WorldWideScience

Sample records for actinium 217

  1. Actinium radioisotope products of enhanced purity

    Science.gov (United States)

    Meikrantz, David Herbert; Todd, Terry Allen; Tranter, Troy Joseph; Horwitz, E. Philip

    2010-06-15

    A product includes actinium-225 (.sup.225Ac) and less than about 1 microgram (.mu.g) of iron (Fe) per millicurie (mCi) of actinium-225. The product may have a radioisotopic purity of greater than about 99.99 atomic percent (at %) actinium-225 and daughter isotopes of actinium-225, and may be formed by a method that includes providing a radioisotope mixture solution comprising at least one of uranium-233 (.sup.233U) and thorium-229 (.sup.229Th), extracting the at least one of uranium-233 and thorium-229 into an organic phase, substantially continuously contacting the organic phase with an aqueous phase, substantially continuously extracting actinium-225 into the aqueous phase, and purifying the actinium-225 from the aqueous phase. In some embodiments, the product may include less than about 1 nanogram (ng) of iron per millicurie (mCi) of actinium-225, and may include less than about 1 microgram (.mu.g) each of magnesium (Mg), Chromium (Cr), and manganese (Mn) per millicurie (mCi) of actinium-225.

  2. Actinium extraction with di(2-ethylhexyl)phosphoric acid

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Rodionova, L.M.; Pyzhova, Z.I.; Myasoedov, B.F.

    1978-01-01

    The extraction of actinium with hdehp from HNO 3 and HClO 4 solutions has been studied in a wide range of acid concentrations. Radioactive Ac 228 has been used as a tracer. Benzene and n-octane have been used as solvents. It has been established that Ac is extracted quantitatively with 0.5 mhdehp in n-octane at HNO 3 concentration -2 M and HClO 4 ( -2 M. Actinium extraction from 8.5 M HClO 4 is 94.7%. The mechanism of actinium extraction has been considered. The composition of the extracted compounds was established, the extraction constant was determined. The most probable form of actinium existance in an organic phase upon extraction from weakly acid solutions is a Asub(c)Xsub(3)x2HX complex and from strongly acid solutions - a solvated complex acid of the HAc(ClO 4 ) 4 x2HX type (where HX - is hdehp)

  3. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  5. Radioactive disequilibrium of uranium and actinium series nuclides in soil

    International Nuclear Information System (INIS)

    Megumi, K.

    1979-01-01

    The concentration of uranium series nuclides ( 238 U, 234 U, 230 Th, 226 Ra, and 210 Pb) and actinium series nuclides ( 235 U and 227 Ac) were determined by γ ray spectrometry for size-separated soil samples collected in Murho and originating from the weathering of granite rock. Each activity ratio of a descendant to 238 U or 235 U is found to be larger than unity. Extraction tests show that approximately 50% of the uranium series nuclides reside on the surface of soil particles and approximately 80% of the 230 Th is surface correlated. Because of the anomalously high radioactivity levels, it was possible to obtain sufficient data to estimate the age of weathering of the soil. A weathering age of >10 3 years was estimated from the 230 Th and 226 Ra surface-correlated activities

  6. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  7. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  8. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  9. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  11. 22 CFR 217.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.4 Section 217.4... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.4 Discrimination... participation in, be denied the benefits of, or otherwise be subjected to discrimination under any program or...

  12. 49 CFR 229.217 - Fuel tank.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fuel tank. 229.217 Section 229.217 Transportation... TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Locomotive Crashworthiness Design Requirements § 229.217 Fuel tank. (a) External fuel tanks. Locomotives equipped with external fuel tanks shall, at a minimum...

  13. 47 CFR 97.217 - Telemetry.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Telemetry. 97.217 Section 97.217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES AMATEUR RADIO SERVICE Special Operations § 97.217 Telemetry. Telemetry transmitted by an amateur station on or within 50...

  14. 48 CFR 252.217-7010 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items of...

  15. 45 CFR 150.217 - Preliminary determination.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Preliminary determination. 150.217 Section 150.217... Are Failing To Substantially Enforce HIPAA Requirements § 150.217 Preliminary determination. If, at... designees). (b) Notifies the State of CMS's preliminary determination that the State has failed to...

  16. 29 CFR 780.217 - Forestry activities.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Forestry activities. 780.217 Section 780.217 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... as It Relates to Specific Situations Hatchery Operations § 780.217 Forestry activities. Operations in...

  17. 49 CFR 217.13 - Information collection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Information collection. 217.13 Section 217.13..., DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING RULES General § 217.13 Information collection. (a) The information collection requirements in this part have been reviewed by the Office of Management and Budget...

  18. 48 CFR 252.217-7009 - Default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Default. 252.217-7009... Clauses 252.217-7009 Default. As prescribed in 217.7104(a), use the following clause: Default (DEC 1991... of default to the Contractor, terminate the whole or any part of a job order if the Contractor fails...

  19. 10 CFR 21.7 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Exemptions. 21.7 Section 21.7 Energy NUCLEAR REGULATORY COMMISSION REPORTING OF DEFECTS AND NONCOMPLIANCE General Provisions § 21.7 Exemptions. The Commission may... requirements of the regulations in this part as it determines are authorized by law and will not endanger life...

  20. 22 CFR 217.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.1 Purpose. The purpose of this part is to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 217.1 Section 217.1 Foreign Relations... the basis of handicap in any program or activity within the United States receiving Federal financial...

  1. 22 CFR 217.45 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 217.45 Section 217.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide...

  2. 22 CFR 217.23 - New construction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...

  3. Nuclear Data Sheets for A=217

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F. G.; McCutchan, E. A.; Singh, B.; Banerjee, K.; Bhattacharya, S.; Chakraborty, A.; Garg, S.; Jovancevic, N.; Kumar, S.; Rathi, S. K.; Roy, T.; Lee, J.; Shearman, R.

    2018-01-01

    The evaluated spectroscopic data are presented for 12 known nuclides with A=217 (Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa, U). For Tl-217, Pb-217, Pa-217, and U-217 nuclei, only information on the ground state is available. Levels in Bi-217 are known only from isomer decay following fragmentation reaction and those in At-217 and Rn-217 only from the a decay of Fr-221 and Ra-221, respectively. High spin levels in Ra-217 are mainly from 1987SuZY and 2011MuZZ which are a lab report and thesis, respectively. Due to differences between these studies, further experimental study is needed to firmly establish the level scheme.This evaluation was carried out as part of a joint IAEA-ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, Aug 22 to Sept 2 2016. The evaluation work was coordinated by E.A. McCutchan (BNL). This work supersedes the previous previous A=217 evaluation (2003Ak06) by Y.A. Akovali.

  4. Nuclear Data Sheets for A=217

    Science.gov (United States)

    Kondev, F. G.; McCutchan, E. A.; Singh, B.; Banerjee, K.; Bhattacharya, S.; Chakraborty, A.; Garg, S.; Jovancevic, N.; Kumar, S.; Rathi, S. K.; Roy, T.; Lee, J.; Shearman, R.

    2018-01-01

    The evaluated spectroscopic data are presented for 12 known nuclides with A=217 (Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa, U). For 217Tl, 217Pb, 217Pa, and 217U nuclei, only information on the ground state is available. Levels in 217Bi are known only from isomer decay following fragmentation reaction and those in 217At and 217Rn only from the α decay of 221Fr and 221Ra, respectively. High spin levels in 217Ra are mainly from 1987SuZY and 2011MuZZ which are a lab report and thesis, respectively. Due to differences between these studies, further experimental study is needed to firmly establish the level scheme. This evaluation was carried out as part of a joint IAEA-ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, Aug 22 to Sept 2 2016. The evaluation work was coordinated by E.A. McCutchan (BNL). This work supersedes the previous previous A=217 evaluation (2003Ak06) by Y.A. Akovali.

  5. 48 CFR 1252.217-72 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1252.217-72... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon...

  6. 33 CFR 117.217 - Norwalk River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Norwalk River. 117.217 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.217 Norwalk River. (a) The draw of.... to 12 p.m., on the first Saturday in December, to facilitate the running of the annual Norwalk River...

  7. 22 CFR 217.21 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.21 Section 217... Discrimination prohibited. No qualified handicapped person shall, because a recipient's facilities within the... excluded from participation in, or otherwise be subjected to discrimination under any program or activity...

  8. 27 CFR 24.217 - Vinegar stock.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Vinegar stock. 24.217... OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.217 Vinegar stock. Vinegar stock may be produced on bonded wine premises with the addition of any quantity of water desired to meet...

  9. 33 CFR 136.217 - Compensation allowable.

    Science.gov (United States)

    2010-07-01

    ...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.217 Compensation... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Compensation allowable. 136.217...

  10. 48 CFR 217.7104 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for...) 252.217-7004, Job Orders and Compensation. (3) 252.217-7005, Inspection and Manner of Doing Work. (4... for, and in, job orders, the clauses in the master agreement, and any other clauses on subjects not...

  11. 13 CFR 134.217 - Settlement.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134.217 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES... issue an order dismissing the case. Settlement negotiations, and rejected settlement agreements, are not...

  12. 40 CFR 86.217-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  13. 49 CFR 397.217 - Waiver processing.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.217 Waiver processing. (a) The... application without prejudice if: (1) he or she determines that there is insufficient information upon which...

  14. 8 CFR 217.2 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS VISA WAIVER PROGRAM § 217.2 Eligibility..., Brunei, Czech Republic, Denmark, Estonia, Finland, France, Germany, Hungary, Iceland, Ireland, Italy... port-of-entry must provide evidence to the immigration officer of financial solvency and a domicile...

  15. 48 CFR 217.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.204 Contracts. (e)(i) Notwithstanding FAR 17.204(e), the ordering period of a task order or delivery order contract... require a longer ordering period. (ii) DoD must submit a report to Congress, annually through fiscal year...

  16. 14 CFR 145.217 - Contract maintenance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) A certificated repair station may contract a maintenance function pertaining to an article to an...) A certificated repair station may contract a maintenance function pertaining to an article to a...

  17. 48 CFR 252.217-7015 - Safety and health.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Safety and health. 252.217... Clauses 252.217-7015 Safety and health. As prescribed in 217.7104(a), use the following clause: Safety and... of any obligations it may have to comply with— (a) The Occupational Safety and Health Act of 1970 (29...

  18. 28 CFR 21.7 - Certification of witness attendance.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Certification of witness attendance. 21.7 Section 21.7 Judicial Administration DEPARTMENT OF JUSTICE WITNESS FEES § 21.7 Certification of witness attendance. In any case in which the U.S. Department of Justice, or office or organization thereof, is a...

  19. 48 CFR 217.7404-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 217.7404-2 Section 217.7404-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contract Actions 217.7404-2 Price ceiling. UCAs shall include a not-to-exceed price. ...

  20. 27 CFR 28.217 - Consignment, shipment, and delivery.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Consignment, shipment, and delivery. 28.217 Section 28.217 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Drawback § 28.217 Consignment, shipment, and delivery. The consignment, shipment, and delivery of wines...

  1. 36 CFR 2.17 - Aircraft and air delivery.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Aircraft and air delivery. 2.17 Section 2.17 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.17 Aircraft and air delivery. (a) The following are...

  2. 30 CFR 285.217-285.219 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false 285.217-285.219 Section 285.217-285.219 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Issuance of OCS Renewable Energy Leases...

  3. 48 CFR 217.7506 - Spare parts breakout program.

    Science.gov (United States)

    2010-10-01

    ..., DoD Supply Chain Materiel Management Regulation, Chapter 8, Section C8.3, for spare parts breakout... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Spare parts breakout program. 217.7506 Section 217.7506 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

  4. 30 CFR 217.51 - Lease account reconciliation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliation. 217.51 Section... MANAGEMENT AUDITS AND INSPECTIONS Oil and Gas, General § 217.51 Lease account reconciliation. Specific lease account reconciliations shall be performed with priority being given to reconciling those lease accounts...

  5. 30 CFR 217.301 - Lease account reconciliations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliations. 217.301 Section... MANAGEMENT AUDITS AND INSPECTIONS Geothermal Resources § 217.301 Lease account reconciliations. Specific lease account reconciliations will be performed with priority being given to reconciling those lease...

  6. 27 CFR 21.7 - Delegations of the Administrator.

    Science.gov (United States)

    2010-04-01

    ... Administrator. 21.7 Section 21.7 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Delegations of the Administrator. The regulatory authorities of the Administrator contained in this part are... the Administrator's Authorities in 27 CFR Part 21, Formulas for Denatured Alcohol and Rum. You may...

  7. 31 CFR 0.217 - Personal financial interests.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Personal financial interests. 0.217... TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.217 Personal financial interests. (a) Employees may... publicly traded corporation with a value of $1000 or less; and (2) The stocks or bonds in the investment...

  8. 48 CFR 1252.217-75 - Lay days.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1252.217-75... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-75 Lay days. As prescribed at (TAR) 48 CFR 1217.7001(c) and (e), insert the following clause: Lay Days (OCT 1994) (a) Lay day...

  9. 48 CFR 3052.217-94 - Lay days (USCG).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Lay days (USCG). 3052.217... CLAUSES Text of Provisions and Clauses 3052.217-94 Lay days (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Lay Days (DEC 2003) (a) Lay day time...

  10. 47 CFR 22.217 - Bidding credit for small businesses.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Bidding credit for small businesses. 22.217... PUBLIC MOBILE SERVICES Licensing Requirements and Procedures Competitive Bidding Procedures § 22.217 Bidding credit for small businesses. A winning bidder that qualifies as a small business, as defined in...

  11. 49 CFR 173.217 - Carbon dioxide, solid (dry ice).

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Carbon dioxide, solid (dry ice). 173.217 Section... Class 7 § 173.217 Carbon dioxide, solid (dry ice). (a) Carbon dioxide, solid (dry ice), when offered for... marked on two sides “WARNING CO2 SOLID (DRY ICE).” (2) Other packagings containing solid carbon dioxide...

  12. 20 CFR 702.217 - Penalty for false statement, misrepresentation.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Penalty for false statement... PROCEDURE Claims Procedures Notice § 702.217 Penalty for false statement, misrepresentation. (a) Any..., or his dependents pursuant to section 9, 33 U.S.C. 909, if the injury results in death, shall be...

  13. 15 CFR 280.217 - Procedural stipulations; extension of time.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Procedural stipulations; extension of... ASSESSMENT PROGRAMS FASTENER QUALITY Enforcement § 280.217 Procedural stipulations; extension of time. (a) Procedural stipulations. Unless otherwise ordered, a written stipulation agreed to by all parties and filed...

  14. 49 CFR 240.217 - Time limitations for making determinations.

    Science.gov (United States)

    2010-10-01

    ... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION QUALIFICATION AND CERTIFICATION OF LOCOMOTIVE ENGINEERS Implementation of the Certification Process § 240.217 Time limitations for making determinations. (a) A railroad shall not certify or recertify a person as a qualified locomotive engineer in any...

  15. 22 CFR 217.42 - Admissions and recruitment.

    Science.gov (United States)

    2010-04-01

    ....42 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.42... disproportionate, adverse effect on handicapped persons or any class of handicapped persons unless (i) the test or...

  16. 14 CFR 217.5 - Data collected (data elements).

    Science.gov (United States)

    2010-01-01

    .... This code represents the industry designator as described in the appendix to § 217.10 of this part. A common private industry source of these industry designator codes is the Official Airline Guides (OAG... reporting the data. The carrier code is assigned by DOT. The Office of Airline Information (OAI'S) will...

  17. 28 CFR 2.17 - Original jurisdiction cases.

    Science.gov (United States)

    2010-07-01

    ... PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.17... Commissioner makes such a designation, the Regional Commissioner shall vote on the case and then refer the case to the other Commissioners for their votes. The decision in an original jurisdiction case shall be...

  18. 49 CFR 199.217 - On-duty use.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY DRUG AND ALCOHOL TESTING Alcohol Misuse Prevention Program § 199.217 On-duty use. Each operator shall prohibit a covered employee from using alcohol... alcohol while performing covered functions shall permit the employee to perform or continue to perform...

  19. 48 CFR 217.7505 - Limitations on price increases.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Limitations on price... Acquisition of Replenishment Parts 217.7505 Limitations on price increases. This section provides implementing... award, on a sole source basis, a contract for any centrally managed replenishment part when the price of...

  20. 48 CFR 217.7103 - Master agreements and job orders.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Master agreements and job... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103 Master agreements and job orders. ...

  1. 48 CFR 217.7103-3 - Solicitations for job orders.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitations for job... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103-3 Solicitations for job orders. (a) When a...

  2. 48 CFR 217.172 - Multiyear contracts for supplies.

    Science.gov (United States)

    2010-10-01

    ... law. For additional policies that apply only to multiyear contracts for weapon systems, see 217.173... requirements of law are met and there are no other statutory restrictions on using a multiyear contract for the... provisions in the contract do not include consideration of recurring manufacturing costs of the contractor...

  3. 49 CFR 180.217 - Requalification requirements for MEGCs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Requalification requirements for MEGCs. 180.217... Requalification requirements for MEGCs. (a) Periodic inspections. Each MEGC must be given an initial visual...) Requalification markings. Each MEGC must be durably and legibly marked in English, with the year and month, and...

  4. 22 CFR 217.46 - Financial and employment assistance to students.

    Science.gov (United States)

    2010-04-01

    .... 217.46 Section 217.46 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE... Education § 217.46 Financial and employment assistance to students. (a) Provision of financial assistance... that discriminate or have the effect of discriminating on the basis of handicap only if the overall...

  5. 42 CFR 413.217 - Items and services included in the ESRD prospective payment system.

    Science.gov (United States)

    2010-10-01

    ... payment system. 413.217 Section 413.217 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT....217 Items and services included in the ESRD prospective payment system. The following items and services are included in the ESRD prospective payment system effective January 1, 2011: (a) Renal dialysis...

  6. 48 CFR 1552.217-73 - Option for increased quantity-cost-type contract.

    Science.gov (United States)

    2010-10-01

    ... accordingly. (c) If this contract contains “not to exceed amounts” for elements of other direct costs (ODCs... quantity-cost-type contract. 1552.217-73 Section 1552.217-73 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of...

  7. 48 CFR 1552.217-74 - Option for increased quantity-cost-plus-award-fee contract.

    Science.gov (United States)

    2010-10-01

    ... accordingly. (c) If this contract contains “not to exceed amounts” for elements of other direct costs (ODCs... quantity-cost-plus-award-fee contract. 1552.217-74 Section 1552.217-74 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES...

  8. MiR-203 suppresses ZNF217 upregulation in colorectal cancer and its oncogenicity.

    Directory of Open Access Journals (Sweden)

    Zewu Li

    Full Text Available Zinc finger protein 217 (ZNF217 is essential for cell proliferation and has been implicated in tumorigenesis. However, its expression and exact roles in colorectal cancer (CRC remain unclear. In this study, we demonstrated that ZNF217 expression was aberrantly upregulated in CRC tissues and associated with poor overall survival of CRC patients. In addition, we found that ZNF217 was a putative target of microRNA (miR-203 using bioinformatics analysis and confirmed that using luciferase reporter assay. Moreover, in vitro knockdown of ZNF217 or enforced expression of miR-203 attenuated CRC cell proliferation, invasion and migration. Furthermore, combined treatment of ZNF217 siRNA and miR-203 exhibited synergistic inhibitory effects. Taken together, our results provide new evidences that ZNF217 has an oncogenic role in CRC and is regulated by miR-203, and open up the possibility of ZNF217- and miR-203-targeted therapy for CRC.

  9. 22 CFR 1203.735-217 - Requesting exceptions from certain statutory prohibitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Requesting exceptions from certain statutory prohibitions. 1203.735-217 Section 1203.735-217 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE RESPONSIBILITIES AND CONDUCT Ethical and Other Conduct and Responsibilities of...

  10. miR-217 suppresses proliferation and promotes apoptosis in cardiac myxoma by targeting Interleukin-6.

    Science.gov (United States)

    Zhang, Jing; Wang, Cui; Xu, Huimin

    2017-08-26

    Cardiac myxoma (CM) is a prevalent primary cardiac tumor. miR-217 plays a vital role in tumorigenesis of various cancers, however, its role and underlying molecular mechanism in human CM remain poorly understood. Here, we reported that the expression of miR-217 was downregulated in CM tissues and inversely correlated with the expression of Interleukin-6 (IL-6) mRNA. Gain-of-function analysis indicated that overexpression of miR-217 inhibited the proliferation and promoted the apoptosis of the primary CM cells. Bioinformatics analysis showed that IL-6 was a direct target gene of miR-217, which is confirmed by the dual luciferase assays. Moreover, downregulation of IL-6 by small interference RNA (siRNA) mimicked the tumor-suppressive effects of miR-217 in CM. Furthermore, rescue experiments pointed out that restoration of IL-6 expression abrogated the anti-proliferative and pro-apoptotic effect induced by miR-217 overexpression in CM cells. Taken together, we validated that miR-217 could act as a tumor suppressor in CM by directly targeting 3'UTR of IL-6 gene, indicating that manipulation of miR-217 may be a potential therapeutic strategy for CM patients. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

    Science.gov (United States)

    2010-10-01

    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...

  12. MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

    International Nuclear Information System (INIS)

    MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

  13. 49 CFR 40.217 - Where is other information on the role of STTs and BATs found in this regulation?

    Science.gov (United States)

    2010-10-01

    ... BATs found in this regulation? 40.217 Section 40.217 Transportation Office of the Secretary of... Personnel § 40.217 Where is other information on the role of STTs and BATs found in this regulation? You can find other information on the role and functions of STTs and BATs in the following sections of this...

  14. MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming, E-mail: lizm_1001@sina.com

    2016-02-26

    MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

  15. 42 CFR 436.217 - Individuals receiving home and community-based services.

    Science.gov (United States)

    2010-10-01

    ... Children and Aged, Blind, and Disabled Individuals, Including Pregnant Women § 436.217 Individuals... if institutionalized. (b) In the absence of home and community-based services under a waiver granted...

  16. 42 CFR 435.217 - Individuals receiving home and community-based services.

    Science.gov (United States)

    2010-10-01

    ... Options for Coverage of Families and Children and the Aged, Blind, and Disabled § 435.217 Individuals... if institutionalized. (b) In the absence of home and community-based services under a waiver granted... services. Options for Coverage of Families and Children ...

  17. 48 CFR 1552.217-71 - Option to extend the term of the contract-cost-type contract.

    Science.gov (United States)

    2010-10-01

    ... (d) If the contract contains “not to exceed amounts” for elements of other direct costs (ODC), those... of the contract-cost-type contract. 1552.217-71 Section 1552.217-71 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES...

  18. 5 CFR 792.217 - Are part-time Federal employees eligible for the child care subsidy program?

    Science.gov (United States)

    2010-01-01

    ... employees eligible for the child care subsidy program? Federal employees who work part-time are eligible for... for the child care subsidy program? 792.217 Section 792.217 Administrative Personnel OFFICE OF... COUNSELING PROGRAMS Agency Use of Appropriated Funds for Child Care Costs for Lower Income Employees-What Is...

  19. Serum microRNAs-217 and -375 as biomarkers of acute pancreatic injury in rats.

    Science.gov (United States)

    Calvano, Jacqueline; Edwards, Gwendolyn; Hixson, Clifford; Burr, Holly; Mangipudy, Raja; Tirmenstein, Mark

    2016-08-10

    Pancreatic injury in rats is primarily detected through histopathological changes and conventional serum biomarkers such as amylase and lipase. However, amylase and lipase have a short half-life and are markers of acinar, not islet cell injury. We investigated whether circulating microRNA (miR) levels that are enriched in acinar cells (miR-217, miR-216a/b) or islet cells (miR-375) could serve as markers of pancreatic injury. Rats were treated with a single dose of either vehicle, streptozotocin (STZ), caerulein, or acetaminophen (APAP), and necropsied at 4, 24, and 48h. Pancreas, liver, heart, kidney and skeletal muscle were analyzed for histopathology. Blood was collected at necropsy and processed to serum for amylase/lipase enzymatic determinations and miR qPCR analysis. Caerulein induced degeneration/necrosis of acinar cells at 4h that persisted for 48h. Caerulein-induced injury was associated with increases in serum amylase/lipase (4h), miR-216a/b (4, 24h). In contrast, serum miR-217 was detected at all time points examined. STZ did not induce increases in either amylase or lipase but did induce increases in miR-375 levels at 4 and 24h. No increases in miR-375 were observed in caerulein-treated rats, and no increases were observed in miR-217 and miR-216a/b in STZ-treated rats. APAP induced centrilobular necrosis in the liver 24h after treatment, but did not induce pancreatic injury or increases in miR-217 or miR-375. Our results suggest that miR-217 and miR-375 represent promising biomarkers of pancreatic injury in rats. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. Snow hazard potential evaluation along G217 highway in Tianshan mountains by using GIS and RS

    Science.gov (United States)

    Tao, Jianwei

    2007-11-01

    Snow hazard especially avalanche potential along G217 national highway in Tianshan Mountains using remote sensing and GIS is evaluated and compared with actual site records of avalanche in a test area. Most places of the actual avalanche accidents are consistent with the places with the high snow hazard potential. But there are several places of the avalanche were not in the high hazard potential areas. The reason for this difference is discussed.

  1. Microstructure, magnetic properties and magnetic hardening in 2:17 Sm-Co magnets

    International Nuclear Information System (INIS)

    Tang, W.; Zhang, Y.; Hadjipanayis, G.C.

