing, Provision of Nursing Care, and Patient Experiences with Care in Europe

    NARCIS (Netherlands)

    L. Bruyneel (Luk); B. Li (Baoyue); D. Ausserhofer (Dietmar); E.M.E.H. Lesaffre (Emmanuel); I. Dumitrescu (Irina); H.L. Smith (Herbert L.); D.M. Sloane (Douglas M.); L.H. Aiken (Linda); W. Sermeus (Walter)

    2015-01-01

    textabstractThis study integrates previously isolated findings of nursing outcomes research into an explanatory framework in which care left undone and nurse education levels are of key importance. A moderated mediation analysis of survey data from 11,549 patients and 10,733 nurses in 217 hospitals

  20. 40 CFR 408.121 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall mean the raw material, including freshwater and saltwater... AND STANDARDS CANNED AND PRESERVED SEAFOOD PROCESSING POINT SOURCE CATEGORY Southern Non-Breaded...