    2002-01-01

    A comprehensive and systematic study has been made on Sm(Co,Fe,M,L) z magnets (M=Cu or Ni, and L=Zr or Ti) to completely understand the effects of composition and processing on the microstructure and magnetic properties of magnets. Ti-containing magnets do not have a lamellar phase but exhibit only a cellular microstructure, resulting in a much lower coercivity (below 10 kOe). Ni-containing magnets exhibit a perfect cellular/lamellar microstructure, but without a large domain wall energy gradient at the interface of the 2:17 and 1:5 phases, leading to a low coercivity. Only in the magnets containing both Cu and Zr, a uniform and stable cellular/lamellar microstructure with a high domain wall energy gradient across the 1:5 phase is formed, resulting in high coercivity. These results indicate that the conditions for effective magnetic hardening are: (1) Formation of a cellular/lamellar microstructure, and (2) establishment of a domain wall energy gradient at the cell boundaries. Based on all of these experimental results, the magnetization reversal mechanism of 2:17 Sm-Co magnets can be explained by both the domain wall pinning and nucleation models. The nucleation mechanism holds at any temperature in the Cu-rich magnets, and only above the Curie temperature of the 1:5 phase in the alloys with the lower Cu content. In these cases, the 2:17 cells become magnetically decoupled. (orig.)

  2. Aging method for electronic components and systems based on MIL-HDBK 217

    International Nuclear Information System (INIS)

    Declercq, M.; Simoens, F.

    1984-01-01

    Accelerated aging tests as requested to comply IEEE Std 323-1974, rise the question of the availability of an adequate aging model. After getting through the usual models, the authors describe an aging methodology based on MIL-HDBK 217. The method, taking into account several stress factors, is shown to yield on acceptable acceleration of time, while reducing the relative importance of temperature. Practical implementation of acceleration testing is discussed, and a summary of the gained experience is made and discussed in the scope of the philosophy of IEEE Std 650. Only natural thermal aging and functional aging, excluding irradiation or thermal shocks, are considered [fr

  3. Dynorphin A (2-17) attenuates the unconditioned but not the conditioned effects of opiate withdrawal in the rat.

    Science.gov (United States)

    Shippenberg, T S; Funada, M; Schutz, C G

    2000-09-01

    An unbiased place preference conditioning procedure was used to examine the influence of the non-opioid peptide, dynorphin A 2-17 (DYN 2-17), upon the conditioned and unconditioned effects of opiate withdrawal in the rat. Rats were implanted SC with two pellets containing 75 mg morphine or placebo. Single-trial place conditioning sessions with saline and the opioid receptor antagonist naloxone (0.1-1.0 mg/kg; SC) commenced 4 days later. Ten minutes before SC injections, animals received an IV infusion of saline or DYN 2-17 (0.1-5.0 mg/kg). Additional groups of placebo- and morphine-pelleted animals were conditioned with saline and DYN 2-17. During each 30-min conditioning session, somatic signs of withdrawal were quantified. Tests of place conditioning were conducted in pelleted animals 24 h later. Naloxone produced wet-dog shakes, body weight loss, ptosis and diarrhea in morphine-pelleted animals. Morphine-pelleted animals also exhibited significant aversions for an environment previously associated with the administration of naloxone. These effects were not observed in placebo-pelleted animals. DYN 2-17 pretreatment resulted in a dose-related attenuation of somatic withdrawal signs. However, conditioned place aversions were still observed in morphine-pelleted animals that had received DYN 2-17 in combination with naloxone. Furthermore, the magnitude of this effect did not differ from control animals. These data demonstrate that the administration of DYN 2-17 attenuates the somatic, but not the conditioned aversive effects of antagonist-precipitated withdrawal from morphine in the rat. Differential effects of this peptide in modulating the conditioned and unconditioned effects of opiate withdrawal are suggested.

  4. Remote Raman spectra of benzene obtained from 217 meters using a single 532 nm laser pulse.

    Science.gov (United States)

    Chen, Teng; Madey, John M J; Price, Frank M; Sharma, Shiv K; Lienert, Barry

    2007-06-01

    This report describes a mobile Raman lidar system that has been developed for spectral measurements of samples located remotely at ranges of hundreds of meters. The performance of this system has been quantitatively verified in a lidar calibration experiment using a hard target of standardized reflectance. A new record in detection range was achieved for remote Raman systems using 532 nm laser excitation. Specifically, Raman spectra of liquid benzene were measured with an integration time corresponding to a single 532 nm laser pulse at a distance of 217 meters. The single-shot Raman spectra at 217 meters demonstrated high signal-to-noise ratio and good resolution sufficient for the unambiguous identification of the samples of interest. The transmitter consists of a 20 Hz Nd:YAG laser emitting at 532 nm and 1064 nm and a 178 mm telescope through the use of which allows the system to produce a focused beam at the target location. The receiver consists of a large custom telescope (609 mm aperture) and a Czerny-Turner monochromator equipped with two fast photomultiplier tubes.

  5. Magnetic fields with frequency of 217 Hz can reduce cell apoptosis caused by electrochemotherapy.

    Science.gov (United States)

    Mansourian, M; Firoozabadi, S Mohammad P; Shankayi, Z; Hassan, Z M

    2013-03-01

    Nowadays, due to the wide use of mobile phones, extensive studies have been carried out on the effects of magnetic field (MF) on public health. In this paper, we study the effect of 217 Hz MF similar to that generated by GSM900 mobile phones on cancer and healthy cells treated with electric pulse and cytotoxic drug. The experiments conducted include exposure to (a) electric pulses alone (4000 square-wave electric pulses with low amplitude of 70 V/cm and frequency of 5 kHz), (b) electric pulses following MF exposure, (c) electrochemotherapy (electric pulses and cytotoxic drug) alone and (d) MF exposure with subsequent electrochemotherapy. The results indicate that the percentage of apoptosis decreases significantly (p 217 Hz MF similar to that generated by GSM900 mobile phones can incur resistance of the cells in response to electric pulses. Our findings implied the existence of amplitude window effect in alternations induced by extremely low-frequency MF.

  6. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr−/− mice

    International Nuclear Information System (INIS)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung; Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog; Lee, Yun Mi; Sohn, Eunjin; Kim, Jin Sook

    2015-01-01

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr −/− mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr −/− ) mice. In three-week-old male Vldlr −/− mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr −/− mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC 50 = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB

  7. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)

    2015-01-02

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

  8. Reduction of F1 Neuronal Excitability by Exposure to 217 Hz Magnetic Fields from GSM 900 Mobile Phone

    OpenAIRE

    Mehri Kaviani Moghadam; Seyed Mohammad Firoozabadi; Mahyar Janahmadi

    2009-01-01

    Objective: The aim of this study was to investigate the effects of a 217 Hz magnetic field ofmobile phone GSM 900 exposure on the bioelectric activity of F1 neuronal cells of the landsnail.Materials and Methods: According to the magnetic field measurement of the mobile phone,a range of flux intensities of magnetic fields (0.46 - 229 μT) at a frequency of 217 Hz wasproduced by magnetic field coils. The bioelectrical activity of F1 nerve cells at different timeintervals was recorded, using intr...

  9. Quem é a vítima menor de 14 anos tutelada pelo art. 217-A?

    OpenAIRE

    Shinmi, Marina Vatanabe

    2013-01-01

    Resumo: A lei 12.015/09 foi responsável por diversas alterações no Título VI, do Código Penal, agora denominado "Crimes contra a dignidade sexual". Partindo da análise do Código de 1940, se faz necessário o estudo da figura da violência presumida para adentrar no cerne dessa contenda, o novo tipo penal autônomo "estupro de vulnerável", criado pelo art. 217-A. Observa-se que tanto na doutrina quanto na jurisprudência a vulnerabilidade dos menores de 14 anos é relativizada. O ponto nevrálgico d...

  10. Fluid-mixing studies in a hexagonal 217-pin wire-wrapped rod bundle

    International Nuclear Information System (INIS)

    Symolon, P.D.; Todreas, N.E.

    1981-02-01

    Mixing, pressure drop, and flow split experiments were performed on a 217 pin LMFBR fuel bundle with a pitch to diameter ratio of 1.25 and a lead length of 12 inches. It was found that the turbulent flow data could best be characterized by the energy parameter C/sub 1L/=.106, which is 9% higher than the value from the correlation of Chiu et al. Chiu's correlation was developed on a data base of 61 and 91 pins. The spread of existing data about the correlation is +- 25%, but the error band on our data is expected to be less (approx. +- 10% since injection depth effects were not previously considered). This result is consistent with the concept of increased swirl flow in larger bundles

  11. MicroRNA-217 suppresses homocysteine-induced proliferation and migration of vascular smooth muscle cells via N-methyl-D-aspartic acid receptor inhibition.

    Science.gov (United States)

    Duan, Hongyan; Li, Yongqiang; Yan, Lijie; Yang, Haitao; Wu, Jintao; Qian, Peng; Li, Bing; Wang, Shanling

    2016-10-01

    Hyperhomocysteine has become a critical risk for atherosclerosis and can stimulate proliferation and migration of vascular smooth muscle cells (VSMCs). N-methyl-D-aspartic acid receptor (NMDAR) is a receptor of homocysteine and mediates the effects of homocysteine on VSMCs. Bioinformatics analysis has shown NMDAR is a potential target of microRNA-217 (miR-217), which exerts multiple functions in cancer tumorigenesis and carotid plaque progression. In this study, we sought to investigate the role of miR-217 in VSMCs phenotype transition under homocysteine exposure and elucidate its effect on atherosclerotic plaque formation. After treating with several doses of homocysteine (0-8 × 10(-4)  mol/L) for 24 hours, the expression of miR-217 in HA-VSMCs and rat aortic VSMCs was not altered. Intriguingly, the expression of NMDAR mRNA and protein was reduced by homocysteine in a dose-dependent manner. Transfection of miR-217 mimic significantly inhibited the proliferation and migration of VSMCs with homocysteine treatment, while transfection of miR-217 inhibitor promoted VSMCs migration. Moreover, miR-217 mimic down-regulated while miR-217 inhibitor up-regulated NMDAR protein expression but not NMDAR mRNA expression. Through luciferase reporter assay, we showed that miR-217 could directly bind to the 3'-UTR of NMDAR. MiR-217 mimic transfection also released the inhibition of cAMP-response element-binding protein (CREB)-PGC-1α signalling induced by homocysteine. Additionally, restoration of PGC-1α expression via AdPGC-1α infection markedly suppressed VSMCs proliferation through the degradation of NADPH oxidase (NOX1) and reduction of reactive oxygen species (ROS). Collectively, our study identified the role of miR-217 in regulating VSMCs proliferation and migration, which might serve as a target for atherosclerosis therapy. © 2016 John Wiley & Sons Australia, Ltd.

  12. Solid state reactions of UO2.17 and U4O9 with (NH4)2SO4

    International Nuclear Information System (INIS)

    Singh Mudher, K.D.; Keskar, Meera; Jayadevan, N.C.

    1993-01-01

    The present study on the solid state reactions of (NH 4 ) 2 SO 4 with UO 2.17 and U 4 O 9 is to investigate any differences in the nature of oxidation state of U in the U-O system in the O/U range of 2.00 to 2.25. (author). 5 refs., 2 figs., 1 tab

  13. 31 CFR 585.217 - Entry into the territorial waters of the FRY (S&M) or the riverine ports of the Republic of...

    Science.gov (United States)

    2010-07-01

    ... the FRY (S&M) or the riverine ports of the Republic of Bosnia and Herzegovina prohibited. 585.217... Prohibitions § 585.217 Entry into the territorial waters of the FRY (S&M) or the riverine ports of the Republic... the FRY (S&M); or (b) The riverine ports of those areas of the Republic of Bosnia and Herzegovina...

  14. Use of a genetically enhanced, pediocin-producing starter culture, Lactococcus lactis subsp. lactis MM217, to control Listeria monocytogenes in cheddar cheese

    NARCIS (Netherlands)

    Buyong, N; Kok, J; Luchansky, JB

    1998-01-01

    Cheddar cheese was prepared with Lactococcus lactis subsp, lactis MM217, a starter culture which contains pMC117 coding for pediocin PA-1, About 75 liters of pasteurized milk (containing ca, 3.6% fat) was inoculated with strain MM217 (ca, 10(6) CFU per ml) and a mixture of three Listeria

  15. New regimens with combined oral contraceptive pills--moving away from traditional 21/7 cycles.

    Science.gov (United States)

    Read, Christine M

    2010-12-01

    The practice of extending combined oral contraceptive use (COC) and eliminating or reducing the hormone free interval has been in use for many years. More recently a range of products with new dosing options has been developed and marketed. Women and physicians in developed countries are comfortable with and many prefer the use of extended COC regimens which provide an option to eliminate or reduce the frequency of regular withdrawal bleeding. The extension of active pill taking and the reduction or elimination of the hormone-free interval have been shown to be beneficial for women who experience menstrual cycle-related problems such as heavy bleeding or dysmenorrhoea. The hormone-free interval of less than seven days has additional benefits in managing hormone withdrawal symptoms and efficacy may be improved in situations where pills are inadvertently missed or in women who are perceived as 'poor' pill takers. This paper provides a descriptive review highlighting the development of new dosing options that alter the traditional 21/7 COC regimen. The rationale for and the acceptability of COCs developed with alternative dosing regimens is examined.

  16. [Physician Assisted Suicide - Survey on § 217 StGB in Germany].

    Science.gov (United States)

    Zenz, Julia; Rissing-van Saan, Ruth; Zenz, Michael

    2017-03-01

    Background  In late 2015, Germany passed a law (§ 217 StGB) prohibiting persons from aiding others in committing suicide on a regular, repetitive basis. Despite intensive societal debate and surveys about assisted dying, the present study was the first to examine attitudes towards the new legal regulation among professionals. Methods  In early 2016, all participants of a congress on palliative care received a one-page anonymous questionnaire to complete until the end of the conference. The questionnaire consisted of questions regarding assisted suicide and the new law. The participants were asked to express their agreement or disagreement on a 4 to 5-point Likert scale. Results  457 questionnaires (48 %) were completed, 138 from physicians, 318 from nurses, 1 non specified. More than 80 % knew about the new law. Only half of the respondents supported it. 54 % felt that the law did not sufficiently differentiate between an illegal form of assisted suicide and a form exempt from prosecution. For more than 40 % the new law made no sense. Conclusion  Professionals engaged in terminal care were reluctant to support a criminal liability of "business-like" physician-assisted suicide and suspected greater uncertainty among professionals in end of life care. © Georg Thieme Verlag KG Stuttgart · New York.

  17. Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

    Directory of Open Access Journals (Sweden)

    Mark Walter

    2006-08-01

    Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

  18. New Insights into DNA Recognition by Zinc Fingers Revealed by Structural Analysis of the Oncoprotein ZNF217*

    Science.gov (United States)

    Vandevenne, Marylène; Jacques, David A.; Artuz, Crisbel; Nguyen, Cuong Dinh; Kwan, Ann H. Y.; Segal, David J.; Matthews, Jacqueline M.; Crossley, Merlin; Guss, J. Mitchell; Mackay, Joel P.

    2013-01-01

    Classical zinc fingers (ZFs) are one of the most abundant and best characterized DNA-binding domains. Typically, tandem arrays of three or more ZFs bind DNA target sequences with high affinity and specificity, and the mode of DNA recognition is sufficiently well understood that tailor-made ZF-based DNA-binding proteins can be engineered. We have shown previously that a two-zinc finger unit found in the transcriptional coregulator ZNF217 recognizes DNA but with an affinity and specificity that is lower than other ZF arrays. To investigate the basis for these differences, we determined the structure of a ZNF217-DNA complex. We show that although the overall position of the ZFs on the DNA closely resembles that observed for other ZFs, the side-chain interaction pattern differs substantially from the canonical model. The structure also reveals the presence of two methyl-π interactions, each featuring a tyrosine contacting a thymine methyl group. To our knowledge, interactions of this type have not previously been described in classical ZF-DNA complexes. Finally, we investigated the sequence specificity of this two-ZF unit and discuss how ZNF217 might discriminate its target DNA sites in the cell. PMID:23436653

  19. Enrichment of H(2)(17)O from tap water, characterization of the enriched water, and properties of several (17)O-labeled compounds.

    Science.gov (United States)

    Prasad, Brinda; Lewis, Andrew R; Plettner, Erika

    2011-01-01

    A low-abundance form of water, H(2)(17)O, was enriched from 0.04% to ∼90% by slow evaporation and fractional distillation of tap water. The density and refractive index for H(2)(17)O are reported. Gas chromatography-mass spectrometry (GC-MS) of (16)O- and (17)O-1-hexanols and their trimethyl silyl ethers and of (16)O- and (17)O-hexamethyl disiloxanes was used to determine the percentage of (17)O enrichment in the H(2)(17)O. Furthermore, the chemical shifts of labeled and nonlabeled water dissolved in CDCl(3) differed sufficiently that we could verify the enrichment of H(2)(17)O. (17)O hexanol was synthesized by the reaction of iodohexane with Na(17)OH. (17)O-Labeled trimethylsilanol and (17)O-labeled hexamethyldisiloxane were prepared by the reaction of H(2)(17)O with bis(trimethylsilyl)trifluoroacetamide (BSTFA). To generate standards for (17)O NMR, H(2)(17)O(2), and (17)O camphor were prepared. H(2)(17)O was electrolyzed to form (17)O-labeled hydrogen peroxide which was quantified using two colorimetric assays. (17)O-Labeled camphor was prepared by exchanging the ketone oxygen of camphor using H(2)(17)O. The (17)O-labeled compounds were characterized using (17)O, (1)H, and (13)C NMR and GC-MS. While we were characterizing the labeled camphor, we also detected an unexpected oxygen exchange reaction of primary alcohols, catalyzed by electrophilic ketones such as camphor. The reaction is a displacement of the alcohol OH group by water. This is an example of the usefulness of (17)O NMR in the study of a reaction mechanism that has not been noticed previously.

  20. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

    2008-04-25

    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  1. Mandibulofacial dysostosis in a patient with a de novo 2;17 translocation that disrupts the HOXD gene cluster.

    Science.gov (United States)

    Stevenson, David A; Bleyl, Steven B; Maxwell, Teresa; Brothman, Arthur R; South, Sarah T

    2007-05-15

    Treacher Collins syndrome (TCS) is the prototypical mandibulofacial dysostosis syndrome, but other mandibulofacial dysostosis syndromes have been described. We report an infant with mandibulofacial dysostosis and an apparently balanced de novo 2;17 translocation. She presented with severe lower eyelid colobomas requiring skin grafting, malar and mandibular hypoplasia, bilateral microtia with external auditory canal atreasia, dysplastic ossicles, hearing loss, bilateral choanal stenosis, cleft palate without cleft lip, several oral frenula of the upper lip/gum, and micrognathia requiring tracheostomy. Her limbs were normal. Chromosome analysis at the 600-band level showed a 46,XX,t(2;17)(q24.3;q23) karyotype. Sequencing of the entire TCOF1 coding region did not show evidence of a sequence variation. High-resolution genomic microarray analysis did not identify a cryptic imbalance. FISH mapping refined the breakpoints to 2q31.1 and 17q24.3-25.1 and showed the 2q31.1 breakpoint likely affects the HOXD gene cluster. Several atypical findings and lack of an identifiable TCOF1 mutation suggest that this child has a provisionally unique mandibulofacial dysostosis syndrome. The apparently balanced de novo translocation provides candidate loci for atypical and TCOF1 mutation negative cases of TCS. Based on the agreement of our findings with one previous case of mandibulofacial dysostosis with a 2q31.1 transocation, we hypothesize that misexpression of genes in the HOXD gene cluster produced the described phenotype in this patient.

  2. Evaluation of miR-216a and miR-217 as Potential Biomarkers of Acute Exocrine Pancreatic Toxicity in Rats.

    Science.gov (United States)

    Wang, Jianying; Huang, Wenhu; Thibault, Stephane; Brown, Thomas P; Bobrowski, Walter; Gukasyan, Hovhannes J; Evering, Winston; Hu, Wenyue; John-Baptiste, Annette; Vitsky, Allison

    2017-02-01

    Detecting and monitoring exocrine pancreatic damage during nonclinical and clinical testing is challenging because classical biomarkers amylase and lipase have limited sensitivity and specificity. Novel biomarkers for drug-induced pancreatic injury are needed to improve safety assessment and reduce late-stage attrition rates. In a series of studies, miR-216a and miR-217 were evaluated as potential biomarkers of acute exocrine pancreatic toxicity in rats. Our results revealed that miR-216a and miR-217 were almost exclusively expressed in rat pancreas and that circulating miR-216a and miR-217 were significantly increased in rats following administration of established exocrine pancreatic toxicants caerulein (CL) and 1-cyano-2-hydroxy-3-butene (CHB) as well as in rats administered a proprietary molecule known to primarily affect the exocrine pancreas. Conversely, neither microRNA was increased in rats administered a proprietary molecule known to cause a lesion at the pancreatic endocrine-exocrine interface (EEI) or in rats administered an established renal toxicant. Compared with amylase and lipase, increases in miR-216a and miR-217 were of greater magnitude, persisted longer, and/or correlated better with microscopic findings within the exocrine pancreas. Our findings demonstrate that in rats, miR-216a and miR-217 are sensitive and specific biomarkers of acute exocrine pancreatic toxicity that may add value to the measurement of classical pancreatic biomarkers.

  3. Roflumilast: APTA 2217, B9302-107, BY 217, BYK 20869.

    Science.gov (United States)

    2004-01-01

    Roflumilast [APTA 2217, B9302-107, BY 217, BYK 20869] is a selective phosphodiesterase IV inhibitor. It is being developed by Altana Pharma (formerly Byk Gulden), a subsidiary of Altana Group, as an orally administered therapy for asthma, chronic obstructive pulmonary disease (COPD), allergic rhinitis and psoriasis. The drug is awaiting regulatory approval in Europe for the treatment of asthma and COPD. Byk Gulden has stated that roflumilast relieves asthma symptoms through both an anti-inflammatory effect and a muscle relaxant effect. Roflumilast has potential as first-line long-term therapy in mild-to-moderate COPD and as additive long-term therapy in moderate-to-severe COPD. Altana has stated that roflumilast is to be marketed under the brand name Daxas. Altana Group and Pharmacia Corporation (now Pfizer) signed an agreement on 22 April 2002 to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory disorders, including asthma and COPD. The companies will jointly develop the drug for the US, Europe and other markets. Pharmacia will co-ordinate development in the US and Altana will co-ordinate development in Europe. After approval of the drug, Pharmacia and Altana will jointly launch and promote roflumilast in the US, Europe and elsewhere. Altana will receive an upfront payment and additional milestone payments. Altana additionally has the option to co-promote Pharmacia products in the US and elsewhere. On 16 April 2003, Pharmacia Corporation was acquired by, and merged into, Pfizer. In November 2002, Altana and Tanabe Seiyaku signed an agreement to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory diseases, including asthma and COPD. Tanabe Seiyaku and Altana will develop roflumilast for asthma and COPD in Japan, and will jointly launch and co-promote roflumilast in Japan following regulatory approval. Roflumilast has been in multinational phase III clinical studies

  4. Efficacy and safety of a 21/7-active combined oral contraceptive with continuous low-dose ethinyl estradiol.

    Science.gov (United States)

    Kroll, Robin; Ackerman, Ronald; Feldman, Robert; Howard, Brandon; Weiss, Herman; Hsieh, Jennifer; Ricciotti, Nancy

    2016-03-01

    Substituting low-dose ethinyl estradiol (EE) for the hormone-free interval in combined oral contraceptives (COCs) may enhance ovarian suppression and improve tolerability. This noncomparative phase 3 study evaluated the efficacy and safety of a 21/7-active COC regimen including 21days of desogestrel (DSG)/EE followed by 7days of EE. This multicenter, open-label, phase 3, single-arm study enrolled sexually active women aged 18-40years at risk for pregnancy. Women received up to 1year, or 13 consecutive 28-day cycles, of DSG 150mcg/EE 20mcg for 21days and EE 10mcg alone for 7days. Participants kept diaries to record compliance, bleeding/spotting and other contraceptive use. Efficacy was measured using the Pearl Index (PI) and life-table approach. Safety and tolerability were assessed primarily through reported adverse events (AEs). A total of 2858 women enrolled and 1680 completed the study. Forty-six pregnancies in 2401 women aged 18-35years occurred after COC initiation and up to 7days after last DSG/EE or EE-only tablet was taken. When cycles in which another contraceptive method was used were excluded, the PI was 2.68 [95% confidence interval (CI), 1.96-3.57]. The cumulative pregnancy rate after 1year of treatment was 2.47% (95% CI, 1.85-3.29) for all users aged 18-35years. When only cycles during which women considered compliant were included, the PI was 2.00 (95% CI, 1.39-2.80). AEs were similar to those seen with other oral contraceptives. This 21/7-active DSG/EE COC with 7days of low-dose EE was efficacious and well tolerated for pregnancy prevention. This phase 3 open-label study demonstrated that a 21/7-active COC regimen including 21days of DSG 150mcg/EE 20mcg and 7days of EE 10mcg was efficacious and well tolerated for pregnancy prevention. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 217, Revision 1 (FGE.217Rev1). Consideration of genotoxic potential for α,β-Unsaturated ketones and precursors from chemical subgroup 4.1 of FGE.19: Lactones

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6-methylcouma......The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6...... that 5-ethyl-3-hydroxy-4-methylfuran-2(5H)-one [FL-no: 10.023] does not give rise to concern with respect to genotoxicity and can accordingly, together with the structurally related substance, 3-hydroxy-4,5-dimethylfuran-2(5H)-one [FL-no: 10.030] for which it is a representative, be evaluated using...... the Procedure. For 3,4-dimethyl-5-pentylidenefuran-2(5H)-one [FL-no: 10.042] and furan-2(5H)-one [FL-no: 10.066] the concern for genotoxicity could not be ruled out and a combined micronucleus and Comet assay is requested for these two substances, covering the remaining seven substances [FL-no: 10.034, 10...

  6. Recent extensions and use of the statistical model code EMPIRE-II - version: 2.17 Millesimo

    International Nuclear Information System (INIS)

    Herman, M.

    2003-01-01

    This lecture notes describe new features of the modular code EMPIRE-2.17 designed to perform comprehensive calculations of nuclear reactions using variety of nuclear reaction models. Compared to the version 2.13, the current release has been extended by including Coupled-Channel mechanism, exciton model, Monte Carlo approach to preequilibrium emission, use of microscopic level densities, widths fluctuation correction, detailed calculation of the recoil spectra, and powerful plotting capabilities provided by the ZVView package. The second part of this lecture concentrates on the use of the code in practical calculations, with emphasis on the aspects relevant to nuclear data evaluation. In particular, adjusting model parameters is discussed in details. (author)

  7. Microstructural changes during the slow-cooling annealing of nanocrystalline SmCo 2:17 type magnets

    International Nuclear Information System (INIS)

    Romero, S.A.; Campos, M.F. de; Castro, J.A. de; Moreira, A.J.; Landgraf, F.J.G.

    2013-01-01

    Highlights: ► Use of the Stoner-Wohlfarth Callen Liu Cullen model in 2:17 type magnets. ► Data suggest exchange coupling between Sm2(CoFe)17 and Sm(CoCu)5 phases. ► It is given structural data for phase Sm0.33Zr0.67TM3, with TM=Co,Fe,Cu. ► The beneficial effect of the slow cooling treatment is explained. - Abstract: The microstructure and magnetic properties of 2:17 type isotropic magnets were investigated. The slow cooling heat treatment (cooling at 1 °C/min from 820 to 400 °C, and isothermal treatment during 24 h) was interrupted after the temperatures of 820, 700, 600 and 500 °C and their hysteresis were measured with fields up to 9 T. The fully heat treated sample presented coercivity (μ 0 H) of 3.32 T, after 24 h at 400 °C. The microstructure was investigated with SEM–FEG (Scanning Electron Microscope with Field Emission Gun) and X-ray Diffraction Rietveld analysis. The application of the Stoner–Wohlfarth–Callen–Liu–Cullen (SW–CLC) model points out exchange coupling between ferromagnetic Sm 2 (CoFe) 17 nanocells and ferromagnetic Sm(CoCu) 5 present at the cell boundary phase. The results are interpreted with the double shell model: first-a cobalt-rich ferromagnetic Sm(CoCu) 5 shell originates exchange coupling and second-a copper-rich paramagnetic Sm(CuCo) 5 shell produces magnetic decoupling. This double shell helps to maximize coercivity and remanence. The anisotropy field of the Sm 2 (CoFe) 17 cell phase was estimated in 7 T with the SW–CLC model.

  8. Activation of Na+-K+-ATPase with DRm217 attenuates oxidative stress-induced myocardial cell injury via closing Na+-K+-ATPase/Src/Ros amplifier.

    Science.gov (United States)

    Yan, Xiaofei; Xun, Meng; Dou, Xiaojuan; Wu, Litao; Zhang, Fujun; Zheng, Jin

    2017-04-01

    Reduced Na + -K + -ATPase activity has close relationship with cardiomyocyte death. Reactive oxygen species (ROS) also plays an important role in cardiac cell damage. It has been proved that Na + -K + -ATPase and ROS form a feed-forward amplifier. The aim of this study was to explore whether DRm217, a proved Na + /K + -ATPase's DR-region specific monoclonal antibody and direct activator, could disrupt Na + -K + -ATPase/ROS amplifier and protect cardiac cells from ROS-induced injury. We found that DRm217 protected myocardial cells against hydrogen peroxide (H 2 O 2 )-induced cardiac cell injury and mitochondrial dysfunction. DRm217 also alleviated the effect of H 2 O 2 on inhibition of Na + -K + -ATPase activity, Na + -K + -ATPase cell surface expression, and Src phosphorylation. H 2 O 2 -treatment increased intracellular ROS, mitochondrial ROS and induced intracellular Ca 2+ , mitochondrial Ca 2+ overload. DRm217 closed Na + -K + -ATPase/ROS amplifier, alleviated Ca 2+ accumulation and finally inhibited ROS and mitochondrial ROS generation. These novel results may help us to understand the important role of the Na + -K + -ATPase in oxidative stress and oxidative stress-related disease.

  9. 26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969.

    Science.gov (United States)

    2010-04-01

    ... expenses set forth in subparagraphs (A) through (D) of section 217(b)(1) attributable to the taxpayer alone... attributable to property sold, purchased, or leased by the taxpayer alone, the same type of expenses paid or... (for example, recent high school or college graduates), or individuals who are reentering the labor...

  10. 26 CFR 1.217-1 - Deduction for moving expenses paid or incurred in taxable years beginning before January 1, 1970.

    Science.gov (United States)

    2010-04-01

    ... expenses set forth in section 217(b)(1) which are attributable to the taxpayer alone, the same type of... first time (for example, recent high school or college graduates), or individuals who are re-entering... may be illustrated by the following examples: Example 1. A, a recent college graduate, with his...

  11. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Judd, Chaeli R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2012-09-01

    This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry.

  12. Characterization of velocity and temperature fields in a 217 pin wire wrapped fuel bundle of sodium cooled fast reactor

    International Nuclear Information System (INIS)

    Naveen Raj, M.; Velusamy, K.

    2016-01-01

    Highlights: • We simulate flow and temperature fields in fuel subassembly of fast reactor. • We perform high fidelity computations for 217 pin bundle of 7 axial pitch lengths. • We investigate transverse and axial flows in different types of subchannels. • Correlations are proposed for transverse flow, which form input for subchannel analysis. • Periodic variations of large magnitude are observed in subchannel flow rates. - Abstract: RANS based computational fluid dynamic (CFD) simulation of flow and temperature fields in a fast reactor fuel subassembly has been carried out. The sodium cooled prototype subassembly consists of 217 pins with helical wire spacers. An axial length of seven helical wire pitches has been considered for the study adopting a structured mesh having 36 million points and 84 processors in parallel. The computational model has been validated against in-house and published experimental data for friction factor and Nusselt number. Also, the transverse flow in the central subchannel and swirl flow in the peripheral subchannel are compared against reported experimental data and those computed by subchannel models. The focus of the study is investigation of transverse and axial flows in different types of subchannels. Based on the 3-dimensional CFD study, correlations have been proposed for calculation of transverse flow, which forms an important input for development of subchannel analysis codes. Periodic variations have been observed in the subchannel axial flow rates. For the subchannels located in the central region, the peak to peak variation in the axial flow rate is ∼21% and it is found to be contributed by the changes in the flow area and hydraulic resistance due to frequent passage of helical wires through the subchannel. For the subchannels located in the periphery, this variation is as high as 50%. The transverse flow in the central subchannels follows a cosine profile, for all the faces. However, there is a phase lag of 120

  13. Status of the 7 MeV/u, 217 MHz Injector Linac for the Heidelberg Cancer Therapy Facility

    CERN Document Server

    Schlitt, B; Hutter, G; Klos, F; Lu, Y; Minaev, S A; Mühle, C; Ratzinger, U; Schlitt, B; Tiede, R; Vinzenz, W; Will, C; Zurkan, O

    2004-01-01

    A clinical synchrotron facility for cancer therapy using energetic proton and ion beams (C, He and O) is under construction and will be installed at the Radiologische Universitätsklinik in Heidelberg, Germany, starting in 2005. The status of the ECR ion source systems, the beam line components of the low energy beam transport lines, the 400 keV/u RFQ and the 20 MV IH-cavity as well as the linac rf system will be reported. Two prototype magnets of the linac quadrupole magnets have been built at GSI and have been tested successfully. A test bench for the 1.4 MW, 217 MHz cavity amplifier built by industry has been installed at GSI including a 120 kW driver amplifier which will be used also for high power tests of the RFQ. A test bench for the RFQ using proton beams is presently being set up at the IAP. RF tuning of the 1:2 scaled IH-DTL model as well as Microwave Studio simulations of the model and the power cavity have been also performed at the IAP [1].

  14. Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

    Directory of Open Access Journals (Sweden)

    Kohzad S

    2013-03-01

    Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

  15. Comparative M-H Characteristics of 1-5 and 2-17 Type Samarium-Cobalt Permanent Magnets to 300 C

    Science.gov (United States)

    Niedra, Janis M.

    1994-01-01

    Recent consideration of the use of permanent magnets in space power converters at heat rejection temperatures exceeding 250 C and in miniature high temperature actuators is supporting a search for permanent magnets resistant to demagnetizing forces at high temperature. The present paper investigates the short-term demagnetization resistance to applied bucking fields and at temperatures up to 300 C of SmCo5 type magnets, in the form of 1-cm cubes, from several commercial sources. Quasistatic, 2nd quadrant M-H data taken at selected temperatures are the source of derived plots which are then compared to similar data for previously tested Sm2Co17 type magnets. The 1-5 magnet remanence tends to be about 1.5 kG below that of the 2-17 magnets throughout the temperature range. However, the intrinsic coercivities and M-H curve 'knee-fields' seen in particular 1-5 magnets were considerably above those seen previously in the 2-17 magnets. This superior resistance to demagnetizing fields attainable in 1-5 magnets is also illustrated by safe operating area plots based on the knee-field, the magnetic induction swing and temperature. Comments are made on the possibility that a remanence versus knee-field tradeoff can make 1-5 material competitive with 2-17 in applications where a magnet has to withstand large bucking fields at high temperature.

  16. pages 217 - 225.pmd

    African Journals Online (AJOL)

    Administrator

    hospital ward (west-Chennai, India) using active and passive methods, and characterise the microorganisms. Methods: Air samples (duplicates) were collected simultaneously using exposed-plate, impingement (BioSampler) and filtration (personal sampling filter cassette loaded with gelatin filter) methods over different ...

  17. hsa-miR-96 and hsa-miR-217 Expression Down-Regulates with Increasing Dysplasia in Pancreatic Intraepithelial Neoplasias and Intraductal Papillary Mucinous Neoplasms.

    Science.gov (United States)

    Chang, XiaoYan; Yu, ChunKai; Li, Ji; Yu, Shuangni; Chen, Jie

    2017-01-01

    AIM: To compare the clinicopathological features of pancreatic intraepithelial neoplasias (PanINs) and intraductal papillary mucinous neoplasms (IPMNs), and to investigate the role of hsa-miR-96 and hsa-miR-217 in these two lesions. Methods: Formalin-fixed paraffin-embedded pancreatic specimens were selected in this study, including 58 cases of pancreatic intraepithelial neoplasias (PanINs), 45 cases of pancreatic ductal adenocarcinomas (PDAs), and 57 cases of intraductal papillary mucinous neoplasms (IPMNs). MiRNAs hsa-miR-96 and hsa-miR-217 were detected using locked nucleic acid in situ hybridization (LNA-ISH) with the NBT/BCIP staining system. The differences in miRNA expression among sample sets were analyzed with the Chi-squared test. Results: PanIN-PDAs were inclined to present with higher rate of invasion (p=0.033), lymph node metastasis (p=0.0004) and poorer differentiation (p<0.001). Of the 45 PDAs, only 2 cases were within AJCC Ⅰstage, while there were 11 cases of IPMN associated carcinomas (p=0.0018). In PanIN-1, PanIN-2 and PanIN-3, the expression of hsa-miR-96 was 91.3% (22/23), 78.6%(12/17) and 22.2%(4/18) respectively, while the expression of hsa-miR-217 was 95.7%(22/23) , 70.6% (12/17) and 27.8% (5/18). In IPMN with low-grade, intermediate-grade, high-grade dysplasia, associated carcinoma, the expression of hsa-miR-96 was 67%(9/13), 64%(7/11), 43%(3/7) and 27%(7/26) respectively, while the expression of hsa-miR-217 was 77%(10/13), 64%(7/11), 29%(2/7) and 38%(10/26). The expression of hsa-miR-96 and hsa-miR-217 in PanIN-1 lesions was not significantly different from that in the normal pancreatic ductal epithelium. However, their expression in PanIN-2/3 lesions was significantly different from that in normal pancreatic ductal epithelium (P<0.01). No difference was observed between PanIN derived adenocarcinomas and IPMN-associated carcinomas. Conclusion: IPMN associated carcinomas were in a statistically earlier stage than PanIN- PDAs at the time of

  18. Effectiveness of live attenuated influenza vaccine and inactivated influenza vaccine in children 2-17 years of age in 2013-2014 in the United States.

    Science.gov (United States)

    Caspard, Herve; Gaglani, Manjusha; Clipper, Lydia; Belongia, Edward A; McLean, Huong Q; Griffin, Marie R; Talbot, H Keipp; Poehling, Katherine A; Peters, Timothy R; Veney, Naomi; Ambrose, Christopher S

    2016-01-02

    A postmarketing observational study was initiated to evaluate quadrivalent live attenuated influenza vaccine (LAIV) effectiveness in children aged 2-17 years in the United States. Children and adolescents aged 2-17 years seeking outpatient care for febrile acute respiratory illness Vaccination status was documented from medical records or immunization registries. Children who received ≥1 dose of influenza vaccine ≥14 days before study visit were considered vaccinated. Vaccine effectiveness (VE) was estimated as 100×(1-adjusted odds ratio), where the odds of interest are the odds of vaccine exposure among influenza cases and test-negative controls. In total, 1033 children and adolescents were included in the analysis. Influenza was detected in 14% (145/1033) of all children, with 74% (108/145) of the influenza cases due to A/H1N1pdm09 strains, 21% (31) to influenza B, and 4% (6) to influenza H3N2. LAIV did not show significant effectiveness against A/H1N1pdm09 (VE 13% [95% CI: -55 to 51]) but was effective against B/Yamagata strains (82% [95% CI: 12-96]). Inactivated influenza vaccine was effective against A/H1N1pdm09 (74% [95% CI: 50-86]) and B/Yamagata (70% [95% CI: 18-89]). LAIV provided significant protection against B/Yamagata influenza but not against A/H1N1pdm09 in children aged 2-17 years in 2013-2014, resulting in a proposed change of the 2015-2016 formulation with a new and more heat-stable A/H1N1pdm09 LAIV strain. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    Directory of Open Access Journals (Sweden)

    Mahsa Mansourian

    2012-03-01

    Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

  20. Evaluation of miR-216a and miR-217 as potential biomarkers of acute pancreatic injury in rats and mice.

    Science.gov (United States)

    Goodwin, David; Rosenzweig, Barry; Zhang, Jun; Xu, Lin; Stewart, Sharron; Thompson, Karol; Rouse, Rodney

    2014-09-01

    Mild injury of the exocrine pancreas is often asymptomatic and can be under- or mis-diagnosed. The pancreas-enriched microRNAs miR-216a and miR-217 were evaluated as potential serum biomarkers of exocrine pancreas injury in rodent models of acute pancreatitis induced by caerulein, l-arginine, and pancreatic duct ligation. Both microRNAs showed time- and dose- relevant responses to pancreatic injury and wider dynamic ranges of response than serum amylase or lipase. Pancreas-selective microRNAs were found to be relatively sensitive serum biomarkers of pancreatic injury in rodents with potentially greater specificity than the current standard assays.

  1. In-gas laser ionization and spectroscopy of actinium isotopes near the N =126 closed shell

    Science.gov (United States)

    Granados, C.; Creemers, P.; Ferrer, R.; Gaffney, L. P.; Gins, W.; de Groote, R.; Huyse, M.; Kudryavtsev, Yu.; Martínez, Y.; Raeder, S.; Sels, S.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wrzosek-Lipska, K.; Zadvornaya, A.; Barzakh, A. E.; Bastin, B.; Delahaye, P.; Hijazi, L.; Lecesne, N.; Luton, F.; Piot, J.; Savajols, H.; Thomas, J.-C.; Traykov, E.; Beerwerth, R.; Fritzsche, S.; Block, M.; Fléchard, X.; Franchoo, S.; Ghys, L.; Grawe, H.; Heinke, R.; Kron, T.; Naubereit, P.; Wendt, K.; Laatiaoui, M.; Moore, I.; Sonnenschein, V.; Loiselet, M.; Mogilevskiy, E.; Rothe, S.

    2017-11-01

    The in-gas laser ionization and spectroscopy (IGLIS) technique was applied on the Ac-215212 isotopes, produced at the Leuven Isotope Separator On-Line (LISOL) facility by using the in-gas-cell and the in-gas-jet methods. The first application under on-line conditions of the in-gas-jet laser spectroscopy method showed a superior performance in terms of selectivity, spectral resolution, and efficiency in comparison with the in-gas-cell method. Following the analysis of both experiments, the magnetic-dipole moments for the Ac-215212 isotopes, electric-quadrupole moments and nuclear spins for the Ac,215214 isotopes are presented and discussed. A good agreement is obtained with large-scale nuclear shell-model calculations by using a 208Pb core.

  2. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    Energy Technology Data Exchange (ETDEWEB)

    Aleissa, Khalid A.; Almasoud, Fahad I.; Islam, Mohammed S. [Atomic Energy Research Institute, King Abdul Aziz City for Science and Technology, P.O. Box 6086, Riyadh 11442 (Saudi Arabia); L' Annunziata, Michael F. [IAEA Expert, Montague Group, P.O. Box 5033, Oceanside, CA 92052-5033 (United States)], E-mail: mlannunziata@cox.net

    2008-12-15

    The activities of {sup 228}Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide {sup 228}Ac. The radium was pre-concentrated on MnO{sub 2} and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter {sup 228}Ra({sup 228}Ac), the daughter nuclide {sup 228}Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by {sup 228}Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9{+-}0.1% was measured for {sup 228}Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317{+-}0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of {sup 228}Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for {sup 228}Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure {sup 228}Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  3. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  4. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  6. Pre-eruptive conditions of dacitic magma erupted during the 21.7 ka Plinian event at Nevado de Toluca volcano, Central Mexico

    Science.gov (United States)

    Arce, J. L.; Gardner, J. E.; Macías, J. L.

    2013-01-01

    The Nevado de Toluca volcano in Central Mexico has been active over the last ca. 42 ka, during which tens of km3 of pyroclastic material were erupted and two important Plinian-type eruptions occurred at ca. 21.7 ka (Lower Toluca Pumice: LTP) and ca. 10.5 ka (Upper Toluca Pumice: UTP). Samples from both the LTP and UTP contain plagioclase, amphibole, iron-titanium oxides, and minor anhedral biotite, set in a vesicular, rhyolitic, glassy matrix. In addition, UTP dacites contain orthopyroxene. Analysis of melt inclusions in plagioclase phenocrysts yields H2O contents of 2-3.5 wt.% for LTP and 1.3-3.6 wt.% for UTP samples. Ilmenite-ulvospinel geothermometry yields an average temperature of ~ 868 °C for the LTP magma (hotter than the UTP magma, ~ 842 °C; Arce et al., 2006), whereas amphibole-plagioclase geothermometry yields a temperature of 825-859 °C for the LTP magma. Water-saturated experiments using LTP dacite suggest that: (i) amphibole is stable above 100 MPa and below 900 °C; (ii) plagioclase crystallizes below 250-100 MPa at temperatures of 850-900 °C; and (iii) pyroxene is stable only below pressures of 200-100 MPa and temperatures of 825-900 °C. Comparison of natural and experimental data suggests that the LTP dacitic magma was stored at 150-200 MPa (5.8-7.7 km below the volcano summit). No differences in pressure found between 21.7 ka and 10.5 ka suggest that these two magmas were stored at similar depths. Orthopyroxene produced in lower temperature LTP experiments is compositionally different to those found in UTP natural samples, suggesting that they originated in two different magma batches. Whole-rock chemistry, petrographic features, and mineral compositions suggest that magma mixing was responsible for the generation of the dacitic Plinian LTP eruption.

  7. A comparative CFD investigation of helical wire-wrapped 7, 19 and 37 fuel pin bundles and its extendibility to 217 pin bundle

    International Nuclear Information System (INIS)

    Gajapathy, R.; Velusamy, K.; Selvaraj, P.; Chellapandi, P.; Chetal, S.C.

    2009-01-01

    Preliminary investigations of sodium flow and temperature distributions in heat generating fuel pin bundles with helical spacer wires have been carried out. Towards this, the 3D conservation equations of mass, momentum and energy have been solved using a commercial computational fluid dynamics (CFD) code. Turbulence has been accounted through the use of high Reynolds number version of standard k-ε model, with uniform mesh density respecting wall function requirements. The geometric details of the bundle and the heat flux in are similar to that of the Indian Prototype Fast Breeder Reactor (PFBR) that is currently under construction. The mixing characteristics of the flow among the peripheral and central zones are compared for 7, 19 and 37 fuel pin bundles and the characteristics are extended to a 217 pin bundle. The friction factors of the pin bundles obtained from the present study is seen to agree well with the values derived from experimental correlations. It is found that the normalized outlet velocities in the peripheral and central zones are nearly equal to 1.1-0.9, respectively which is in good agreement with the published hydraulic experimental measurements of 1.1-0.85 for a 91 pin bundle. The axial velocity is the maximum in the peripheral zone where spacer wires are located and minimum in the zones which are diametrically opposite to the respective zone of maximum velocity. The sodium temperature is higher in the zones where the flow area and mass flow rates are less due to the presence of the spacer wires though the axial velocity is higher there. It is the minimum in the peripheral zones where the circumferential flow is larger. Based on the flow and temperature distributions obtained for 19 and 37 pin bundles, a preliminary extrapolation procedure has been established for estimating the temperatures of peripheral and central zones of 217 pin bundle.

  8. Increased risk of revision in patients with non-traumatic femoral head necrosis 11,589 cases compared to 416,217 cases with primary osteoarthritis in the NARA database, 1995–2011

    DEFF Research Database (Denmark)

    Bergh, C.; Fenstad, Ann M.; Furnes, O.

    2014-01-01

    . The relative risk of revision for any reason, for aseptic loosening, dislocation, deep infection, and periprosthetic fracture was studied before and after adjustment for covariates using Cox regression models. Results - 416,217 hips with POA (mean age 69 (SD 10), 59% females) and 11,589 with FHN (mean age 65...

  9. Malachi’s concern for social justice: Malachi 2:17 and 3:5 and its ethical imperatives for faith communities

    Directory of Open Access Journals (Sweden)

    Blessing O. Bọlọjẹ

    2014-07-01

    Full Text Available Any time humans in any culture consider primary ethical concepts, justice will be to the fore. Much seems to hinge upon it whether human society is to function with any semblance of civil order, security and harmony. When justice is pervasively trampled upon, the very fabric of liveable society crumbles. The apprehension for justice is clearly reflected in almost all of the Old Testament (OT. It is an important theological motif in the OT. This is found in such OT literature as historical, legal, prophetic and wisdom writings. This evidence thus reveals that the apprehension for the issue of justice was one of the many ways by which Israel’s multifaceted social life was knit together throughout its various ancient historical developments. No aspect of the life of Israel was excluded from this kind of apprehension for justice, and Yahweh was understood to be actively involved in its entire phase. This article examines Malachi’s fourth disputation in the light of the lawlessness alluded to in Malachi 2:17 and the corruption of personal and civil morality in Malachi 3:5. In the discussions that follow, this article examines the need for the justice of Yahweh; that is, Yahweh’s righting of past wrongs and the reversal of sinful societal order. The purpose is to enact a communal ethic for those who generously care for the neighbourhood and are firm in their devotion to Him, that is, God.

  10. Long-term marginal bone loss in 217 machined-surface implants placed in 68 patients with 5 to 9 years of follow-up: a retrospective study.

    Science.gov (United States)

    Mir-Mari, Javier; Mir-Orfila, Pedro; Valmaseda-Castellón, Eduard; Gay-Escoda, Cosme

    2012-01-01

    The aim of the present study was to evaluate marginal bone loss (mBL) adjacent to dental implants with a machined surface with at least 5 years of function. Machined-surface implants with a minimum follow-up of 5 years were included in the study. Recorded clinical parameters included plaque and gingival bleeding indices, smoking habit (nonsmoker, 0 to 10 cigarettes/day, or more than 10 cigarettes/day), presence of periodontal disease (healthy or periodontally compromised), and compliance with periodontal maintenance. Marginal bone loss (mBL) was assessed radiographically around the implants using the long-cone parallel technique. Sixty-eight participants who received 217 implants were included in the study. No late failures occurred. The mean duration of follow-up was 6.7 years (range, 5 to 9 years). The mean mBL after 5 to 9 years was 0.43 threads (± 1.12 threads) (0.26 mm). Thirteen implants (6.0%) showed a mBL of at least three threads. Multiple linear regression (R2 = 0.229) showed that implants in patients with poor periodontal maintenance and implants placed in periodontally compromised patients were significantly associated with greater mBL (P implants. Regular periodontal maintenance visits every 3 to 6 months, especially in periodontally compromised patients, have to be considered paramount to maintain peri-implant bone levels over the long term.

  11. UV absorption investigation of ferromagnetically filled ultra-thick carbon onions, carriers of the 217.5 nm Interstellar Absorption Feature

    Science.gov (United States)

    Boi, Filippo S.; Zhang, Xiaotian; Ivaturi, Sameera; Liu, Qianyang; Wen, Jiqiu; Wang, Shanling

    2017-12-01

    Carbon nano-onions (CNOs) are fullerene-like structures which consist of quasi-spherical closed carbon shells. These structures have become a subject of great interest thanks to their characteristic absorption feature of interstellar origin (at 217.5 nm, 4.6 μm-1). An additional extinction peak at 3.8 μm-1 has also been reported and attributed to absorption by graphitic residues between the as-grown CNOs. Here, we report the ultraviolet absorption properties of ultra-thick CNOs filled with FePt3 crystals, which also exhibit two main absorption peaks—features located at 4.58 μm-1 and 3.44 μm-1. The presence of this additional feature is surprising and is attributed to nonmagnetic graphite flakes produced as a by-product in the pyrolysis experiment (as confirmed by magnetic separation methods). Instead, the feature at 4.58 μm-1 is associated with the π-plasmonic resonance of the CNOs structures. The FePt3 filled CNOs were fabricated in situ by an advanced one-step fast process consisting in the direct sublimation and pyrolysis of two molecular precursors, namely, ferrocene and dichloro-cyclooctadiene-platinum in a chemical vapour deposition system. The morphological, structural, and magnetic properties of the as-grown filled CNOs were characterized by a means of scanning and transmission electron microscopy, X-ray diffraction, and magnetometry.

  12. In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

    Directory of Open Access Journals (Sweden)

    D. A. Fink

    2015-02-01

    Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

  13. On employing H216O, H217O, H218O, and D216O lines as frequency standards in the 15-170 cm-1 window

    International Nuclear Information System (INIS)

    Furtenbacher, Tibor; Csaszar, Attila G.

    2008-01-01

    The protocol MARVEL, standing for measured active rotational-vibrational energy levels, is used to study high-accuracy measurements of rotational lines of four isotopologues of water, H 2 16 O, H 2 17 O, H 2 18 O, and D 2 16 O, obtained by spectroscopy in the far-infrared (FIR) region of 15-170 cm -1 by Matsushima et al. [Matsushima F, Odashima H, Iwasaki T, Tsunekawa S, Takagi K. Frequency measurement of pure rotational transitions of H 2 O from 0.5 to 5 THz. J Mol Struct 1995; 352/353, 371-8; Matsushima F, Nagase H, Nakauchi T, Odashima H, Takagi K. Frequency measurement of pure rotational transitions of H 2 17 O and H 2 18 O from 0.5 to 5 THz. J Mol Spectrosc 1999;193: 217-23; Matsushima F, Matsunaga M, Qian GY, Ohtaki Y, Wang RL, Takagi K. Frequency measurement of pure rotational transitions of D 2 O from 0.5 to 5 THz. J Mol Spectrosc 2001;206: 41-6; Matsushima F, Tomatsu N, Nagai T, Moriwaki Y, Takagi K. Frequency measurement of pure rotational transitions in the v 2 =1 state of H 2 O. J Mol Spectrosc 2006;235: 190-5]. MARVEL validates the high accuracy of most of the measured line positions. It results in a considerable number of energy levels with an average internal uncertainty of only 40 kHz (2σ). It also supports serious inaccuracy problems when Watson-type A-reduced Hamiltonians are used for predicting the highly accurate rotational measurements for water. Finally, MARVEL suggests a large number of para-water levels, for example 41 for H 2 16 O, which are candidates for becoming frequency standards in the FIR region of 15-170 cm -1 (the 0.5-5 THz window) when an accuracy of about 0.1 MHz is deemed to be sufficient

  14. Atti : programs 2-17

    OpenAIRE

    Grech, Sergio

    1998-01-01

    A series of programs where producer and presenter Sergio Grech explores the story of theatre in Malta and the contribution that various personalities gave to enrich it. Unfortunately, program 1 was lost.

  15. 217 Résumé

    African Journals Online (AJOL)

    AKA BOKO

    diminution du rapport Mg/Ca dans les eaux des aquifères carbonatés. Cette diminution est progressive selon l'âge croissant des terrains aquifères, contrôlée par l'équilibre entre calcite et dolomite et fortement dépendante de la température [4]. La réaction des sulfates favorise la dissolution des minéraux carbonatés. Ceci.

  16. Determination of {sup 227}Ac by {alpha}-particle spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Martin, P. [Environmental Research Inst. of the Supervising Scientist, Jabiru, NT (Australia); Hancock, G.J. [Commonwealth Scientific and Industrial Research Organization, Canberra, ACT (Australia). Div. of Water Resources; Paulka, S. [Australian Radiation Lab., Yallambie, VIC (Australia); Akber, R.A. [Queensland Univ. of Technology, Brisbane, QLD (Australia)

    1995-10-01

    A method is described for the determination of {sup 227}Ac concentration in environmental samples. Actinium is separated from the sample digest by co-precipitation with lead sulphate, purified using anion and cation exchange techniques, and electrodeposited onto a stainless-steel disc. The chemical yield is monitored by addition of a {sup 229}Th/{sup 225}Ra/{sup 225}Ac tracer before sample dissolution. {sup 225}Ac recovery is determined from an initial count by measurement of its {alpha}-emitting daughter, {sup 217}At. The disc is then stored for 2-3 months and recounted. The {sup 227}Ac activity is obtained by measurement of the ingrown {sup 227}Th and {sup 223}Ra activities in the 5.38-6.10 MeV region. Co-precipitation with lead sulphate enables the convenient determination of actinium, thorium and radium on the same sample digest. (author).

  17. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  18. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  19. Bismuth-213 and actinium-225 -- generator performance and evolving therapeutic applications of two generator-derived alpha-emitting radioisotopes.

    Science.gov (United States)

    Morgenstern, Alfred; Bruchertseifer, Frank; Apostolidis, Christos

    2012-07-01

    The alpha emitters (225)Ac and (213)Bi are promising therapeutic radionuclides for application in targeted alpha therapy of cancer and infectious diseases. Both alpha emitters are available with high specific activity from established radionuclide generators. Their favourable chemical and physical properties have led to the conduction of a large number of preclinical studies and several clinical trials, demonstrating the feasibility, safety and therapeutic efficacy of targeted alpha therapy with (225)Ac and (213)Bi. This review describes methods for the production of (225)Ac and (213)Bi and gives an overview of (225)Ac/(213)Bi radionuclide generator systems. Selected preclinical studies are highlighted and the current clinical experience with (225)Ac and (213)Bi is summarized.

  20. Suppression of ovarian activity with a low-dose 21/7-day regimen oral contraceptive containing ethinylestradiol 20 mcg/drospirenone 3 mg in Japanese and Caucasian women.

    Science.gov (United States)

    Anzai, Yuzuru; Heger-Mahn, Doris; Schellschmidt, Ilka; Marr, Joachim

    2012-07-01

    Two studies assessed the effect of a low-estrogen-dose 21/7-day oral contraceptive containing ethinylestradiol and drospirenone (EE 20 mcg/drsp 3 mg) on ovarian activity in Japanese and Caucasian women. Study 1 was conducted in Japanese women (20-35 years), and Study 2 was conducted in Caucasian women (18-35 years). All women received EE 20 mcg/drsp 3 mg in a 21-day active pill regimen. The primary endpoint was the proportion of women with ovulation inhibition (Hoogland score day regimen provides comparable ovarian suppression in Japanese and Caucasian women, with normal ovarian function resuming shortly after treatment end in both populations. Copyright © 2012 Elsevier Inc. All rights reserved.

  1. Decay analysis of compound nuclei formed in reactions with exotic neutron-rich 9Li projectile and the synthesis of 217At* within the dynamical cluster-decay model

    Science.gov (United States)

    Kaur, Arshdeep; Kaushal, Pooja; Hemdeep; Gupta, Raj K.

    2018-01-01

    The decay of various compound nuclei formed via exotic neutron-rich 9Li projectile is studied within the dynamical cluster-decay model (DCM). Following the earlier work of one of us (RKG) and collaborators (M. Kaur et al. (2015) [1]), for an empirically fixed neck-length parameter ΔRemp, the only parameter in the DCM, at a given incident laboratory energy ELab, we are able to fit almost exactly the (total) fusion cross section σfus =∑x=16σxn for 9Li projectile on 208Pb and other targets, with σfus depending strongly on the target mass of the most abundant isotope and its (magic) shell structure. This result shows the predictable nature of the DCM. The neck-length parameter ΔRemp is fixed empirically for the decay of 217At* formed in 9Li + 208Pb reaction at a fixed laboratory energy ELab, and then the total fusion cross section σfus calculated for all other reactions using 9Li as a projectile on different targets. Apparently, this procedure could be used to predict σfus for 9Li-induced reactions where experimental data are not available. Furthermore, optimum choice of "cold" target-projectile combinations, forming "hot" compact configurations, are predicted for the synthesis of compound nucleus 217At* with 8Li + 209Pb as one of the target-projectile combination, or another (t , p) combination 48Ca + 169Tb, with a doubly magic 48Ca, as the best possibility.

  2. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Directory of Open Access Journals (Sweden)

    Mary J. Eaton

    2012-01-01

    Full Text Available Effective treatment of sensory neuropathies in peripheral neuropathies and spinal cord injury (SCI is one of the most difficult problems in modern clinical practice. Cell therapy to release antinociceptive agents near the injured spinal cord is a logical next step in the development of treatment modalities. But few clinical trials, especially for chronic pain, have tested the potential of transplant of cells to treat chronic pain. Cell lines derived from the human neuronal NT2 cell line parentage, the hNT2.17 and hNT2.19 lines, which synthesize and release the neurotransmitters gamma-aminobutyric acid (GABA and serotonin (5HT, respectively, have been used to evaluate the potential of cell-based release of antinociceptive agents near the lumbar dorsal (horn spinal sensory cell centers to relieve neuropathic pain after PNS (partial nerve and diabetes-related injury and CNS (spinal cord injury damage in rat models. Both cell lines transplants potently and permanently reverse behavioral hypersensitivity without inducing tumors or other complications after grafting. Functioning as cellular minipumps for antinociception, human neuronal precursors, like these NT2-derived cell lines, would likely provide a useful adjuvant or replacement for current pharmacological treatments for neuropathic pain.

  3. 75 FR 38052 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2010-07-01

    ... (1.130 N.m) One to six....... Repeat torque but greater than or equal to inspection within 5 LB-IN (0... TIS since last inspection. Less than 10 LB-IN (1.130 N.m) One to six....... Repeat torque but greater... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  4. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2011-03-24

    ... stage and 4th stage low- pressure turbine (LPT) blades for shroud notch wear and replacement of the... without notch gauge support did not show any measurable differences. Revision 6 introduced the notch gauge... proposed AD will probably improve containment with the new design of longer case bolts with crushable...

  5. 49 CFR 217.2 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... negligence standards apply where there is no Federal action covering the subject matter. Under 49 U.S.C... that does not unreasonably burden interstate commerce. Section 20106 permits State tort actions arising...

  6. 14 CFR 217.11 - Reporting compliance.

    Science.gov (United States)

    2010-01-01

    ... subject an air carrier to civil penalties prescribed in Title 49 United States Code section 46301. (b) Title 18 U.S.C. 1001, Crimes and Criminal Procedure, makes it a criminal offense subject to a maximum... jurisdiction of any agency of the United States. ...

  7. 48 CFR 217.170 - General.

    Science.gov (United States)

    2010-10-01

    ... contract to the cost of an annual procurement approach, using a present value analysis. Do not award the multiyear contract unless the analysis shows that the multiyear contract will result in the lower cost (10 U...

  8. 27 CFR 555.217 - Lighting.

    Science.gov (United States)

    2010-04-01

    ... “National Electrical Code,” (National Fire Protection Association, NFPA 70-81), for the conditions present... also meet the standards prescribed by the National Electrical Code. (c) Copies of invoices, work orders or similar documents which indicate the lighting complies with the National Electrical Code must be...

  9. 48 CFR 252.217-7007 - Payments.

    Science.gov (United States)

    2010-10-01

    ... Officer shall approve progress payments based on the value, computed on the price of the job order, of... Contracting Officer may require. (c) The Government will retain until final completion and acceptance of all... direct that progress payments be based on the price of the job order as adjusted as a result of change...

  10. 22 CFR 217.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... relationship that has the effect of subjecting qualified handicapped applicants or employees to discrimination...) Specific activities. The provisions of this subpart apply to: (1) Recruitment, advertising, and the...

  11. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Knowledge integration and the adoption of new agricultural technologies: Kenyan perspectives (restricted access). The study aims to identify and better understand the barriers to knowledge integration for improved agricultural technologies and their adoption. Results suggest a potential link between farmers'' levels of ...

  12. 14 CFR 217.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the definition of revenue passenger; a person traveling at a fare or discount available only to employees or authorized persons of air carriers or their agents or only for travel on the business of the... government officials who are traveling on official business or traveling to or from such duty; (8) Guests of...

  13. 49 CFR 212.217 - Car inspector.

    Science.gov (United States)

    2010-10-01

    ... Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232), to make reports of those... inspector shall demonstrate the following specific qualifications: (1) A comprehensive knowledge of the...), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The...

  14. 14 CFR 120.217 - Tests required.

    Science.gov (United States)

    2010-01-01

    ... after making a contingent offer of employment or transfer, subject to the employee passing the pre... testing will be 25 percent of the covered employees. (2) The Administrator's decision to increase or... functions by every covered employee (whether a new employee or someone who has transferred to a position...

  15. 22 CFR 217.44 - Academic adjustments.

    Science.gov (United States)

    2010-04-01

    ... with manual impairments, and other similar services and actions. Recipients need not provide attendants... adjustments. (a) Academic requirements. A recipient to which this subpart applies shall make such... applicant or student. Academic requirements that the recipient can demonstrate are essential to the...

  16. 22 CFR 217.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... entire sole proprietorship— (A) If assistance is extended to such corporation, partnership, private organization, or sole proprietorship as a whole; or (B) Which is principally engaged in the business of... extended, in the case of any other corporation, partnership, private organization, or sole proprietorship...

  17. 48 CFR 217.7802 - Policy.

    Science.gov (United States)

    2010-10-01

    ... determination of the Under Secretary of Defense for Acquisition, Technology, and Logistics, that it is necessary... considered include— (i) Satisfying customer requirements; (ii) Schedule; (iii) Cost effectiveness (taking... acquisition for analysis. Follow the reporting requirements in Subpart 204.6. ...

  18. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cyanobacteria harmful algal blooms (cyanoHABs) pose a threat to water quality and human health. The Lake Naivasha, Kenya community expressed concern about these events which prompted this study of influences, characteristics and health impacts of cyanoHABs. While eutrophication of Lake Naivasha... Case study ...

  19. 14 CFR 217.10 - Instructions.

    Science.gov (United States)

    2010-01-01

    ... destination. BA—British Airways LHR—London, England ANC—Anchorage, USA NRT—Tokyo-Narita, Japan OSA—Osaka...-flight market. Use the 3-letter code from the City/Airport Codes section of the Official Airline Guide...) of this Appendix. (iv) Line A-4 Destination airport code. This is the arrival airport, where an...

  20. 48 CFR 217.7102 - General.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and... contractors located outside the United States and its outlying areas. (c) Activities may issue job orders... government in the solicitation and job order. [56 FR 36345, July 31, 1991, as amended at 70 FR 35544, June 21...

  1. 48 CFR 217.7101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... master agreement. (2) Is not a contract. (b) Job order— (1) Is a fixed price contract incorporating, by... pertaining to subjects not covered by the master agreement; but applicable to the job order being awarded...

  2. 48 CFR 217.7406 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Undefinitized Contract..., in— (1) All UCAs; (2) Solicitations associated with UCAs; (3) Basic ordering agreements; (4) Indefinite-delivery contracts; (5) Any other type of contract providing for the use of UCAs; and (6) Unpriced...

  3. 48 CFR 217.7401 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Undefinitized Contract... includes task orders and delivery orders. (3) It does not include change orders, administrative changes..., orders under basic ordering agreements, and provisioned item orders, for which the price has not been...

  4. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This thesis aims to better understand the sexual and reproductive health of young women married during their adolescence, in a marginalized Muslim community in a predominantly... Lessons from the old Green Revolution for the new: Social, environmental and nutritional issues for agricultural change in Africa (restricted ...

  5. 48 CFR 217.7801 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Department of State; the Office of Intelligence and Analysis of the Department of the Treasury; and the elements of the Department of Homeland Security concerned with the analysis of intelligence information... that is an element of the intelligence community means the Office of the Director of National...

  6. Immunogenicity, safety and reactogenicity of the pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV) in 2-17-year-old children with asplenia or splenic dysfunction: A phase 3 study.

    Science.gov (United States)

    Szenborn, L; Osipova, I V; Czajka, H; Kharit, S M; Jackowska, T; François, N; Habib, M A; Borys, D

    2017-09-25

    Immunization with pneumococcal vaccines is an important prophylactic strategy for children with asplenia or splenic dysfunction, who are at high risk of bacterial infections (including S. pneumoniae). This study aimed to assess immunogenicity and safety of pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV, GSK) in this at-risk population. This phase III, multi-centre, open-label, controlled study, in which at-risk children with asplenia or splenic dysfunction were enrolled (age strata: 2-4, 5-10 and 11-17years), was conducted in Poland and the Russian Federation. For the 2-4years at-risk group, healthy age-matched children were enrolled as control. Unprimed children (not previously vaccinated with any pneumococcal vaccine) received 2 PHiD-CV doses (≥2months apart) and pneumococcal vaccine-primed children received 1 dose. Immune responses were assessed pre-vaccination and one month post-each dose. Solicited and unsolicited adverse events (AEs) were recorded for 4 and 31days post-vaccination, respectively, and serious AEs (SAEs) throughout the study. Of 52 vaccinated children (18 at-risk primed, 28 at-risk unprimed and 6 control unprimed), 45 (18, 23 and 4, respectively) were included in the according-to-protocol cohort for immunogenicity. Post-vaccination (post-dose 1 in primed and post-dose 2 in unprimed children), for each vaccine pneumococcal serotype and vaccine-related serotype 6A all at-risk children had antibody concentrations ≥0.2µg/mL, and for vaccine-related serotype 19A at least 94.4%. Increases in antibody geometric mean concentrations were observed. For most serotypes, all at-risk children had post-vaccination opsonophagocytic activity (OPA) titers ≥8 and increases in OPA geometric mean titers were observed. No safety concerns were raised. One non-fatal SAE (respiratory tract infection, considered not vaccine-related) was reported by one at-risk unprimed child. PHiD-CV was immunogenic and well tolerated in 2-17

  7. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

    Science.gov (United States)

    2010-10-01

    ... with a positive door opening device that, after the release mechanism has been operated, under the.... (ii) The positive door opening device shall perform the functions specified in paragraph (a)(3)(i) (A... label shall state in letters at least 25 mm (one inch) high, the words “DO NOT BLOCK” in a color that...

  8. Comparative, open-label prospective study on the quality of life and sexual function of women affected by endometriosis-associated pelvic pain on 2 mg dienogest/30 µg ethinyl estradiol continuous or 21/7 regimen oral contraceptive.

    Science.gov (United States)

    Caruso, S; Iraci, M; Cianci, S; Fava, V; Casella, E; Cianci, A

    2016-08-01

    To evaluate the effects of a continuous regimen combined oral contraceptive (COC) containing 2 mg dienogest and 30 µg ethinyl estradiol (DNG/EE) compared to a 21/7 regimen on the quality of life (QoL) and sexual function in women affected by endometriosis-associated pelvic pain. Sixty-three women constituted the Study group treated with DNG/EE COC continuous regimen; 33 women were given DNG/EE COC in a 21/7 regimen. To define the endometriosis-associated pelvic pain, the Visual Analogic Scale was used. The Short Form-36, Female Sexual Function Index (FSFI) and the Female Sexual Distress Scale (FSDS) were used to assess QoL, sexual function and sexual distress, respectively. The study included two follow-ups. At 3 and 6 months of treatment there was an improvement in pain of the Study group (p < 0.001). The Control group underwent pain improvement at the second follow-up (p < 0.05). At the first and the second follow-ups, the Study group reported QoL improvements in all categories (p < 0.001). The Control group reported QoL improvements in all categories at the second follow-up (p < 0.05). At the first and the second follow-ups of the Study group, the FSFI total score had risen (p < 0.001), and the FSDS score had dropped (p < 0.001). An improvement of the FSFI score and a reduction of the FSDS score of the Control group was observed at the second follow-up (p < 0.001), but not at the first follow-up (p = NS). Women on DNG/EE COC continuous regimen reported a reduction of endometriosis-associated pelvic pain and there was an improvement of their sexual activity and their QoL that was better than the DNG/EE 21/7 conventional regimen.

  9. Colloquial and Literary Uses of Inversions. Technical Report No. 217.

    Science.gov (United States)

    Green, Georgia M.

    Inversion constructions (declarative sentence constructions in which the subject follows part or all of its verb phrase) are distributed over the whole range of spoken and written language, not along the spoken-written dimension but along a colloquial-literary dimension. Some of these inversions are colloquial or literary for functional reasons,…

  10. 217 THE LAND USE ACT AND EQUITY FACTOR IN PROPERTY ...

    African Journals Online (AJOL)

    Fr. Ikenga

    the paper examines the provisions of the Land Use Act on property tax in line with normative principles ... required funds, government demand contributions from its citizens in form of taxes, levies, charges and tariffs ..... inheritance and/or population growth and the consequent pressure on land.38 It approaches these issues.

  11. 29 CFR 778.217 - Reimbursement for expenses.

    Science.gov (United States)

    2010-07-01

    ... transportation (whether by private car or common carrier) and living expenses away from home, other travel... before the employee has had an opportunity to find living quarters at the new location or (ii) because...

  12. 31 CFR 31.217 - Confidentiality of information.

    Science.gov (United States)

    2010-07-01

    ... prevent unauthorized access to computer equipment and data storage devices that store or transmit... business days of detecting a violation of the prohibitions in paragraph (b), above. The security measures required by this paragraph shall include: (1) Security measures to prevent unauthorized access to...

  13. 48 CFR 252.217-7001 - Surge option.

    Science.gov (United States)

    2010-10-01

    ... delivery called for under this contract, at a price or cost established before contract award or to be... may exercise this option at any time before acceptance by the Government of the final scheduled... establish a not-to-exceed price equal to the highest contract unit price or cost of the added or accelerated...

  14. 78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage

    Science.gov (United States)

    2013-01-02

    ... under the common law standard, and an employer is the person that is the employer of an employee under the common law standard. Under the common law standard, an employment relationship exists when the... and means by which that result is accomplished. Under the common law standard, an employment...

  15. 5 CFR 532.217 - Appropriated fund survey jobs.

    Science.gov (United States)

    2010-01-01

    ... Operator I 9 Carpenter 9 Electrician 10 Automotive Mechanic 10 Sheet Metal Mechanic 10 Pipefitter 10 Welder 10 Machinist 10 Electronics Mechanic 11 Toolmaker 13 (b) A lead agency may not omit a required survey... Aircraft Mechanic 10 Electrician, Ship 10 Pipefitter, Ship 10 Shipfitter 10 Shipwright 10 Machinist, Marine...

  16. 8 CFR 217.4 - Inadmissibility and deportability.

    Science.gov (United States)

    2010-01-01

    ..., will be refused admission into the United States and removed. Such refusal and removal shall be made at... be effected without referral of the alien to an immigration judge for further inquiry, examination... Referral to Immigration Judge, for a proceeding in accordance with 8 CFR 208.2(c)(1) and (c)(2). (2) The...

  17. 29 CFR 1910.217 - Mechanical power presses.

    Science.gov (United States)

    2010-07-01

    ...) Brakes. Friction brakes provided for stopping or holding a slide movement shall be inherently self... attachments at any point in its travel. (3) Machines using full revolution positive clutches. (i) Machines... circuit to prevent or stop slide motion if the operator's hand or other part of his body is within the...

  18. 48 CFR 217.171 - Multiyear contracts for services.

    Science.gov (United States)

    2010-10-01

    ..., vehicles, and other highly complex military equipment. (iii) Specialized training requiring high quality instructor skills (e.g., training for pilots and aircrew members or foreign language training). (iv) Base... disposal). (v) Environmental remediation services for— (A) An active military installation; (B) A military...

  19. JCSC_128_2_217-226_SI_a.doc

    Indian Academy of Sciences (India)

    All reagents were purchased from TCI and Sigma Aldrich and used without further purification. All the products ... General procedure for the four component synthesis of compounds 13 and 14: A solution of 4-chloro-3-formyl coumarin (1 mmol), morpholine/ thiomorpholine (2 mmol) were refluxed for 2 min in benzene. To this ...

  20. 8 CFR 217.3 - Maintenance of status.

    Science.gov (United States)

    2010-01-01

    ... under this part from departing from the United States within his or her period of authorized stay, the district director having jurisdiction over the place of the alien's temporary stay may, in his or her... during that period, the alien is to be regarded as having satisfactorily accomplished the visit without...

  1. 8 CFR 217.5 - Electronic System for Travel Authorization.

    Science.gov (United States)

    2010-01-01

    ... specified herein. (b) Time. Each alien falling within the provisions of paragraph (a) of this section must... required. Each nonimmigrant alien intending to travel by air or sea to the United States under the Visa Waiver Program (VWP) must, within the time specified in paragraph (b) of this section, receive a travel...

  2. 12038_2016_9610_Article_print 205..217

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... discoideum. DdRabS is a Dictyostelium Rab that is 80% homologous to DdRab1 which is required for protein transport between the ER and Golgi. Expression of GFP-tagged DdRab2 and DdRabS proteins showed localization to. Golgi membranes and to the contractile vacuole system (CV) in Dictyostelium ...

  3. All projects related to | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Program: Maternal and Child Health. Total Funding: CA$ 137,690.00. Health Trends in Post-conflict North Uganda. Project. A new disease profile of Gulu District and neighbouring areas in North Uganda will help local health service providers meet the changing health needs of the most vulnerable. Start Date: February 15, ...

  4. 34 CFR 685.217 - Teacher loan forgiveness program.

    Science.gov (United States)

    2010-07-01

    ... Elementary and Secondary Education Act of 1965, as amended. Elementary school means a public or nonprofit... school means a public or nonprofit private school that provides secondary education as determined by... of the elementary school curriculum, as certified by the chief administrative officer of the eligible...

  5. Dicty_cDB: SSH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IKKRKKKRKKKKKEKKNLKKKKKI EKKKLKM*w*nqsrmeiqkkifinchynqcidivpsvcmllgpvcslvtli*iyivifik Translated Amino Acid ...cnxlkcissl *QKKIFKKKKKRKKKNXKIFFLKSILNINNNVFFFFIKKRKKKRKKKKKEKKNLKKKKKI EKKKLKM*w*nqsrmeiqkkifinchynqcidivps

  6. 217 | Page A JURISPRUDENCE OF THE RULE OF LAW: AN ...

    African Journals Online (AJOL)

    Fr. Ikenga

    government and the government is its slave, then the situation is full of promise and men enjoy all the .... 19 I.E. Sagay, “The Judiciary in Modern Democracy” in Ayua I.A. and Guobadia D.A. et al (eds.) Issues in the 1999. Constitution, Nigeria Institute of Advanced Legal Studies, Lagos, 2000, p. 79. 20 [1986] INWLR 18, p.

  7. 48 CFR 217.7103-4 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... soliciting offers, may issue a written job order to a contractor that has previously executed a master...

  8. 48 CFR 217.7103-2 - Period of agreement.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for.... (c) Cancellation of a master agreement does not affect the rights and liabilities under any job order existing at the time of cancellation. The contractor must continue to perform all work covered by any job...

  9. 48 CFR 217.7103-6 - Modification of master agreements.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS... only by modifying the master agreement itself. It shall not be changed through a job order. (c) A modification to a master agreement shall not affect job orders issued before the effective date of the...

  10. 20 CFR 217.3 - Need to file an application.

    Science.gov (United States)

    2010-04-01

    ... application will— (a) Permit a formal decision on whether the person is entitled to an annuity or lump sum; (b) Protect a person's entitlement to an annuity for as many as 12 months before the application is filed; and (c) Provide the right to appeal if the person is dissatisfied with the decision (see part 260 of this...

  11. 7 CFR 2.17 - Under Secretary for Rural Development.

    Science.gov (United States)

    2010-01-01

    ... encouraging the creation of rural community development organizations. (5) Assist other Federal agencies in...)), with respect to the designation of officials who may obligate money in the Hazardous Substances... organizations in foreign countries (7 U.S.C. 3291). (xv) Administer in rural areas the process of designation...

  12. 48 CFR 252.217-7027 - Contract definitization.

    Science.gov (United States)

    2010-10-01

    ...., fixed-price or cost-and-fee) proposal and cost or pricing data supporting its proposal. (b) The schedule for definitizing this contract is as follows (insert target date for definitization of the contract... of the make-or-buy and subcontracting plans and cost or pricing data). (c) If agreement on a...

  13. 12038_2016_9610_Article_print 205..217

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... structure and function of the Golgi apparatus (Sigma, St. Louis, MO, USA 2003). First, cells were harvested and allowed to settle in a 35×10 mm Petri dish. Loflo medium containing BFA at a concentration of 5 μM was added. Cells were incubated for 60 min. Fluorescence from GFP and. FM®1-43 (AX4) was ...

  14. 48 CFR 52.217-8 - Option To Extend Services.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... of any services within the limits and at the rates specified in the contract. These rates may be...

  15. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ...) Species Delineation Zone Mitgation Scenario Impact Zone Radius Pre Det Surface Survey (min) Pre Det Aerial... entire impact zone. These vantage points may be on the structure being removed or proximal surface...

  16. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2012-09-01

    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  17. Cyclotron production of cesium radionuclides as analogues for francium-221 biodistribution

    International Nuclear Information System (INIS)

    Finn, R.; McDevitt, M.; Sheh, Y.; Lom, C.; Qiao, J.; Cai, S.; Burnazi, E.; Nacca, A.; Pillarsetty, N.; Jaggi, J.; Scheinberg, D.

    2005-01-01

    In our clinical investigations focussing on improved therapeutic treatment of specific tumors we have concentrated on a targeted therapy approach utilizing designed radiolabeled monoclonal antibodies as the cytotoxic reagent. The physical characteristics of the alpha particle emitting radionuclide bismuth-213 including the short half-life of 45.6 min, has shown promise for the treatment of specific cancers such as leukemias and lymphomas or micrometastatic carcinomas. In an effort to increase the cytocidal effect of the HuM195, a humanized monoclonal antibody carrier to the CD33 antigen expressed on leukemia cells, our focus is directed toward an 'internal' nano-generator composed of Ac-225 radionuclide, the parent of the bismuth-213. The actinium-225 radionuclide decays through several short-lived, alpha emitting daughters including francium-221, astatine-217 and bismuth-213. In order to study the biodistribution and the pharmacokinetics of the individual daughter nuclide, francium-221, the cyclotron production and separation of cesium radionuclides, specifically cesium-132, from a natural xenon gas target was undertaken. The choice of cesium as an analogue for francium was predicated upon both elements being in Group 1A alkali metals and cesium radionuclide possesses a sufficient half-life to allow biodistribution studies to be performed. The preliminary experimental results of this investigation are presented

  18. Cyclotron production of cesium radionuclides as analogues for francium-221 biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Finn, R. [Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States) and Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States)]. E-mail: finnr@mskcc.org; McDevitt, M. [Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Department of Medicine, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Sheh, Y. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Lom, C. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Qiao, J. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Cai, S. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Burnazi, E. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Nacca, A. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Pillarsetty, N. [Cyclotron Core Facility, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Jaggi, J. [Department of Medicine, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States); Scheinberg, D. [Department of Medicine, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10021 (United States)

    2005-12-15

    In our clinical investigations focussing on improved therapeutic treatment of specific tumors we have concentrated on a targeted therapy approach utilizing designed radiolabeled monoclonal antibodies as the cytotoxic reagent. The physical characteristics of the alpha particle emitting radionuclide bismuth-213 including the short half-life of 45.6 min, has shown promise for the treatment of specific cancers such as leukemias and lymphomas or micrometastatic carcinomas. In an effort to increase the cytocidal effect of the HuM195, a humanized monoclonal antibody carrier to the CD33 antigen expressed on leukemia cells, our focus is directed toward an 'internal' nano-generator composed of Ac-225 radionuclide, the parent of the bismuth-213. The actinium-225 radionuclide decays through several short-lived, alpha emitting daughters including francium-221, astatine-217 and bismuth-213. In order to study the biodistribution and the pharmacokinetics of the individual daughter nuclide, francium-221, the cyclotron production and separation of cesium radionuclides, specifically cesium-132, from a natural xenon gas target was undertaken. The choice of cesium as an analogue for francium was predicated upon both elements being in Group 1A alkali metals and cesium radionuclide possesses a sufficient half-life to allow biodistribution studies to be performed. The preliminary experimental results of this investigation are presented.

  19. People and things. CERN Courier, September 1981, v. 21(7)

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: The King of Belgium recently paid a state visit to the People's Republic of China and invited four Belgian scientists to accompany him — M. Engelborghs-Bertelsr P. Melchior (Royal Observatory of Brussels and Louvain), J. van der Veken (Louvain) and Y. Go/dschmidt-Clermont (Brussels and CERN). Yves Goldschmidt- Clermont provided us with the following report. Italian physicists are presently developing a large modular track detector to be installed in the future Gran Sasso underground laboratory. Such a 'Giant Underground track- Detector' (GUD), up to 10 Kt in mass, should be capable of investigating nucleon decay and the interactions of high energy cosmic neutrinos. An International Conference on Nucleus-Nucleus Collisions will be held at Michigan State University from 26 September to 1 October, 1982

  20. WE-G-217A-01: Fast Recovery Driven Equilibrium with Automated Switching to Avoid Artifacts.

    Science.gov (United States)

    Edmonson, H; Bernstein, M

    2012-06-01

    To reduce image artifacts from the unnecessary use of driven- equilibrium. Driven-equilibrium methods known as fast recovery, RESTORE, or DRIVE enable reduction of repetition time (TR) and hence acquisition time in RARE (FSE or TSE) imaging by applying additional RF pulses following each echotrain to accelerate T1 recovery. Fast recovery (FR) techniques are most useful when TR is less than 4*T1. For neuroimaging, the benefit of FR diminishes as TR increases beyond ∼3s. In regions of rapid susceptibility change such as near metallic implants, FR techniques can introduce artifact because the magnetization is not properly rephased when the FR pulses are applied. In our clinical practice we observe that technologists frequently adjust TR over a range of 2-5s on a patient- specific basis to minimize scan time. We do not observe, however, that technologists reliably disable FR when TR is long enough, introducing possible artifacts. An FR-FSE pulse sequence was modified to automatically disable the FR feature whenever TR exceeded a user-defined threshold (TR0). Under IRB approval, a healthy volunteer was scanned with the sequence using TRs ranging from 1-5s, and TR0=900ms or 6s. Contrast- to-noise measurements were made between CSF, gray matter and white matter for each dataset. The volunteer study shows decreasing benefit of FR as TRs increase beyond 3s. A patient with bilateral auditory brainstem implants scanned with and without FR demonstrates FR-induced artifacts. We demonstrate an FR-FSE pulse sequence that automatically disables fast-recovery whenever TR exceeds an operator- selected threshold. The pulse sequence avoids unnecessary artifacts in regions of rapid susceptibility changes, while retaining the advantages of FR when TRartifacts introduced by FR, and the benefits of automatically avoiding unnecessary use of FR. © 2012 American Association of Physicists in Medicine.

  1. Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

    Directory of Open Access Journals (Sweden)

    Ana Claudia Camargo Gonçalves da Silva

    2012-01-01

    Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

  2. : tous les projets | Page 217 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'établissement d'un réseau de politique étrangère à Ottawa aidera à combler certaines lacunes, à renforcer le milieu de la politique étrangère dans la région de la capitale nationale et à intégrer de jeunes professionnels aux travaux en cours. Date de début : 1 mars 2012. End Date: 28 février 2015. Sujet: FOREIGN ...

  3. Progress of Recycling in the Built Environment Final report of the RILEM Technical Committee 217-PRE

    CERN Document Server

    2013-01-01

    This report is a useful tool for countries starting to recycle aggregates or construction and demolition waste. It contains the latest developments in this field, introduces a completely new approach to the procedure of proportioning concrete mixtures with recycled aggregate, references recent publications, opinions and discrepancies in relation to the durability of recycled concrete, such as freeze-thaw standards, studies of chloride penetration and diffusion, and sulfate attacks, the use of the fine fraction <4mm, quality assurance of concrete recycled aggregate, sustainability and recycling construction waste and global impact assessment of urban renewal based on sustainable recycling strategies for construction and demolition waste. This volume will be of interest to recyclers, researchers and consumers.

  4. Supplement to J. Genet. 84, 217–222 (2005), V. Rodrigues ...

    Indian Academy of Sciences (India)

    rdt

    29. CAMPOS-ORTEGA, J.A. and N.J. STRAUSFELD. Synaptic connections of intrinsic cells and basket arbo-rizations in the external plexi- form layer of the fly's eye. Brain Research, 59, 119-136 (1973). 30. CAMPOS-ORTEGA, J.A. Autoradiographic localization of 3H- -aminobutyric acid uptake in the lamina ganglionaris of ...

  5. 40 CFR 80.217 - How does a refiner or importer apply for the GPA standards?

    Science.gov (United States)

    2010-07-01

    ... annual average sulfur standard for gasoline produced for use in the GPA for the 2004 through 2006 annual... for gasoline produced for use in the GPA. (d) If EPA finds that a refiner or importer provided false... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur Geographic Phase...

  6. Yeast Interacting Proteins Database: YMR159C, YBR217W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ure on bait (YPD) 11 Literature on prey (YPD) 16 Literature shared by bait and prey 7 Literature...s prey Rows with this prey as prey (3) Rows with this prey as bait Rows with this prey as bait (2) Literat

  7. Subtask 2.17 - CO2 Storage Efficiency in Deep Saline Formations

    Energy Technology Data Exchange (ETDEWEB)

    Gorecki, Charles D. [Univ. of North Dakota, Grand Forks, ND (United States); Liu, Guoxiang [Univ. of North Dakota, Grand Forks, ND (United States); Braunberger, Jason R. [Univ. of North Dakota, Grand Forks, ND (United States); Klenner, Robert C. L. [Univ. of North Dakota, Grand Forks, ND (United States); Ayash, Scott C. [Univ. of North Dakota, Grand Forks, ND (United States); Dotzenrod, Neil W. [Univ. of North Dakota, Grand Forks, ND (United States); Steadman, Edward N. [Univ. of North Dakota, Grand Forks, ND (United States); Harju, John A. [Univ. of North Dakota, Grand Forks, ND (United States)

    2014-02-01

    As the field of carbon capture and storage (CCS) continues to advance, and large-scale implementation of geologic carbon dioxide (CO2) storage progresses, it will be important to understand the potential of geologic formations to store meaningful amounts of CO2. Geologic CO2 storage in deep saline formations (DSFs) has been suggested as one of the best potential methods for reducing anthropogenic CO2 emission to the atmosphere, and as such, updated storage resource estimation methods will continue to be an important component for the widespread deployment of CCS around the world. While there have been several methodologies suggested in the literature, most of these methods are based on a volumetric calculation of the pore volume of the DSF multiplied by a storage efficiency term and do not consider the effect of site-specific dynamic factors such as injection rate, injection pattern, timing of injection, pressure interference between injection locations, and overall formation pressure buildup. These volumetric methods may be excellent for comparing the potential between particular formations or basins, but they have not been validated through real-world experience or full-formation injection simulations. Several studies have also suggested that the dynamic components of geologic storage may play the most important role in storing CO2 in DSFs but until now have not directly compared CO2 storage resource estimates made with volumetric methodologies to estimates made using dynamic CO2 storage methodologies. In this study, two DSFs, in geographically separate areas with geologically diverse properties, were evaluated with both volumetric and dynamic CO2 storage resource estimation methodologies to compare the results and determine the applicability of both approaches. In the end, it was determined that the dynamic CO2 storage resource potential is timedependent and it asymptotically approaches the volumetric CO2 storage resource potential over very long periods of time in the two systems that were evaluated. These results indicate that the volumetric assessments can be used as long as the appropriate storage efficiency terms are used and it is understood that it will take many wells over very long periods of time to fully realize the storage potential of a target formation. This subtask was funded through the Energy & Environmental Research Center (EERC)– U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  8. Mid IR-fiber spectroscopy in the 2-17μm range

    Science.gov (United States)

    Artyushenko, Viatcheslav G.; Bocharnikov, A.; Colquhoun, Gary; Leach, Clive A.; Lobachov, Vladimir; Pirogova, Lyudmila; Sakharova, Tatjana; Savitskij, Dmitrij; Ezhevskaya, Tatjana; Bublikov, Alexandr

    2007-10-01

    The latest development in IR-fibre optics enables us to expand the spectral range of process spectroscopy from 2μm out to 17μm (5000 to 600cm-1) i.e. into the most informative "finger-print" part of the spectrum. Mid-IR wavelength ranges from 2 to 6-10μm may be covered by Chalcogenide IR-glass CIR-fibres while Polycrystalline PIR-fibres made of Silver Halides solid solutions transmit 4-17 μm wavelength radiation. PIR-fibre immersion ATR probes and Transmission/Reflection probes had been manufactured and successfully tested with different FTIR spectrometers in the field of remote spectroscopy for forensic substances identification, chemical reaction control, and monitoring of exhaust or exhalation gases. Using these techniques no sample preparation is necessary for fibre probes to measure evanescent, reflection and transmission spectra, in situ and in real time. QCL spectrometer may be used as a portable device for multispectral gas analysis at 1ppb level of detectivity for various applications in environmental pollution monitoring.

  9. Order No. 217 of 29 April 1977 on X-ray diagnostic equipment for medical use

    International Nuclear Information System (INIS)

    1978-01-01

    This Order was made by the National Health Service and is divided into several parts covering inter alia approval and notification of X-ray installations, conditions of liability, occupational radiation protection, construction of X-ray apparatus and its shielding and inspection of such equipment by the National Health Service. (NEA) [fr

  10. TU-E-217BCD-11: Evaluating the Performance of a Stationary Digital Breast Tomosynthesis System.

    Science.gov (United States)

    Tucker, A; Gidcumb, E; Shan, J; Qian, X; Sprenger, F; Spronk, D; Zhang, Y; Kennedy, D; Farbizio, T; Ruth, C; Jing, Z; Lu, J; Zhou, O

    2012-06-01

    In conventional Digital Breast Tomosynthesis (DBT) systems a single x-ray source moves over a limited angle arc. This leads to motion blurring in the projection images associated with x-ray source motion and total scan times. We have developed a stationary DBT (s-DBT) system which forgoes a rotating source for an array of carbon nanotube (CNT) based x-ray sources. Here we report the results of evaluating the performance and the optimization of image acquisition parameters of the s-DBT system. The s-DBT system consists of a linear source array with 31 x-ray generating focal spots distributed over a 30 degree angular span. The source array has been retrofitted onto a Hologic Selenia Dimensions DBT system. An American College of Radiology accreditation phantom was imaged to assess the quality of the reconstruction images in different configurations. A line wire phantom is used to measure the modulation transfer function (MTF). For the standard imaging protocol, the system resolution along the scanning direction is increased from 3.0 cycles/mm in DBT to 4.2 cycles/mm in s-DBT at a magnification factor of 1.08. The MTF did not have a noticeable change between different configurations, whereas in DBT the MTF can be degraded for larger angular spans due to faster x-ray source motion. The overall image quality factor is found to be best for the configuration with a large angular span and intermittent number of projection views. We demonstrated successful construction and operation of the s-DBT system integrating a CNT x-ray source array with a Hologic DBT system. The spatial resolution of the s-DBT system is demonstrated to be substantially increased over the corresponding DBT system. It was found that a configuration with a large angular span, an intermittent number of projection views, and an even dose distribution resulted in the best overall image quality. Hologic INC has provided the Hologic Selenia Dimensions used in the research. The project is supported by the National Cancer Institute under grant number U54CA119343 and R01CA134598 and the UNC University Cancer Research Fund. Dr. Xin Qian is supported by a fellowship from the Department of Defense under grant number BC087505. © 2012 American Association of Physicists in Medicine.

  11. 49 CFR 232.217 - Train brake tests conducted using yard air.

    Science.gov (United States)

    2010-10-01

    ... reduction of brake pipe air pressure at the same, or slower, rate as an engineer's brake valve. (b) The yard... 49 Transportation 4 2010-10-01 2010-10-01 false Train brake tests conducted using yard air. 232... Train brake tests conducted using yard air. (a) When a train air brake system is tested from a yard air...

  12. Modeling Relationships among 217 Fires Using Remote Sensing of Burn Severity in Southern Pine Forests

    Directory of Open Access Journals (Sweden)

    Amr Abd-Elrahman

    2011-09-01

    Full Text Available Pine flatwoods forests in the southeastern US have experienced severe wildfires over the past few decades, often attributed to fuel load build-up. These forest communities are fire dependent and require regular burning for ecosystem maintenance and health. Although prescribed fire has been used to reduce wildfire risk and maintain ecosystem integrity, managers are still working to reintroduce fire to long unburned areas. Common perception holds that reintroduction of fire in long unburned forests will produce severe fire effects, resulting in a reluctance to prescribe fire without first using expensive mechanical fuels reduction techniques. To inform prioritization and timing of future fire use, we apply remote sensing analysis to examine the set of conditions most likely to result in high burn severity effects, in relation to vegetation, years since the previous fire, and historical fire frequency. We analyze Landsat imagery-based differenced Normalized Burn Ratios (dNBR to model the relationships between previous and future burn severity to better predict areas of potential high severity. Our results show that remote sensing techniques are useful for modeling the relationship between elevated risk of high burn severity and the amount of time between fires, the type of fire (wildfire or prescribed burn, and the historical frequency of fires in pine flatwoods forests.

  13. 5 CFR 591.217 - In which outlets does OPM collect prices?

    Science.gov (United States)

    2010-01-01

    ... data collection areas, accessibility by road, physical size, advertising, and other characteristics that reflect sales volume. To the extent practical, OPM prices like items in the same types of outlets...

  14. 18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Price discrimination... discrimination and anticompetitive effect (price squeeze issue). To implement compliance with the Supreme Court... interested person may file petitions to intervene alleging price discrimination and anticompetitive effects...

  15. 20 CFR 217.8 - When one application satisfies the filing requirement for other benefits.

    Science.gov (United States)

    2010-04-01

    .... Therefore a claimant does not need to file another application to be entitled to any of the following types of benefits: (a) An employee age annuity if— (1) The employee's application for a disability annuity... (2) The employee is entitled to a disability annuity in the month before the month he or she is 65...

  16. Supplement to J. Genet. 84, 217–222 (2005), V. Rodrigues ...

    Indian Academy of Sciences (India)

    rdt

    of transcription during early embryogenesis. Development, Genes and Evolution 207, 156-166 (1997). 123. CAMPOS-ORTEGA, J.A. The genetics of the Drosophila achaete-scute gene complex: an historical ap-praisal. Int. J. Dev. Biol. 42,. 291-297 (1998). 124. CAMPOS-ORTEGA, J.A. Logros en la Biologia del Desarrollo.

  17. Session 21.7 - Education Programs Promoting Light Pollution Awareness and IYL2015

    Science.gov (United States)

    Walker, Constance E.

    2016-10-01

    By proclaiming the IYL2015, the United Nations recognized the importance of light and light based technology in the lives of the citizens of the world and for the development of global society on many levels. Light and application of light science and technology are vital for existing and future advances in many scientific areas and culture. Light is a key element in astronomy: as astronomers, it is what we study and makes our science possible, but it is also what threatens our observations when it is set-off from the ground (light pollution). The UN-designated year 2015 represented a magnificent and unique opportunity for the global astronomical community to disseminate these messages and raise the awareness of the importance and preservation of dark skies for heritage and the natural environment. As such, the International Year of Light served as a launching pad for several projects during 2015. Two other projects with equally as impressive programs are highlighted and begin the narrative for this section on public education and outreach programs on light pollution issues and solutions.

  18. SU-D-217BCD-01: Corrupted DICOM Image Recovering: A Clinical Experience.

    Science.gov (United States)

    Chen, L; Walz-Flannigan, A; Langer, S

    2012-06-01

    Colored DICOM secondary capture images generated from CT perfusion studies were corrupted if they were sent directly from a Siemens acquisition workstation to a GE viewing workstation. However, those images were properly displayed in the GE viewing workstation if they were transferred through a GE PACS first. The purpose of this work is to investigate the cause of image corruption and determine why passing through PACS corrected it. DICOM headers of corrupted and non-corrupted (sent through the PACS) images were compared with a free DICOM software tool (http://DVTK.org); the differences were highlighted. Certain header tags were found in non-corrupted images, but not in corrupted images. These tags were sequentially removed until the non- corrupted image became corrupted. Once a candidate tag was found, fresh corrupt images were modified by adding a 'repair' tag and tested. It was found that the absence of Planar Configuration (0028, 0006) is the cause of image corruption. This attribute is used in the DICOM color image to specify whether the color pixel data are sent color-by-plane or color-by- pixel and should be present if the Sample per Pixel (0028, 0002) tag has a value greater than 1. In our DICOM color images, the values of (0028, 0002) and Photometric Interpretation (0028, 0004) are 3 and RGB, respectively. Thus (0028, 0006) should equal 0 (color-by-pixel), which is used for uncompressed or lossless compressed transfer syntaxes. Adding this tag and setting the value to zero manually repaired corrupt images. Using open source DICOM tools and following the described process can be a valuable ally in the search for causes of image corruption. Comparing the headers and finding the handful of different tags rapidly led to an explanation that could be used by the vendor for a permanent fix. © 2012 American Association of Physicists in Medicine.

  19. 7 CFR 58.217 - Evaporators and/or vacuum pans.

    Science.gov (United States)

    2010-01-01

    ... Sanitary Standards for Milk and Milk Products Evaporators and Vacuum Pans. When enclosed type condensers... from the condensing of product (cow water) in this equipment may be utilized for prerinsing and...

  20. http://journals.tbzmed.ac.ir/JARCM/Manuscript/JARCM-2-217.pdf

    Directory of Open Access Journals (Sweden)

    Ali Ghavidel

    2014-11-01

    Full Text Available Introduction: Secondary aortoenteric fistula (SAF is an uncommon, but very important complication of abdominal aortic reconstruction. The complication often occurs months to years after aortic surgery. The clinical manifestation of the aortoenteric fistula is always upper gastrointestinal bleeding. Treatment of the disease is early surgical intervention. If operative treatment is not performed promptly, the mortality is high. Case Report: A case of secondary aortoduodenal fistula found 6 years after aortic reconstructive surgery, with the clinical presentation of upper gastrointestinal bleeding because of the increasing number of elective aortic aneurysm repairs in the aging population, it is likely that more patients with SAF will present to the clinical physicians in the future. Hence, a high index of suspicion is necessary for prompt diagnosis and treatment of this lifethreatening event. The patient treated medically and finally expiration of the patient and review of the literature currently available in Medline. Conclusion: The aim of this case report is to emphasize early diagnosis and management of all gastrointestinal bleeding in patients who have a history of aortic reconstructive surgery.

  1. Laboratory manual for salt-mixing test in 37- and 217-pin bundles

    International Nuclear Information System (INIS)

    Chan, Y.N.; Todreas, N.E.

    1980-08-01

    This laboratory manual deals with the procedure employed during salt tracer experiments used in evaluating the hydraulic characteristics of a rod bundle. A description of the standard equipment used is given together with the details of manufacture of probes used for detecting the salt concentration. Details of the bundle construction have been excluded as they are availble in the reference cited. An attempt has been made to point out potential trouble areas and procedures

  2. 217 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)

    FIRST LADY

    President Harry Truman and Mao Zedong used domestically popular but unnecessary foreign policies in secondary areas as a diversion for necessary, but unpopular policies in primary areas. These secondary policies set in motion a chain of events culminating in the U.S subsequent Chinese. Utility of Military Strategy as ...

  3. 48 CFR 3052.217-92 - Inspection and manner of doing work (USCG).

    Science.gov (United States)

    2010-10-01

    ... activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms containing... extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair... work is done on a tank; (7) Treat the contents of any tank as Government property in accordance with...

  4. 48 CFR 1252.217-73 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms containing... extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair... work is done on a tank; (7) Treat the contents of any tank as Government property in accordance with...

  5. 48 CFR 252.217-7005 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... over activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms... the extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair; (6) Furnish the Contracting Officer or designated representative with a copy of the “gas-free” or...

  6. 217. Experiencia en asistencia circulatoria mecánica en nuestro centro

    Directory of Open Access Journals (Sweden)

    J. Otero

    2012-04-01

    Conclusiones: Dada la gravedad de estos pacientes, con mortalidad cercana al 100% sin asistencia, consideramos el beneficio que aporta esta técnica y la gran utilidad que representa su disponibilidad.

  7. 217 L'entourage d'un Fait d'expression Comme Guide a la ...

    African Journals Online (AJOL)

    Ike Odimegwu

    n'est pas synonyme d'une bonne connaissance de la langue de l'énoncé. Il faut se .... fonctionnement de sourcils ou le clignement des yeux, les attitudes ..... source. Conclusion. Pour traduire un fait d'expression un traducteur est censé maitriser les traits linguistiques et non-linguistiques d'un fait d'expression. Par les traits ...

  8. TU-D-217A-01: CTDI and Patient Dose: A European Perspective.

    Science.gov (United States)

    Kalender, W

    2012-06-01

    Dose in CT has been a dominant topic in Medical Physics for at least a decade. This was for good reason since increasing use of CT necessarily led to an increase of cumulative dose to the population and inappropriate use of CT in some cases led to an unnecessarily high exposure of patients with subsequent coverage in the U.S. media. Fortunately, this situation also triggered a number of positive technical developments and fruitful initiatives worldwide. Currently, even "sub-mSv CT" is a realistic topic. However, we also engage in extensive discussions of the topic "CTDI and patient dose". They do not always seem to be pragmatic and sometimes are unnecessarily complicated. One reason may be that the topics computed tomography dose index (CTDI) and patient dose are seen necessarily combined. This lecture aims at discussing and hopefully helping to resolve some of the issues. Key points and suggestions are the following: • CTDI is a proven and reasonably good concept for scanner dosimetry and quality control (QC) on standard 64-row scanners. There is no major debate on CTDI efficiency and similar issues in Europe. • The new IEC scanner dosimetry concept to be used for wider detectors is acceptable; there is no need for new and heavy phantoms. • There still is a need of phantoms and concepts for QC of automated exposure control systems in CT. • CTDI should not and need not be changed and expanded to assess patient dose. • Patient dose estimates (both organ and effective dose) are based on air kerma measurements (without a CTDI phantom) and MC calculations using mathematical phantoms and/or voxel models. The DLP-to-E conversion which is accepted in Europe for more than a decade was based on this approach. • Patient dose estimates, both organ and effective dose, should be scanner- and patient-specific. Fast MC programs and dose software allow for this. Manufacturer cooperation is a necessity, and there are first positive examples. • The concept of diagnostic reference levels (DRL) which was started in Europe in the 1990s and is in wide use today has to be revisited. It need not be based on CTDI further on but, for example, on a revised scanner- and patient-specific DLP-to-E conversion. • An international consensus on the topics CTDI and patient dose appears desirable. All these points do not mean a revolution but rather aim at staying with established equipment. The two major objectives are to • avoid unnecessary QC burden of medical physicists who are threatened with extended CTDI measurements • provide more reliable and understandable information regarding patient dose in real time. Organ dose and effective dose are preferable to DLP. 1. Understand that CTDI is a technical concept for scanner acceptance and constancy testing 2. Learn about concepts for patient- and scanner-specific patient dose estimates 3. Learn about the concept of diagnostic reference levels and its strengths and weaknesses Research sponsored by Siemens Healthcare and by CT Imaging GmbH, both in Erlangen, Germany. © 2012 American Association of Physicists in Medicine.

  9. Effect of physical activity and 217-Hz extremely low frequency electromagnetic field on rat locomotor activity

    Directory of Open Access Journals (Sweden)

    Rasol Zeidabadi

    2017-02-01

    Full Text Available Background: Nowadays the widespread use of cell phones has increased concerns about the biological effects of electromagnetic fields on human body. The purpose of the present study was to examine the role of physical activity in moderating the effects of extremely low frequency electromagnetic fields (ELF-EMF emitted from cell phones on rat locomotor activity. Material and Methods: Male Albino-Wistar rats (no=70 were divided into seven groups: Short and Long- term physical activity; Control, ELF-EMF; Sham; Long-term physical activity+ELF-EMF; Short-term physical activity+ELF-EMF. Short and Long- term physical activity groups were forced to daily treadmill running (30 minutes for one week and one month, respectively. ELF-EMF group was exposed to ELF-EMF cell phone simulator for three hours during the period. Having placed in the ELF-EMF simulator device, the physical activity+ELF-EMF groups were transferred to treadmill. Locomotor activity were analyzed as distance, time and speed of movement in open field apparatus. Results: The results showed that the ELF-EMF from cell phones can significantly decrease the locomotor activity in the exposed rats. On the other hand, short and long-term physical activity significantly increased motor activity in the trained rats (P≤0.05. However, there was no significant difference between the combination groups (Physical activity+ELF-EMF and ELF group in locomotor activity. Conclusion: The results revealed that the physical activity could not prevent the decrease of locomotor activity caused by ELF-EMF from cell phone.

  10. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  11. 75 FR 10552 - Sixth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping...

    Science.gov (United States)

    2010-03-08

    ...) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials... Applications Numerical Requirements Guidance Materials Data Quality Wednesday, April 14 Continuation of... Planning SC-214 Requirements Review and Response Planning Thursday, April 15 Document Agreements DO-272...

  12. [Galen of Pergamum (129-216/217 AD) and his contribution to urology: part I: life, work and medical system].

    Science.gov (United States)

    Marx, F J

    2013-04-01

    Galen of Pergamum was, along with Hippocrates, the most influential physician and undoubtedly the most important medical scholar of classical antiquity. His anatomy and his concept of humoral pathology dominated western medicine until the sixteenth century and influenced all fields of medicine until after the seventeenth century. After referring to some biographical data the philosophical and epistemic fundamentals of Galen's"medical system" are outlined and brought into relation with the prevailing medical sects of the second century AD. The very treatises of his enormous work which are the most relevant with reference to the issue are briefly characterized.In the second part of the paper to be published in one of the next issues of this journal, Galen's significant contributions to the speciality we today define as urology are presented and analyzed. In addition pertinent case reports based on the Greek original texts will illustrate and substantiate his theoretical and clinical approach to the urology patient. Finally the significance of Galen's thinking for the present day physician will be evaluated.

  13. Performance Standards and Employee Effort: Evidence from Teacher Absences. Upjohn Institute Working Paper No. 15-217

    Science.gov (United States)

    Gershenson, Seth

    2015-01-01

    The 2001 No Child Left Behind Act (NCLB) increased accountability pressure in U.S. public schools by threatening to impose sanctions on Title 1 schools that failed to make adequate yearly progress (AYP) in consecutive years. Difference-in-difference estimates of the effect of failing AYP in the first year of NCLB on teacher effort in the…

  14. Incorporation of Operating Precepts of Roman Rhetoric in Medieval and Renaissance Handbooks on Letter Writing. Working Paper No. 217.

    Science.gov (United States)

    Hildebrandt, Herbert W.

    The ancient world, as exemplified in the theoretical writings of the Greek and Roman rhetoricians, directly influenced the teaching and practice of dictamen as taught for business, for the church, and for law in the Middle Ages and into the Renaissance. Prescriptions on how to communicate in the ancient world formed the core of preparation for the…

  15. In vivo emergence of Aspergillus terreus with reduced azole susceptibility and a Cyp51a M217I alteration

    DEFF Research Database (Denmark)

    Arendrup, Maiken C; Jensen, Rasmus; Grif, Katharina

    2012-01-01

    Azole resistance in Aspergillus terreus isolates was explored. Twenty related (MB) and 6 unrelated A. terreus isolates were included. CYP51A sequencing and RAPD genotyping was performed. Five MB isolates were itraconazole susceptible, whereas the minimum inhibitory concentrations (MICs) for 15 MB...

  16. 41 CFR 101-6.217 - Laws authorizing Federal financial assistance for programs to which this subpart applies.

    Science.gov (United States)

    2010-07-01

    ..., licenses, or permits is less than estimated fair market value. (h) Conveyance of real property or interests... less than estimated fair market value. (i) Allotment of space by the General Services Administration in... property transferred from the Reconstruction Finance Corporation (Title VII of the Federal Property and...

  17. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and...

    Science.gov (United States)

    2012-03-12

    ... mobile, 33-5-57-92-55-55 1150. FOR FURTHER INFORMATION CONTACT: The RTCA Secretariat, 1150 18th Street NW... results completed Working Group Road Map Review The existing Road Map will be addressed within the... Meeting Adjourn Attendance is open to the interested public but limited to space availability. With the...

  18. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar).

    Science.gov (United States)

    2010-10-01

    .... Piscataquis Shawtown Twp, TA R11 WELS, TA R10 WELS, TB R10 WELS, Greenville, T7 R9 NWP, Bowdoin College Grant..., Williamsburg Twp, Bowdoin College Grant East Twp, Barnard Twp, Monson, Orneville Twp. Somerset Squaretown Twp..., Cushing, Friendship, Hope, Rockland, Rockport, Saint George, South Thomaston, Thomaston, Union, Warren...

  19. 76 FR 6179 - Eighth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping...

    Science.gov (United States)

    2011-02-03

    ... Activities Working Group Read-Outs Applications Content Connectivity Guidance Quality, Non-Numeric Quality... Attendance is open to the interested public but limited to space availability. With the approval of the...

  20. 217. Predictores de insuficiencia renal aguda en pacientes con enfermedad aórtica sometidos a parada circulatoria

    Directory of Open Access Journals (Sweden)

    E. Sarria García

    2010-01-01

    Conclusiones: La incidencia de IRA en pacientes sometidos a PCH es elevada, presumiblemente, siendo un factor de riesgo de mortalidad. El tiempo de CEC, hematocrito bajo y diuresis durante CEC parecen ser factores pronósticos para su desarrollo, por lo que deben optimizarse las medidas preventivas.

  1. Melhaoui Mohammed, Peste, contagion et martyre. Histoire du fléau en Occident médiéval, Paris, Publisud, 2005, 217 p.

    Directory of Open Access Journals (Sweden)

    Stéphane Barry

    2007-07-01

    Full Text Available En France, à l’exception des études du médecin, historien et démographe Jean-Noël Biraben (1975-1976, peu de travaux existent sur la Peste noire et ses conséquences dans l’Occident musulman médiéval. On comprendra alors tout l’intérêt de l’ouvrage de Mohammed Melhaoui sur ce thème qu’il connaît bien puisqu’il lui a consacré non seulement une thèse de doctorat d’histoire, mais aussi quelques études portant notamment sur la « perception de la peste en pays chrétiens byzantins et musulman » (Co...

  2. SU-E-J-217: Accuracy Comparison Between Surface and Volumetric Registrations for Patient Setup of Head and Neck Radiation Therapy

    International Nuclear Information System (INIS)

    Kim, Y; Li, R; Na, Y; Jenkins, C; Xing, L; Lee, R

    2014-01-01

    Purpose: Optical surface imaging has been applied to radiation therapy patient setup. This study aims to investigate the accuracy of the surface registration of the optical surface imaging compared with that of the conventional method of volumetric registration for patient setup in head and neck radiation therapy. Methods: Clinical datasets of planning CT and treatment Cone Beam CT (CBCT) were used to compare the surface and volumetric registrations in radiation therapy patient setup. The Iterative Closest Points based on point-plane closest method was implemented for surface registration. We employed 3D Slicer for rigid volumetric registration of planning CT and treatment CBCT. 6 parameters of registration results (3 rotations and 3 translations) were obtained by the two registration methods, and the results were compared. Digital simulation tests in ideal cases were also performed to validate each registration method. Results: Digital simulation tests showed that both of the registration methods were accurate and robust enough to compare the registration results. In experiments with the actual clinical data, the results showed considerable deviation between the surface and volumetric registrations. The average root mean squared translational error was 2.7 mm and the maximum translational error was 5.2 mm. Conclusion: The deviation between the surface and volumetric registrations was considerable. Special caution should be taken in using an optical surface imaging. To ensure the accuracy of optical surface imaging in radiation therapy patient setup, additional measures are required. This research was supported in part by the KIST institutional program (2E24551), the Industrial Strategic technology development program (10035495) funded by the Ministry of Trade, Industry and Energy (MOTIE, KOREA), and the Radiation Safety Research Programs (1305033) through the Nuclear Safety and Security Commission, and the NIH (R01EB016777)

  3. Post irradiation fatigue tests of type 316 LN stainless steel. Final report for the ITER Task T511, Subtask 1. European Technology Programme Task GB5-T217

    Energy Technology Data Exchange (ETDEWEB)

    Norring, K.; Koenig, M

    2002-01-01

    The main objective of this Subtask was to estimate the corrosion fatigue behaviour of 316L Stainless Steel (SS) and SS/SS joints, and to check among others the influence of irradiation. Joints were produced by solid Hot Isostatic Pressure (HIP) and powder HIP. Conventional material was used for comparison. The specimens were supplied by EFDA and were irradiated to 4 dpa in Dimitrovgrad (Russia). All specimens were tested at 150 deg C in hydrogenated high purity water. Testing was performed with a stepwise decrease in {delta}K keeping K{sub max} constant. The crack growth rates of irradiated as well as unirradiated specimens tested earlier are of the same magnitude, around 2x10{sup -5} mm/cycle at {delta}K= 18 MPa{radical}m. Thus, irradiation does not seem to enhance the fatigue crack growth rate, at least not up to irradiation levels of 4 dpa. But it is worth noting that the exponents in the da/dN versus {delta}K equation, also known as Paris' law, seems to fall within two areas, either around 3.5 or just below 2. Both Powder HIPed and Solid HIPed specimens are found in both groups. The reason for this is not evident. The fracture surfaces of the specimens show typical fatigue appearance.

  4. The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9

    DEFF Research Database (Denmark)

    Makovicky, Emil; Petricek, Vaclav; Dusek, Michal

    2011-01-01

    The layer-like crystal structure of franckeite from the mine of San José, Bolivia, exhibits a pronounced one-dimensional transversal wave-like modulation and a non-commensurate layer match in two dimensions. It consists of alternating pseudohexagonal (H) layers and pseudotetragonal (Q) slabs...... and H stacking directions, and the divergence between modulation wave-front and these stacking directions are typical for the composite structures of franckeite and cylindrite. Because of the increased rigidity of the Q component, franckeite usually forms masses of curved crystals rather than...... and forms a homologous pair with cylindrite, which has thinner Q slabs. The Q slabs in franckeite are four atomic layers thick. The two components have their own lattices and a common modulation. The Q slab of the refined franckeite structure, Pb21.74Sn9.34Fe3.95Sb8.08S56.87, is an MS layer (M = Pb2+, Sn2...

  5. Attentional Modulation of Envelope-Following Responses at Lower (93-109 Hz) but Not Higher (217-233 Hz) Modulation Rates.

    Science.gov (United States)

    Holmes, Emma; Purcell, David W; Carlyon, Robert P; Gockel, Hedwig E; Johnsrude, Ingrid S

    2018-02-01

    Directing attention to sounds of different frequencies allows listeners to perceive a sound of interest, like a talker, in a mixture. Whether cortically generated frequency-specific attention affects responses as low as the auditory brainstem is currently unclear. Participants attended to either a high- or low-frequency tone stream, which was presented simultaneously and tagged with different amplitude modulation (AM) rates. In a replication design, we showed that envelope-following responses (EFRs) were modulated by attention only when the stimulus AM rate was slow enough for the auditory cortex to track-and not for stimuli with faster AM rates, which are thought to reflect 'purer' brainstem sources. Thus, we found no evidence of frequency-specific attentional modulation that can be confidently attributed to brainstem generators. The results demonstrate that different neural populations contribute to EFRs at higher and lower rates, compatible with cortical contributions at lower rates. The results further demonstrate that stimulus AM rate can alter conclusions of EFR studies.

  6. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    OpenAIRE

    Mahsa Mansourian; S. Mohammad Firoozabadi; Zuhair Mohammad Hassan; Zeynab Shankayi

    2012-01-01

    Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the ...

  7. Topographic Map of Quadrangles 3770 and 3870, Maymayk (211), Jamarj-I-Bala (212), Faydz-Abad (217), and Parkhaw (218) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  8. Monitoramento das cargas de treinamento no tênis de elite DOI:10.5007/1980-0037.2010v12n3p217

    Directory of Open Access Journals (Sweden)

    Aaron James Coutts

    2010-01-01

    Full Text Available A carga de treinamento (CT é influenciada pelo volume e pela intensidade. A determinação precisa das CTs utilizadas durante o treinamento é crucial para atingir as adaptações desejadas e evitar o overtraining. A CT pode ser monitorada de diversas maneiras. Entretanto, nós recomendamos o método da percepção subjetiva de esforço da sessão (PSE da sessão para quantificar a CT pelo seu baixo custo, pela sua fácil compreensão e a pela sua relativa simplicidade de implementação. Neste relato, nós apresentamos dados relacionados às CTs coletados durante o Torneio de Roland Garros em 2008. Nossa experiência no tênis sugere que o método da PSE da sessão é uma ferramenta valiosa que pode ser usada para controlar o treinamento e evitar CTs excessivas. Nós também acreditamos que o monitoramento preciso da CT proporcionará ao técnico o melhor entendimento do processo de treinamento desportivo, em última instância, levando ao aumento de desempenho.

  9. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)

    2015-06-15

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care.

  10. TU-E-217BCD-10: Dose Reduction in Digital Breast Tomosynthesis with the Dose Reduction Prior Image Constrained Compressed Sensing (DR-PICCS) Algorithm.

    Science.gov (United States)

    Garrett, J; Tang, J; Zhang, Y; Ruth, C; Jing, Z; Chen, G H

    2012-06-01

    To reduce image noise and radiation dose in Digital Breast Tomosynthesis (DBT) reconstructions. A retrospective study was performed on clinical data sets acquired at a normal dose with Hologic Selenia Dimensions DBT systems. The Prior Image Constrained Compressed Sensing (PICCS) algorithm was used to reduce image noise. In addition, a prospective study was performed on an American College of Radiology breast phantom at various dose levels and the PICCS algorithm was used to reconstruct images at the corresponding radiation dose levels. The reconstructed images were inspected visually, and the noise levels in various regions of interest were quantitatively measured and compared between images. In the case of the clinical data, the PICCS reconstructions showed dramatic noise reduction (over 35%) with no loss of diagnostically important features such as calcifications or low contrast lesions; visibility of low contrast lesions was improved with PICCS. Dose reduction of 28% was possible with the phantom data, and the low dose PICCS reconstructions of phantom data show improved low contrast lesion detectability and lower noise. The work indicates potential dose savings in digital breast tomosynthesis. The diagnostic quality of the phantom reconstructions at 28% reduced dose was equivalent to or better than those acquired at full dose. The noise suppression in the clinical data sets improved visibility of low contrast lesions without sacrificing important diagnostic features. Support for this project was provided by a grant from Hologic Inc. © 2012 American Association of Physicists in Medicine.

  11. Frequency metrology in the near-infrared spectrum of H217O and H218O molecules: testing a new inversion method for retrieval of energy levels

    International Nuclear Information System (INIS)

    Gambetta, A; Marangoni, M; Fasci, E; Castrillo, A; Casa, G; Gianfrani, L; Galzerano, G; Laporta, P

    2010-01-01

    An extensive Doppler-free spectroscopic investigation of the near-infrared absorption spectrum of the H 2 18 O molecule was performed, for the first time, with absolute frequency calibration by using a GPS-disciplined fiber-based optical frequency comb. The investigated line pairs belong to the ν 1 +ν 3 band and have been chosen in the wavelength range from 1.38 to 1.41μm with a lambda scheme, so as to share the excited energy level and allow an accurate determination of the rotational energy separations of the fundamental vibrational state. The measurement of the sub-Doppler line-center frequencies, also extended to the H 2 17 O spectrum, has been performed with an overall uncertainty of ∼30 kHz, i.e. about three orders of magnitude lower than the HITRAN data set. The retrieved energy separations agree, by less than 80 kHz, with recent findings provided by the so-called MARVEL procedure for spectral data inversion, thus yielding a very stringent test of its accuracy.

  12. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part I-Energy levels and transition wavenumbers for H217O and H218O

    International Nuclear Information System (INIS)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Carleer, Michel R.; Csaszar, Attila G.; Gamache, Robert R.; Hodges, Joseph T.; Jenouvrier, Alain; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Toth, Robert A.; Vandaele, Ann Carine; Zobov, Nikolai F.; Daumont, Ludovic; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Mikhailenko, Semen N.

    2009-01-01

    This is the first part of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependence and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. The present article contains energy levels and data for line positions of the singly substituted isotopologues H 2 17 O and H 2 18 O. The procedure and code MARVEL, standing for measured active rotational-vibrational energy levels, is used extensively in all stages of determining the validated levels and lines and their self-consistent uncertainties. The spectral regions covered for both isotopologues H 2 17 O and H 2 18 O are 0-17125cm -1 . The energy levels are checked against ones determined from accurate variational calculations. The number of critically evaluated and recommended levels and lines are, respectively, 2687 and 8614 for H 2 17 O, and 4839 and 29 364 for H 2 18 O. The extensive lists of MARVEL lines and levels obtained are deposited in the Supplementary Material, as well as in a distributed information system applied to water, W-DIS, where they can easily be retrieved. A distinguishing feature of the present evaluation of water spectroscopic data is the systematic use of all available experimental data and validation by first-principles theoretical calculations.

  13. SU-F-T-217: A Comprehensive Monte-Carlo Study of Out-Of-Field Secondary Neutron Spectra in a Scanned-Beam Proton Therapy Treatment Room

    Energy Technology Data Exchange (ETDEWEB)

    Englbrecht, F; Parodi, K [LMU Munich, Department of Medical Physics, Garching / Munich, Bavaria (Germany); Trinkl, S; Mares, V; Ruehm, W; Wielunski, M [Helmholtz Zentrum Munich, Institute of Radiation Protection, Neuherberg, Bavaria (Germany); Wilkens, J [Technical University of Munich, Department of Physics, Munich, Germany, Garching, Bavaria (Germany); Klinikum rechts der Isar, Department of Radiation Oncology, Munich (Germany); Hillbrand, M [Rinecker Proton Therapy Center, Munich, Bavaria (Germany)

    2016-06-15

    Purpose: To simulate secondary neutron radiation-fields produced at different positions during phantom irradiation inside a scanning proton therapy gantry treatment room. Further, to identify origin, energy distribution and angular emission as function of proton beam energy. Methods: GEANT4 and FLUKA Monte-Carlo codes were used to model the relevant parts of the treatment room in a gantry-equipped pencil beam scanning proton therapy facility including walls, floor, metallic gantry-components, patient table and the homogeneous PMMA target. The proton beams were modeled based on experimental beam ranges in water and spot shapes in air. Neutron energy spectra were simulated at 0°, 45°, 90° and 135° relative to the beam axis at 2m distance from isocenter, as well as 11×11 cm2 fields for 75MeV, 140MeV, 200MeV and for 118MeV with 5cm PMMA range-shifter. The total neutron energy distribution was recorded for these four positions and proton energies. Additionally, the room-components generating secondary neutrons in the room and their contributions to the total spectrum were identified and quantified. Results: FLUKA and GEANT4 simulated neutron spectra showed good general agreement in the whole energy range of 10{sup −}9 to 10{sup 2} MeV. Comparison of measured spectra with the simulated contributions of the various room components helped to limit the complexity of the room model, by identifying the dominant contributions to the secondary neutron spectrum. The iron of the bending magnet and counterweight were identified as sources of secondary evaporation-neutrons, which were lacking in simplified room models. Conclusion: Thorough Monte-Carlo simulations have been performed to complement Bonner-sphere spectrometry measurements of secondary neutrons in a clinical proton therapy treatment room. Such calculations helped disentangling the origin of secondary neutrons and their dominant contributions to measured spectra, besides providing a useful validation of widely used Monte-Carlo packages in comparison to experimental data. Cluster of Excellence of the German Research Foundation (DFG) “Munich-Centre for Advanced Photonics (MAP)”.

  14. TU-E-217BCD-07: Pilot Study on Consistency in Size Metrics for a Multimodality PEM/MR Breast Imaging Approach.

    Science.gov (United States)

    Sadinski, M; Giger, M; Drukker, K; Yamaguchi, K; Lan, L; Li, H

    2012-06-01

    In this study, we evaluated the degree of consistency between size metrics obtained from PEM and MRI to determine the intrinsic effectiveness of a multimodality approach using these two systems for breast imaging. Under an IRB-approved protocol, 42 cases were considered (16 patients with 28 lesions), each consisting of an MRI data set and corresponding PEM data set, with an inclusion criterion of being obtained within 2 weeks of each other. Lesions were delineated manually on the PEM images and semi-automatically on the MRI images for efficiency. In addition to volume, equivalent sphere diameter (ESD) was evaluated for each lesion. This metric describes the diameter of a sphere with the same volume as that of the lesion, and is useful for minimizing the cubic impact of a single voxel contribution inherent to volume calculations. The relationship between PEM based volumes and MRI based volumes showed a linear trend around VolMRI=VolPEM demonstrating a degree of consistency in the two volumes. The correlation between VolMRI and VolPEM was calculated as 0.547 with a corresponding p-value of 0.00018 demonstrating a significant correlation. The associated concordance was calculated as 0.534. The ESD metric showed a more significant linear trend with correlation 0.733 and corresponding p-value 3.5×10-8, indicating consistency in lesion size. The concordance is 0.717, indicating high reproducibility. Multimodality PEM/MRI breast imaging has the potential to combine functional and molecular imaging information for a powerful tool in cancer staging and evaluation of response to therapy. The resulting, expanded data set is of use only if fundamental size metrics are consistent between the two modalities. Our pilot data demonstrates that size metrics as we extracted from the image data are consistent between PEM and MRI breast image sets.Maryellen Giger is a stockholder in R2 Technology/Hologic, has equity in Quantitative Insights, and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi and Toshiba. It is the University of Chicago Conflict of Interest Policy that investigators disclose publicly actual or potential significant financial interest that would reasonably appear to be directly and significantly affected by the research activities. © 2012 American Association of Physicists in Medicine.

  15. Status of liquid metal reactor development in the United States of America

    International Nuclear Information System (INIS)

    Griffith, J.D.; Horton, K.E.

    1991-01-01

    An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

  16. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira

    2007-11-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  17. Determination of radionuclides in discharged water from gold ...

    African Journals Online (AJOL)

    Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

  18. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    Ahlquist, A.J.

    1981-01-01

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  19. Tumor Immunotargeting Using Innovative Radionuclides

    OpenAIRE

    Françoise Kraeber-Bodéré; Caroline Rousseau; Caroline Bodet-Milin; Cédric Mathieu; François Guérard; Eric Frampas; Thomas Carlier; Nicolas Chouin; Ferid Haddad; Jean-François Chatal; Alain Faivre-Chauvet; Michel Chérel; Jacques Barbet

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others a...

  20. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  1. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Moulin, J.

    2008-06-01

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  2. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  3. Toxicidad, acumulación y efectos fisiológicos del colorante premetalizado C.I. Acid Violet 66 y su base azoica C.I. Acid Red 217 en la trucha Arcoiris Salmo Gairdneri R.

    OpenAIRE

    Riva Juan, María del Carmen

    1989-01-01

    El objetivo fundamental de esta Tesis ha sido una ampliación de conocimientos sobre toxicidad y efectos de los colorantes premetalizados en la trucha arcoiris Salmogairdneri. Se ha dedicado especial atención a la toxicocinética del colorante premetalizado (acumulación y eliminación, tanto de colorante como de cromo y base azoica, en diferentes órganos y partes del cuerpo de los animales), así como a los efectos a nivel sanguíneo y en algunas características histológicas. The main objective...

  4. The crystal structure of franckeite, Pb.sub.21.7./sub.Sn.sub.9.3./sub.Fe.sub.4.0./sub.Sb.sub.8.1./sub.S.sub.56.9./sub..

    Czech Academy of Sciences Publication Activity Database

    Makovicky, E.; Petříček, Václav; Dušek, Michal; Topa, D.

    2011-01-01

    Roč. 96, 11-12 (2011), s. 1686-1702 ISSN 0003-004X Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : franckeite * Pb-Sn-Sb-Fe sulfide * modulated layer-misfit crystal structure * 2D–non-commensurate layer structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.169, year: 2011

  5. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Science.gov (United States)

    2012-01-01

    epidemiological studies suggest that most or many SCIs are at a cervical spinal level [122], although chronic pain is a common report following thoracic...intervention on the quality of life in diabetic peripheral neuropathic pain and fibromyalgia ,” pain Medicine, vol. 8, supplement 2, pp. S33–S42, 2007. [77] R. A...33, no. 3, pp. 240–249, 2009. [122] G. Z. Ning, T. Q. Yu, S. Q. Feng et al., “ Epidemiology of traumatic spinal cord injury in Tianjin, China

  6. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    International Nuclear Information System (INIS)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.

    2014-01-01

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D 2 16 O, D 2 17 O, and D 2 18 O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm −1 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. For D 2 16 O, D 2 17 O, and D 2 18 O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm −1 , from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D 2 O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  7. WE-C-217BCD-07: Best in Physics (Joint Eyiaging-Therapy) - Direct Imaging of the Uptake of Platinum Anticancer Agents Using X-Ray Stimulated Fluorescence: A Proof-Of-Concept Study.

    Science.gov (United States)

    Kuang, Y; Pratx, G; Qian, J; Meng, B; Bazalova, M; Xing, L

    2012-06-01

    Platinum-based (Pt) chemotherapy has greatly improved the initial response rate of different cancers. However, relapse of a drug-resistant tumor occurs with a high frequency, resulting in poor long term survival. The most common phenotype of Pt chemoresistance is decreased Pt drug accumulation in the tumor region due to either decreased influx or increased efflux, which is invisible for current imaging modalities. The inability of imaging methods to directly image the Pt drug uptake has resulted in a very unfavorable scenario for early assessment of chemotherapeutic efficacy as well as for personalized treatment planning. In this study, we investigated the feasibility of imaging the uptake and retention of Pt drugs using x-ray stimulated fluorescence CT (XSF-CT). Pt is a high atomic number element, and it emits XSF photons when excited by ionizing photons. Therefore, the alteration of spatial distribution and concentration of Pt drugs in the cancer region could be monitored with XSF-CT. In this study, a polychromatic X-ray source was used to stimulate emission of XSF photons from the Pt drugs. XSF-CT used a first-generation CT geometry. The data were collected using a cadmium telluride detector to sort out a set of spectra. The spectra were then used to generate sinogram. The bio distribution and concentration of each element were reconstructed with the ML-EM algorithm. The reconstructed images clearly identified the distributions of cisplatin. A good linearity between XSF intensities and the concentrations of cisplatin was also observed, suggesting that XSF-CT is capable of quantitative imaging. The X-ray dose for stimulating the XSF photon was 0.25 cGy per projection. XSF-CT has the potential to be a promising modality for monitoring the intervention processes within X-ray scanners. It would afford a powerful way to reliably modify an ineffective treatment regimen in nearly real time. This work was supported by NIH/NCI grants (CA133474, CA153587), an NSF grant (0854492) and a grant from the Friends for an Earlier Breast Cancer Test Foundation. © 2012 American Association of Physicists in Medicine.

  8. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069501)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  9. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    International Nuclear Information System (INIS)

    P. Bernot

    2005-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  10. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  11. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  12. Analytical methodology for radium in food and water

    International Nuclear Information System (INIS)

    Baratta, E.J.

    1990-01-01

    The hazards associated with radium-226 and radium-228 have been well studied and documented. Analysis at the levels set by the Environmental Protection Agency for these two isotopes in drinking water should present no analytical problems. The methods for radium-226 by total radium and emanation have been collaboratively studied and published in the ALPHA Standard Methods. The method of Krieger for radium-228, although it has not been collaboratively tested, has the tentative approval of the American Public Health Association (ALPHA) Standard Methods and was recommended by the National Institute for Science and Technology. In this method the radium is precipitated using barium and lead carriers, then purified and the actinium-228 allowed to ingrow. It is separated using a yttrium carrier and the actinium-228 is beta counted. Other methods could also be used. It should be noted that the EPA's Quality Assurance Program should be used to document that the methods being used are performing adequately. 42 refs., 3 tabs

  13. Formerly utilized MED/AEC sites remedial action program: radiological survey of the former Linde Uranium Refinery, Tonawanda, New York. Final report

    International Nuclear Information System (INIS)

    Leggett, R.W.; Cottrell, W.D.; Burden, J.; Ryan, M.T.

    1978-05-01

    The results of a radiological survey of the Linde Air Products Division of Union Carbide Corporation, Tonawanda, New York, are presented. During the period 1940 to 1948, this site was used for the separation of UO 2 from uranium ores and for the conversion of UO 2 to UF 4 . Five buildings were involved in these operations. The survey included measurements of the following: residual alpha and beta-gamma contamination levels in these buildings; external gamma radiation levels at one meter above the surface in these buildings and outdoors throughout the Linde property; radon and radon daughter concentrations in the air in these buildings; uranium, radium, actinium, and thorium concentrations in soil samples taken both onsite and offsite; contamination in surface water on and near the site; and airborne concentrations of uranium, radium, and thorium in the building in which the separation process was carried out. Elevated concentrations of uranium, radium, and/or actinium were found in two of the buildings and outdoors in widely separated areas of the site. Alpha and beta-gamma contamination levels in some areas of the buildings were above limits set by current federal guidelines concerning the release of property for unrestricted use. Elevated external gamma radiation levels were measured at some outdoor locations and in three of the buildings. The concentration of radium in a water sample taken from an old conveyor pit in one of the buildings was in excess of the non-occupational maximum permissible concentration

  14. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  15. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    Riedhauser, S.R.

    1994-06-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  16. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  17. Late excretion of 231Pa and its decay products

    International Nuclear Information System (INIS)

    Holtzman, R.B.; Ilcewicz, F.H.

    1978-01-01

    Excretion rates of members of the naturally-occurring actinium series (4n + 3) were determined for a 69-year-old man who had acquired 231 Pa(T/sub 1/2/ = 32500 yr) about 45 years prior to this investigation. The body contents determined by whole body counting were approximately 71 nCi of 231 Pa, 51 nCi each of 22 yr 227 Ac and 18.2 day 227 Th, and 39 nCi of 11.4 day 223 Ra. All urinary and fecal samples were collected, as were representative daily diets during the 10 days the subject was maintained on a metabolic ward. The samples were wet ashed with nitric acid. After separation the 231 Pa and 227 Th were electrodeposited on stainless steel and alpha counted. The 223 Ra was coprecipitated with BaSO 4 , mounted, and alpha counted. Actinium-227 was determined from the 227 Th daughter after a long growth period. The excretion rates varied quite dramatically over the 10-day study

  18. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  19. The Consummate Leader - A Holistic Guide to Inspiring Growth in Others... and in Yourself Thompson Patricia The Consummate Leader - A Holistic Guide to Inspiring Growth in Others... and in Yourself 217pp £10.13 Silver Lining Psychology 9780996047906 0996047905 [Formula: see text].

    Science.gov (United States)

    2014-10-01

    WE HAVE here one of the few general books on the subject of leadership that is exceptionally easy to read, with an engaging style, a great deal of humour and good real-life examples. The psychology of leadership is complex, but experienced corporate psychologist and management consultant Patricia Thompson steers a bold and confident course through the subject.

  20. “… Those could just as well be the rocky mountains…” Consumption, spectacularity and much more in obstetrical ultrasound in Rio de Janeiro at the turn of the century - DOI: 10.3395/reciis.v3i4.217en

    Directory of Open Access Journals (Sweden)

    Lilian Krakowski Chazan

    2009-12-01

    Full Text Available This work calls upon the so called ANT (actor-network theory to approach the obstetric ultrasound technology as an ‘indispensable’ technology in prenatal monitoring in Rio de Janeiro at the turn of the 21st century. It does not envisage to build an exhaustive list but rather to perform a set of heterogeneous elements which by acting in juxtaposition configure the specificity of the studied technology, allowing for its delimitation and naming. The hybrid elements that are presented here - equipment, didacticism, assurance, oracle, affections, prestige, market, media, pathology, purification – are configured and understood as agents or actants which simultaneously are: 1 natural but without previously established forms that are already out there to be ‘simply’ discovered (not “things-in-themselves”; 2 collective but not social if this adjective refers to belonging to an exclusive world of relations of “humans-among-themselves”; and yet 3 narrated but not constituted solely by discourse.The purpose of this work is to perform a distance from the tradition of the great a priori dividers which predominate in the studies of the so-called modern knowledge in the last few centuries: natural x social, public x private, heart x mind, science x belief, human x non-human, male x female, macro x micro, local x global. Our special interest is that, to the extent that this distance is obtained, other landscapes can be reached by Brazilian and Latin American STS (science-technology-society studies – there, to say it somewhat crudely, that which exists is that which acts, and only hybrids have the capacity to act. The next step of this work, here indicated but not completed, is to study where the actions that configure the above elements take place and by which means (material vehicles they communicate, articulate and act one upon other among themselves.

  1. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-09-01

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

  2. Towards high-resolution laser ionization spectroscopy of the heaviest elements in supersonic gas jet expansion.

    Science.gov (United States)

    Ferrer, R; Barzakh, A; Bastin, B; Beerwerth, R; Block, M; Creemers, P; Grawe, H; de Groote, R; Delahaye, P; Fléchard, X; Franchoo, S; Fritzsche, S; Gaffney, L P; Ghys, L; Gins, W; Granados, C; Heinke, R; Hijazi, L; Huyse, M; Kron, T; Kudryavtsev, Yu; Laatiaoui, M; Lecesne, N; Loiselet, M; Lutton, F; Moore, I D; Martínez, Y; Mogilevskiy, E; Naubereit, P; Piot, J; Raeder, S; Rothe, S; Savajols, H; Sels, S; Sonnenschein, V; Thomas, J-C; Traykov, E; Van Beveren, C; Van den Bergh, P; Van Duppen, P; Wendt, K; Zadvornaya, A

    2017-02-22

    Resonant laser ionization and spectroscopy are widely used techniques at radioactive ion beam facilities to produce pure beams of exotic nuclei and measure the shape, size, spin and electromagnetic multipole moments of these nuclei. However, in such measurements it is difficult to combine a high efficiency with a high spectral resolution. Here we demonstrate the on-line application of atomic laser ionization spectroscopy in a supersonic gas jet, a technique suited for high-precision studies of the ground- and isomeric-state properties of nuclei located at the extremes of stability. The technique is characterized in a measurement on actinium isotopes around the N=126 neutron shell closure. A significant improvement in the spectral resolution by more than one order of magnitude is achieved in these experiments without loss in efficiency.

  3. Development of ion beam sputtering techniques for actinide target preparation

    International Nuclear Information System (INIS)

    Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

    1985-01-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

  4. The chemistry of the actinide elements. Volume I

    International Nuclear Information System (INIS)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

  5. Process for radioisotope recovery and system for implementing same

    Science.gov (United States)

    Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

    2009-10-06

    A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

  6. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    Higgo, J.J.W.

    1987-09-01

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  7. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

    1979-01-01

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  8. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    International Nuclear Information System (INIS)

    1979-09-01

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222 Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222 Rn from the site was observed

  9. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  10. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  11. Measurements of a in 2-stage axial turbine with shrouded bladings. Influence of open and closed shroud cavities on the flowfield in a 2-stage turbine with shrouded bladings. Final report; GuD-Kraftwerk - 500 MW auf einer Welle (AG Turbo II). Vorhaben 2.1.7A: 3-D-instationaere Schaufelgitter-Interaktionen in 2-stufigen Turbinenbeschaufelungen mit Deckband-Kavitaeten. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, D.; Tuemmers, C.; Bouzidi, F.

    2003-06-01

    The flow in a multi-stage turbine is characterised by complex steady and unsteady 3D - flow phenomena such as rotor-stator interactions or secondary flow phenomena like the passage - or the vortex. The unsteady flow field itself is influenced by different parameters, like the blade geometry, the flow in the shroud cavities or the relative position of the guide vanes respectively the rotating blades among each other (clocking). Understanding the basic mechanism relating development and propagation of secondary flow phenomena is key to reducing the aerodynamic losses. The aim of this project was the investigation of the influence of open and closed shroud cavities, blade geometry, axial blade distance, relative positions of the guide vanes and the rotor blades to each other (clocking) and the operating conditions on the flow losses, related by the interaction between the guide vanes and the rotor blades. These influences are analysed by coupled experimental and numerical investigation on a two-stage test turbine. The test turbine is built up in a modular way, so that different bladings (a basis- and an optimised blading) and different endwall, rotor and hub geometries can be investigated. For the numerical investigations the in-house Navier-Stockes - solver CHT-flow has been used. The comparison of the basis blading and the optimised blading shows that due to the design of the optimised blading the secondary flow regions at the hub and the tip could have been reduced significantly. Thus, a radially homogeneous flow field and therefore an increased efficiency could be achieved for the optimised blading. Further numerical and experimental investigations showed that due to opened shroud cavities the boundary layer at the hub and the tip has been increased. This leads to a displacement of the secondary flows from the endwalls towards the middle of the channel. Furthermore additional losses are induced, leading to an overall decrease in efficiency. Investigations concerning the clocking showed a potential in increase of efficiency of about 0.5% between the worst and the optimised clocking position. Furthermore, the 'balance-based'-method has been applied successfully into the numerical in-house flow solver CHT-flow. Due to the closely co-operation with the industrial partner ALSTOM it is warranted, that the main results can be implemented directly in the internal development processes. (orig.)

  12. South African Radio League Introduction to Amateur Radio: A study guide for the Radio Amateur Examination

    CSIR Research Space (South Africa)

    Burger, Chris

    2016-01-01

    Full Text Available (CW) ......................................................................................... 181 21.6 Frequency Modulation (FM) .................................................................................. 182 21.7 Digital Modulation... ........................................................................................................................ 275 Revision Questions ........................................................................................................ 276 Chapter 30: Digital Systems...

  13. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 27; Issue 3. Issue front cover thumbnail. Volume 27, Issue 3. June 2004, pages 217-322. pp 217-220 Synthesis. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique · Y S Malghe A V Gurjar S R Dharwadkar.

  14. Planck 2015 results: VII. High Frequency Instrument data processing: Time-ordered information and beams

    DEFF Research Database (Denmark)

    Adam, R.; Ade, P. A R; Aghanim, N.

    2016-01-01

    The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing...

  15. 24 CFR 92.453 - Competitive reallocations.

    Science.gov (United States)

    2010-04-01

    ... (42 U.S.C. 3545) and the requirements of sec. 217(c) of the Cranston-Gonzalez National Affordable... the Cranston-Gonzalez National Affordable Housing Act (42 U.S.C. 12747(c)), with the following maximum... at sec. 217(c)(1) of the Cranston-Gonzalez National Affordable Housing Act (42 U.S.C. 12747(c)(1...

  16. 48 CFR 1217.7001 - Clauses.

    Science.gov (United States)

    2010-10-01

    ... CONTRACT TYPES SPECIAL CONTRACTING METHODS Fixed Price Contracts for Vessel Repair, Alteration or... acceptance tests will afford full protection to the Government in ascertaining conformance to specifications... through (TAR) 48 CFR 1252.217-80. (c) (TAR) 48 CFR 1252.217-75 may be included in sealed bid fixed-price...

  17. Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

    African Journals Online (AJOL)

    PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

  18. Intracellular fate of polymer therapeutics investigated by fluorescence lifetime imaging and fluorescence pattern analysis

    Czech Academy of Sciences Publication Activity Database

    Pánek, Jiří; Koziolová, Eva; Štěpánek, Petr; Etrych, Tomáš; Janoušková, Olga

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S217-S224 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : therapeutics * polymer * anthracycline Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S217.pdf

  19. Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B; Ansari, Z.A.; Parulekar, A.H.

    stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  20. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Annual Meetings · Mid Year Meetings · Discussion Meetings · Public Lectures · Lecture Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Journal of Earth System Science; Volume 125; Issue 2. Issue front cover thumbnail. Volume 125, Issue 2. March 2016, pages 217-442. pp 217-230.

  1. Mobilization of Neural Precursors in the Circulating Blood of Patients with Multiple Sclerosis

    Science.gov (United States)

    2013-09-01

    cells in patients with liver cirrhosis. World J Gastroenterol 16:217-224. Gehling UM, Ergun S, Schumacher U, Wagener C, Pantel K, Otte M, Schuch G...cirrhosis. World J Gastroenterol 16:217-224. Gehling UM, Ergun S, Schumacher U, Wagener C, Pantel K, Otte M, Schuch G, Schafhausen P, Mende T, Kilic N

  2. 77 FR 61593 - North American Natural Resources, Inc. Complainant v. PJM Interconnection, L.L.C, American...

    Science.gov (United States)

    2012-10-10

    ... interconnection costs as Network Upgrades and allocate those costs to AEP and its customers, failed to update AEP's Regional Transmission System Expansion (RTEP) and wrongfully foisted the costs of the Network... sections 1.7A.02, 1.3A, 1.17A, 1.26, 212.4, 217.3, 205, 206 and 217 of PJM's Open Access Transmission...

  3. Genome Sequences of Three Highly Copper-Resistant Salmonella enterica subsp. I Serovar Typhimurium Strains Isolated from Pigs in Denmark

    DEFF Research Database (Denmark)

    Qin, Yanan; Hasman, Henrik; Aarestrup, Frank Møller

    2014-01-01

    Salmonella typhimurium is the causative agent of typhoid fever, which causes nearly 21.7 million illnesses and 217,000 deaths around the world each year. Here, we describe the draft genome sequences of the Salmonella typhimurium strains S7, S15, and S23, isolated from copper-fed pigs in Denmark...

  4. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 27; Issue 3. Issue front cover thumbnail. Volume 27, Issue 3. June 2004, pages 217-322. pp 217-220 Synthesis. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique · Y S Malghe A V Gurjar S R Dharwadkar.

  5. Biochemical composition of zooplankton from the northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, K.L; Sreepada, R.A.; Ansari, Z.A.

    stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|ZP_01061096.1| copper/silver efflux P-type ATPase [Flavobacte...rium sp. MED217] gb|EAQ49147.1| copper/silver efflux P-type ATPase [Leeuwenhoekiella blandensis MED217] ZP_01061096.1 1e-128 60% ...

  7. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities in Support of Marine and Hydrokinetic Energy Deployment

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Copping, Andrea E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Van Cleve, Frances B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2011-09-01

    This fiscal year 2011 progress report summarizes activities carried out under DOE Water Power Task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the marine and hydrokinetic (MHK) energy industry, including regulatory and resource management agencies, tribes, nongovernmental organizations, and industry.

  8. Daniël 2 as satire

    African Journals Online (AJOL)

    23 Jan 2012 ... Die howeling word tot 'n hoër rang verhef en beloon, terwyl sy vyande gestraf word (Humphreys 1973:217). Humphreys (1973:217) ..... Baldwin, J.G., 1978, Daniel: Tyndale Old Testament commentaries, Inter-Varsity,. Leicester. Bentzen, A., 1952, Daniel: Handbuch zum Alten Testament, 2. Auflage, Mohr ...

  9. Resonance Capture in Unbalanced Dual-Spin Spacecraft

    Science.gov (United States)

    1994-03-01

    York, 1989. 22. Wittenburg, Jens. "Beitrige zur dynamik von gyrostaten." In Convegno Inter- nazaionale sul Tema: Metodi Valutativi Nella Fisica ...Matematica, Roma, 15-19 dicembre 1972, Problemi Attuali di Scienza e di Cultura , Quaderno N. 217, pages 217-354. Accademia Nazionale dei Lincei, 1975. 23

  10. Dollar Summary of Prime Contract Awards by Contractor, State or Country, and Place, FY83, Part 2 (Gillespie Delorenzo Asla & Assocs-Planning Analysis Corp).

    Science.gov (United States)

    1983-01-01

    CENTER SAFETY EDUCA TEMPE ARIZONA 34 34 34 34 INTERNATIONAL CINEMA EQUIPMENT CO MIAMI FLORIDA 25 25 25 25 INTERNATIONAL CIVIL AVIATION ORGA CANADA 05...598 MAPLE ISLAND INC WANAMINGO MINNESOTA 485 485 1,217 1,217 MAQUINARIA E INGENIERIA S A PANAMA 500 264 236 500 264 236 MAR BERT CONSTRUCTION

  11. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    International Nuclear Information System (INIS)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-01-01

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  12. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  13. Review of radionuclide source terms used for performance-assessment analyses

    International Nuclear Information System (INIS)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

  14. Alpha-emitting nuclides in the marine environment

    Science.gov (United States)

    Pentreath, R. J.

    1984-06-01

    The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.

  15. Workplace monitoring and related health hazard evaluation in South African mining and mineral processing industries by application of nuclear and related analytical techniques

    International Nuclear Information System (INIS)

    Faanhof, Arnaud

    2000-01-01

    The South African Government notice R 849 (23 April 1994) requires application to the South African Council for Nuclear Safety (CNS) for a nuclear licence if materials are dealt with that contain more than 0,2 but less than 1 Becquerel per gram of any radionuclide of the natural uranium, thorium and actinium decay series. If the material is to be used in the construction of buildings the application should have been made before 1 April 1996, otherwise before 31 March 1999. The first phase of the monitoring programme assesses the observed radioactivity levels of waste products and the possible radiological impact on people working on site and living in the direct environment of the operational site. Information has been obtained on the radionuclide content and elemental composition of the various sources of the coal, waste ash, ash related products, crusher materials and effluent water. Except for the effluent and coal samples all other materials showed activity levels for one or more nuclides above the 0,2 Bq/g but not exceeding the 1 Bq/g level. Accordingly a first order assessment of the possible radiological impact on workers and the public has been performed for water consumption and dust inhalation. Actual dust concentrations recorded at various sites within the operational area are used to evaluate the yearly dose to workers. (author)

  16. Soil nuclide distribution coefficients and their statistical distributions

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

    1984-12-01

    Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

  17. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  18. The high-temperature vaporization/decomposition of actinide materials: fundamental and technological aspects

    International Nuclear Information System (INIS)

    Haire, R.G.

    1997-01-01

    The unique and variable chemistry exhibited across the actinide series offers a scientifically challenging group of elements. Investigations of their high-temperature materials science and thermodynamics can provide important insights into fundamental actinide science and generate critical information for technological applications. The wide variations in the physicochemical properties and the availability of the various actinide elements necessitates special experimental techniques be employed, even when investigating a single property (e.g., the enthalpy of vaporization). Experimental approaches range can from classical to novel methods to permit studies of the rarer and the more intensely radioactive members. We have developed special equipment and techniques to investigate the high-temperature, physicochemical properties of several actinides through Md, as well as the precursor elements, radium and actinium. These experimental approaches employed both alloys and solid solutions of compounds, in addition to the pure elements themselves. The vaporization/decomposition of compounds and the sublimation of the elements, together with the associated thermodynamics, are the main issues. Results for several of the actinide elements, some of the techniques employed and systematic comparisons of the thermochemical aspects of bonding are discussed to give a fuller understanding of the series as a whole. (orig.)

  19. Review of Gallium-68 PSMA PET/CT Imaging in the Management of Prostate Cancer.

    Science.gov (United States)

    Lenzo, Nat P; Meyrick, Danielle; Turner, J Harvey

    2018-02-11

    Over 90% of prostate cancers over-express prostate specific membrane antigen (PSMA) and these tumor cells may be accurately targeted for diagnosis by 68 Ga-PSMA-positron emission tomography/computed tomography ( 68 Ga-PSMA-PET/CT) imaging. This novel molecular imaging modality appears clinically to have superseded CT, and appears superior to MR imaging, for the detection of metastatic disease. 68 Ga-PSMA PET/CT has the ability to reliably stage prostate cancer at presentation and can help inform an optimal treatment approach. Novel diagnostic applications of 68 Ga-PSMA PET/CT include guiding biopsy to improve sampling accuracy, and guiding surgery and radiotherapy. In addition to facilitating the management of metastatic castrate resistant prostate cancer (mCRPC), 68 Ga-PSMA can select patients who may benefit from targeted systemic radionuclide therapy. 68 Ga-PSMA is the diagnostic positron-emitting theranostic pair with the beta emitter Lutetium-177 PSMA ( 177 Lu-PSMA) and alpha-emitter Actinium-225 PSMA ( 225 Ac-PSMA) which can both be used to treat PSMA-avid metastases of prostate cancer in the molecular tumor-targeted approach of theranostic nuclear oncology.

  20. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    International Nuclear Information System (INIS)

    Shiotsuki, Masao; Miyahara, Kaname

    2003-01-01

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  1. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  2. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  3. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  4. Synthesis of new bivalent peptides for applications in the Affinity Enhancement System.

    Science.gov (United States)

    Morandeau, L; Benoist, E; Loussouarn, A; Ouadi, A; Lesaec, P; Mougin, M; Faivre-Chauvet, A; Le Boterff, J; Chatal, J F; Barbet, J; Gestin, J F

    2005-01-01

    The feasibility of two-step radioimmunotherapy (RIT) of cancer by the Affinity Enhancement System (AES) has been demonstrated in experimental and clinical studies. This technique, associating a bispecific antibody and a bivalent peptide radiolabeled with iodine-131, has been developed to reduce toxicity and to improve therapeutic efficacy compared to one-step targeting methods. The use of AES with different beta-emitters such as rhenium-188, samarium-153, or lutetium-177 or alpha-emitters such as actinium-225 or bismuth-213 is now considered. Thus three new peptides, designed to allow for the coupling of a variety of bifunctional chelating agents BCA, were synthesized by associating two glycyl-succinyl-histamine (GSH) arms, which are recognized by the 679 monoclonal antibody (mAb-679), with different binding agents, such as p-nitrophenylalanine or N,N-bis(carboxymethyl)-4-N'-(9-fluorenylmethyloxycarbonyl)aminobenzylamine. Immunoreactivity and serum stability evaluation were performed for each synthesized peptide. One of the three peptides (LM218) proved to be more stable than the others, and three different BCAs were coupled to LM218 (CITC-DTPA, CITC-TTHA, and CITC-CHXA''DTPA). One of these products, LM218-BzTTHA was radiolabeled with indium-111 without loss of immunoreactivity toward the mAb-679. These new peptides will allow pretargeted RIT with a large variety of radionuclides, to adapt the choice of the radionuclide (LET, half-life, penetrating emission) to the nature and size of targeted tumors.

  5. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-02-11

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  6. Pulse-shape discrimination and energy quenching of alpha particles in Cs2LiLaBr6:Ce3+

    Science.gov (United States)

    Mesick, K. E.; Coupland, D. D. S.; Stonehill, L. C.

    2017-01-01

    Cs2LiLaBr6:Ce3+(CLLB) is an elpasolite scintillator that offers excellent linearity and gamma-ray energy resolution and sensitivity to thermal neutrons with the ability to perform pulse-shape discrimination (PSD) to distinguish gammas and neutrons. Our investigation of CLLB has indicated the presence of intrinsic radioactive alpha background that we have determined to be from actinium contamination of the lanthanum component. We measured the pulse shapes for gamma, thermal neutron, and alpha events and determined that PSD can be performed to separate the alpha background with a moderate figure of merit of 0.98. We also measured the electron-equivalent-energy of the alpha particles in CLLB and simulated the intrinsic alpha background from 227Ac to determine the quenching factor of the alphas. A linear quenching relationship Lα =Eα × q +L0 was found at alpha particle energies above 5 MeV, with a quenching factor q = 0.71 MeVee / MeV and an offset L0 = - 1.19 MeVee .

  7. Adjunctive levetiracetam in children, adolescents, and adults with primary generalized seizures: Open-label, noncomparative, multicenter, long-term follow-up study.

    LENUS (Irish Health Repository)

    Delanty, Norman

    2012-02-01

    Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive

  8. IgA Nephropathy: Molecular Mechanisms of the Disease

    Czech Academy of Sciences Publication Activity Database

    Městecký, Jiří; Raška, M.; Julian, B. A.; Gharavi, A. G.; Renfrow, M. B.; Moldoveanu, Z.; Novák, L.; Matoušovič, K.

    2013-01-01

    Roč. 8, č. 2013 (2013), s. 217-240 ISSN 1553-4006 Institutional support: RVO:61388971 Keywords : O-glycosylation * hinge region * circulating immune complexes Subject RIV: EC - Immunology Impact factor: 22.128, year: 2013

  9. Recent Work in Roman Satire (1962-68)

    Science.gov (United States)

    Anderson, William S.

    1970-01-01

    Initial phase of a literary review of books and articles on satire in Roman literature (the 51st in the "Classical World surveys). The review continues in "Classical World, March 1970, pages 217-222. (DS)

  10. Feromony v integrované ochraně rostlin. V. Obaleči a makadlovka na broskvoních a švestkách

    Czech Academy of Sciences Publication Activity Database

    Hrdý, Ivan

    -, č. 5 (2006), s. 217-220 ISSN 0044-4812 Institutional research plan: CEZ:AV0Z40550506 Keywords : pheromones * Cydia funebrana * Cydia molesta * Anarsia lineatella Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  11. Age at weaning, immunocompetence and ectoparasite performance in a precocial desert rodent

    Czech Academy of Sciences Publication Activity Database

    Dlugosz, E. M.; Goüy de Bellocq, Joëlle; Khokhlova, I. S.; Degen, A. A.; Pinshow, B.; Krasnov, B. R.

    2014-01-01

    Roč. 217, č. 17 (2014), s. 3078-3084 ISSN 0022-0949 Institutional support : RVO:68081766 Keywords : Fleas * PHA response * Weaning * Spiny mouse Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

  12. Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs

    Czech Academy of Sciences Publication Activity Database

    Robovská-Havelková, P.; Aerts, P.; Roček, Zbyněk; Přikryl, Tomáš; Fabre, A.-C.; Herrel, A.

    2014-01-01

    Roč. 217, č. 20 (2014), s. 3637-3644 ISSN 0022-0949 Institutional support: RVO:67985831 Keywords : Anura * kinematics * locomotion * swimming Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

  13. Conjugated oestrogen during the menstrual cycle measured by a direct radioimmunoassay with an antiserum prepared against oestradiol-17-glucosiduronate-(C-6)-BSA conjugate

    Energy Technology Data Exchange (ETDEWEB)

    Honjo, H.; Otsubo, K.; Yasuda, J.; Kitawaki, J.; Okada, H. (Department of Obstetrics and Gynaecology, Kyoto Prefectural University of Medicine, Kyoto); Ohkubo, T.; Nambara, T. (Pharmaceutical Institute, Tohoku University, Sendai, Japan)

    1984-01-01

    Early morning and 24 h urine samples and serum were collected daily throughout the menstrual cycle in women. Urinary oestradiol-17-glucosiduronate (E/sub 2/-17G) was measured with a direct radioimmunoassay whose antiserum has been prepared against E/sub 2/-17-G-(C-6)-bovine serum albumin conjugate and was very specific. On the average, E/sub 2/-17-G in early morning and 24 h urine samples showed a prominent peak one day before the peak of urinary LH. The time relationship between these urinary E/sub 2/-17-G and serum E/sub 2/ levels and peaks was also investigated.

  14. No evidence for cumulative effects in a Dnmt3b hypomorph across multiple generations

    Czech Academy of Sciences Publication Activity Database

    Youngson, N.A.; Epp, Trevor; Roberts, A.R.; Daxinger, L.; Ashe, A.; Huang, E.; Lester, K.L.; Harten, S.K.; Kay, G.F.; Cox, T.; Matthews, J.M.; Chong, S.; Whitelaw, E.

    2013-01-01

    Roč. 24, 5-6 (2013), s. 206-217 ISSN 0938-8990 Institutional support: RVO:68378050 Keywords : epigenetic inheritance * mammalian development * transgenerational Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.883, year: 2013

  15. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  16. Submanifolds weakly associated with graphs

    Indian Academy of Sciences (India)

    Leuven: Katholieke Universiteit Leuven). (1990). [5] Etayo F, On quasi-slant submanifolds of an almost Hermitian manifold, Publ. Math. Debrecen 53 (1998) 217–223. [6] Harary F, Graph Theory (Reading: Addison-Wesley) (1972). [7] Papaghiuc N ...

  17. Teadlasena poliitikas - võimalused ja piirid = Als Wissenschaftler in der Politik - Chancen und Grenzen / Eiki Berg

    Index Scriptorium Estoniae

    Berg, Eiki, 1970-

    2005-01-01

    Autori hinnangul lasub teadlasel poliitikas suurem vastutus kui mistahes valdkonna esindajal, sest teaduslikult argumenteeritud poliitilised otsused on teadmiste jõu ja poliitilise võimu sümbioos. Vt. ka kommentaare lk. 217-222,467-472

  18. Genomic and Functional Characterization of the Unusual pLOCK 0919 Plasmid Harboring the spaCBA Pili Cluster in Lactobacillus casei LOCK 0919

    Czech Academy of Sciences Publication Activity Database

    Aleksandrzak-Piekarczyk, T.; Koryszewska-Baginska, A.; Grynberg, M.; Nowak, A.; Cukrowska, B.; Kozáková, Hana; Bardowski, J.

    2016-01-01

    Roč. 8, č. 1 (2016), s. 202-217 ISSN 1759-6653 Institutional support: RVO:61388971 Keywords : adhesion * spaCBA pilus cluster * lactobacillus Subject RIV: EC - Immunology Impact factor: 3.979, year: 2016

  19. Meeting Report: Minutes from EMBO: Ten Years of Comparative Genomics of Eukaryotic Microorganisms

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; López-García, P.; Louis, E.; Boekhout, T.

    2016-01-01

    Roč. 167, č. 3 (2016), s. 217-221 ISSN 1434-4610 Institutional support: RVO:60077344 Keywords : protist * eukaryotic microorganisms * genomics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.794, year: 2016

  20. Neuropsychiatric manifestations in patients with systemic lupus erythematosus: A study from Iran

    Directory of Open Access Journals (Sweden)

    Fatemeh Hajighaemi

    2016-01-01

    Conclusions: We identified NPSLE manifestations in 21.7% of patients; headache and CVD were the most frequent neurological manifestations. Continued studies into the pathogenesis of neurological involvement in patients with SLE are warranted.

  1. Is It a Cosmetic, a Drug, or Both? (or Is It Soap?)

    Science.gov (United States)

    ... Simplified Chinese: PDF 251KB Traditional Chinese, PDF: 260KB Korean, PDF: 217KB Whether a product is a cosmetic ... does the law define a cosmetic? The Federal Food, Drug, and Cosmetic Act (FD&C Act) defines ...

  2. African Journal of Biomedical Research - Vol 18, No 3 (2015)

    African Journals Online (AJOL)

    Analgesic and Central Nervous System Depressant Activities of Kolaviron (a Garcinia kola biflavonoid complex) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GF Ibironke, AA Fasanmade, 217-223 ...

  3. Hatchling sex ratio and female mating status in the great reed warbler, Acrocephalus arundinaceus (Aves, Passeriformes): further evidence for offspring sex ratio manipulation

    Czech Academy of Sciences Publication Activity Database

    Trnka, A.; Prokop, P.; Kašová, M.; Sobeková, Karolina; Kocian, Ľ.

    2012-01-01

    Roč. 79, č. 2 (2012), s. 212-217 ISSN 1125-0003 Institutional support: RVO:68081766 Keywords : Great reed warbler * sex ratio * social polygyny Subject RIV: EG - Zoology Impact factor: 0.890, year: 2012

  4. Fulltext PDF

    Indian Academy of Sciences (India)

    Wintec

    benzodiazepin-2(1H)-one and. -thione (TIBO) derivatives as HIV-1RT inhibitors 395. Aspartic acid. Three-dimensional hybrid networks based on aspartic acid. 217. Assembly p-Aminoacetanilide mediated formation of assembly of Au nanoparticles.

  5. 76 FR 22054 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2011-04-20

    .... June 24, 2010 230169 1143). 01-1532P). 19, 2010; The Times Henderson, Chairman, Record. Board of.... Selectboard, P.O. Box 217, Wilmington, VT 05363. Virginia: Independent City of City of Fairfax (10-03- June 14...

  6. Možnosti mediální výchovy v učebnicích českého jazyka

    Czech Academy of Sciences Publication Activity Database

    Dufek, Ondřej

    2012-01-01

    Roč. 62, č. 5 (2012), s. 209-217 ISSN 0009-0786 Institutional support: RVO:68378092 Keywords : media literacy * media education * communication training * Czech language * Framework Educational Programme * cross-sectional subject Subject RIV: AI - Linguistics

  7. Wüstehubové. Ďáblovo plémě nebo tvůrcové kulturní krajiny?

    Czech Academy of Sciences Publication Activity Database

    Kouřil, Pavel; Wihoda, M.

    2001-01-01

    Roč. 50, č. 3 (2001), s. 205-217 ISSN 0323-0678 Institutional research plan: CEZ:AV0Z8001916 Keywords : Moravia, Silesia * colonisation * castles and material culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Gibsonnema nom. n., a new name for the nematode genus Paraseuratoides Moravec, Salgado-Maldonado et Aguilar-Aguilar, 2002

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Salgado-Maldonado, G.; Aguilar-Aguilar, R.

    Roč. 49, č. 3 ( 2002 ), s. 217 ISSN 0015-5683 Institutional research plan: CEZ:AV0Z6022909 Keywords : Gibsonnema * new name * Paraseuratoides Subject RIV: EG - Zoology Impact factor: 0.515, year: 2002

  9. Human factors issues in motorcoach emergency egress

    Science.gov (United States)

    2009-08-01

    FMVSS 217, Bus Emergency Exits and Window Retention and Release specifies a series of dimensional and physical requirements : for emergency exits. The intent of NHTSA is to minimize the likelihood of occupants being ejected from the bus and to pro...

  10. Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

    Czech Academy of Sciences Publication Activity Database

    Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.

    2015-01-01

    Roč. 285, 1 July (2015), s. 217-226 ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.333, year: 2015

  11. Minimal Representation and Decision Making for Networked Autonomous Agents

    Science.gov (United States)

    2015-08-27

    University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S...Laboratory University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 tel: 217-333-1368, fax: 217-244-1653 email: voulgari@illinois.edu...a mobile sensor network (MSN) when some of the nodes in the network fail. We posed the problem as a multi-stage decision process, and used forward

  12. Identification of amino acid residues essential for binding of calmodulin in C-terminal region of TRPC6

    Czech Academy of Sciences Publication Activity Database

    Friedlová, Eliška; Gryčová, Lenka; Lánský, Zdeněk; Šulc, Miroslav; Teisinger, Jan

    2008-01-01

    Roč. 275, Suppl.1 (2008), s. 217-217 ISSN 1742-464X. [FEBS Congress /33./ and IUBMB Conference /11./. 28.06.2008-03.07.2008, Athens] R&D Projects: GA AV ČR(CZ) IAA600110701; GA ČR(CZ) GA303/07/0915; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * TRPC6 receptor * calmodulin * fluorescence anisotropy Subject RIV: BO - Biophysics

  13. Nonwoven polymeric nanofiber scaffolds with bone marrow mesenchymal stem cells utilizable for spinal cord injury repair

    Czech Academy of Sciences Publication Activity Database

    Lesný, Petr; Jendelová, Pavla; Martinová, L.; Hejčl, Aleš; Jirsák, O.; Řeháková, M.; Syková, Eva

    2006-01-01

    Roč. 8, Supplement 1 (2006), s. 217-217 ISSN 1465-3249. [ISCT 2006. 04.05.2006-07.05.2006, Berlin] R&D Projects: GA MŠk(CZ) 1M0021620803; GA ČR GA309/06/1246; GA MZd(CZ) 1A8697; GA MŠk 1M0538 Institutional research plan: CEZ:AV0Z50390512 Keywords : Cell Subject RIV: FH - Neurology

  14. Spectroscopic Investigations of High-Power Laser Sparks in Gas Mixtures Containing Methane: A Laboratory Model of Energetic Events in Strongly Reduced Planetary Atmospheres

    Czech Academy of Sciences Publication Activity Database

    Civiš, Svatopluk; Civiš, Martin; Rašín, R.; Kamas, Michal; Dryahina, Kseniya; Španěl, Patrik; Juha, Libor; Ferus, Martin

    2009-01-01

    Roč. 39, 3-4 (2009), s. 217-217 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : planetary atmosphere * lasers * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009

  15. 75 FR 80259 - Taking and Importing Marine Mammals; Taking Marine Mammals Incidental to Operation and...

    Science.gov (United States)

    2010-12-21

    ... Part V Department of Commerce National Oceanic and Atmospheric Administration 50 CFR Part 217... and Atmospheric Administration 50 CFR Part 217 [Docket No. 0808041026-9015-01] RIN 0648-AX09 Taking... 148.5 dB re 1 [mu]Pa at 1 m at 2,000 Hertz (Hz) to 174.5 dB re 1 [micro]Pa at 1 m at 10 Hz. Figures 1...

  16. Nematodes from the genus Ascaridia parasitizing psittaciform birds: a review and determination key

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 6 (2004), s. 217-223 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * parrots * morphometry Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-6-217.pdf

  17. Wnt signaling pathway involvement in genotypic and phenotypic variations in Waardenburg syndrome type 2 with MITF mutations.

    Science.gov (United States)

    Wang, Xue-Ping; Liu, Ya-Lan; Mei, Ling-Yun; He, Chu-Feng; Niu, Zhi-Jie; Sun, Jie; Zhao, Yu-Lin; Feng, Yong; Zhang, Hua

    2018-03-12

    Mutation in the gene encoding microphthalmia-associated transcription factor (MITF) lead to Waardenburg syndrome 2 (WS2), an autosomal dominantly inherited syndrome with auditory-pigmentary abnormalities, which is clinically and genetically heterogeneous. Haploinsufficiency may be the underlying mechanism for WS2. However, the mechanisms explaining the genotypic and phenotypic variations in WS2 caused by MITF mutations are unclear. A previous study revealed that MITF interacts with LEF-1, an important factor in the Wnt signaling pathway, to regulate its own transcription through LEF-1-binding sites on the MITF promoter. In this study, four different WS2-associated MITF mutations (p.R217I, p.R217G, p.R255X, p.R217del) that are associated with highly variable clinical features were chosen. According to the results, LEF-1 can activate the expression of MITF on its own, but MITF proteins inhibited the activation. This inhibition weakens when the dosage of MITF is reduced. Except for p.R217I, p.R255X, p.R217G, and p.R217del lose the ability to activate TYR completely and do not inhibit the LEF-1-mediated activation of the MITF-M promoter, and the haploinsufficiency created by mutant MITF can be overcome; correspondingly, the mutants' associated phenotypes are less severe than that of p.R217I. The dominant negative of p.R217del made it have a second-most severe phenotype. This study's data imply that MITF has a negative feedback loop of regulation to stabilize MITF gene dosage that involves the Wnt signaling pathway and that the interaction of MITF mutants with this pathway drives the genotypic and phenotypic differences observed in Waardenburg syndrome type 2 associated with MITF mutations.

  18. Robust Stability and Control of Multi-Body Ground Vehicles with Uncertain Dynamics and Failures

    Science.gov (United States)

    2010-01-01

    Square and Invertible 2.1.7 Application to the 3DOF Vehicle Dynamics Problem 2.1.8 Conclusions 2.2 Active Roll Control for...the matrices A, B, C and D. 2.1.7 Application to the 3DOF Vehicle Dynamics Problem In this section, we apply the above LQR extension procedure to...the 3DOF vehicle dynamics problem discussed before and investigate the performance of the resulting controllers under a double lane change maneuver

  19. (SSR) markers for analysis of genetic diversity in African rice ...

    African Journals Online (AJOL)

    Bonny Oloka

    2015-05-06

    May 6, 2015 ... 161/161. 194/196. 32 WAC 116. AfricaRice. 116/122. 121/121. 182/182. 146/146. 217/217. 210/210. 157/189. 231/257. 157/157. 174/177. 33 AER-75 ..... Life Technologies Inc., USA. Table 3. Estimated genetic diversity parameters obtained at each locus across 99 genotypes. Marker. No. of Alleles. He. Ho.

  20. Design Rules for High Temperature Microchemical Systems

    Science.gov (United States)

    2006-10-25

    500 micron posts shrink to 300 microns. Figure 28 and Figure 29 compare the anodization of different aluminum alloys . We find when...S Mathews Avenue Urbana IL, 61801 (217)333-6841 (Phone), (217)333- 5052 (fax) e-mail: r-masel@uiuc.edu Administrative Point of Contact...microreactor. The UIUC team pioneered the use of monolithic anodized aluminum as an alternative catalyst support. Reactors created in the acceptable

  1. Functional characterization of temperature-gated ion channels using an improved technique for rapid heating and cooling of superfusing solutions in patch clamp experiments

    Czech Academy of Sciences Publication Activity Database

    Benedikt, Jan; Dittert, Ivan; Vyklický st., Ladislav; Vlachová, Viktorie

    2005-01-01

    Roč. 272, S1 (2005), s. 217-217 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] R&D Projects: GA MŠk(CZ) 1M0517; GA ČR(CZ) GA305/03/0802 Institutional research plan: CEZ:AV0Z50110509 Keywords : channel * TRPV1 Subject RIV: ED - Physiology

  2. Antibacterial activities of coagulase-negative staphylococci from bovine teat apex skin and their inhibitory effect on mastitis-related pathogens.

    Science.gov (United States)

    Braem, G; Stijlemans, B; Van Haken, W; De Vliegher, S; De Vuyst, L; Leroy, F

    2014-05-01

    To explore antibacterial activities of coagulase-negative staphylococci (CoNS) from teat apices of dairy cows towards mastitis-causing pathogens. Of 254 CoNS, 38 displayed bacteriocin-like activity after a first screening. Seven of these strains displayed activity against at least one mastitis-related pathogen (Streptococcus uberis, Streptococcus dysgalactiae and Staphylococcus aureus). Staphylococcus chromogenes L217 displayed the strongest inhibitory effect, being active against all tested mastitis-related pathogens and most tested CoNS. Based on cation exchange and reversed-phase chromatography, in addition to N-terminal Edman degradation and PCR, the antibacterial peptide was identified as a nukacin-type bacteriocin and named nukacin L217. Although staphylococcal bacteriocins are generally found in the cell-free supernatants of liquid cultures, Staph. chromogenes L217 only led to detectable activity when grown on agar medium. Bacteriocin-like activities are not uncommon among CoNS from teat apices and may inhibit mastitis-causing pathogens, as found for nukacin L217 production by Staph. chromogenes L217. Nukacin L217 is the first identified bacteriocin of the species Staph. chromogenes and displays unusual production kinetics, that is, requiring surface growth of its producer. The fact that nukacins are produced by different CoNS species suggests a role in the teat skin ecosystem. © 2014 The Society for Applied Microbiology.

  3. Radioisotope space power generator annual report, July 1, 1974--June 30, 1975

    International Nuclear Information System (INIS)

    Elsner, N.B.; Chin, J.; Staley, H.G.

    1976-01-01

    The Isotec Technology Program for FY-75 concentrated on materials development efforts in two areas: TPM-217 P-type material and SiGe technology. TPM-217 P-type material is a 3M proprietary thermoelectric material whose principal components are Cu, Ag, and Se. The usefulness of TPM-217 P-type selenide in thermoelectric converters depends on its dimensional, electrical, and thermal stability at high temperature and its compatibility with other converter component materials in a low-pressure environment. Experimental efforts were directed toward determining (1) the vapor species above TPM-217 from 700 0 to 1100 0 C, (2) the weight loss rate for TPM-217 at 900 0 C in vacuo, and (3) the stability of TPM-217 material in contact with Mo, Fe, 316 stainless steel, and pyrocarbon. The Si-Ge program is a continuation of the experimental work performed during FY-74. The development of coatings to suppress the vaporization of SiMo and SiGe continued. Techniques for applying ion-plated and chemical-vapor-deposited coatings of Si 3 N 4 and (Si,Al)N alloys on SiMo were examined. Methods of controlling morphology and the chemical composition of these coatings were developed. Rates of vaporization for coated samples at 1100 0 C were measured

  4. Determination of radium in water

    International Nuclear Information System (INIS)

    Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

    1995-10-01

    These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)

  5. Radiological survey of the Mallinckrodt Chemical Works, St. Louis, Missouri

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, W A; Leggett, R W; Haywood, F F

    1981-12-01

    The results of a radiological survey of part of the Mallinckrodt Chemical Works (former Destrehan and Broadway Street plants), St. Louis, Missouri, are presented. During the period 1942 through 1957, this site was used for various projects involving the production of purified uranium from pitchblende concentrates. The survey included measurements of the following: residual alpha and beta-gamma contamination levels in the existing buildings that were used in the uranium projects; external gamma radiation levels at 1 m above the surface in these buildings and outdoors around these buildings; radon and radon daughter concentrations in the air in these buildings; uranium, radium, actinium, and thorium concentrations in surface and subsurface soil on the site; concentrations of radionuclides in water and sediment found in drains both inside and outside the buildings; and concentrations of radionuclides in ground and surface water on the site and in river water taken near the site. Alpha and beta-gamma contamination levels inside and outside some of the buildings were above limits set by current federal guidelines concerning the release of property for unrestricted use. Elevated external gamma radiation levels were measured at some outdoor locations and in some of the buildings. Licensable concentrations of uranium were found in soil at some places, and the concentration of uranium in a water sample taken from a core hole between Buildings 100 and 101 was in excess of limits set by current federal standards. Radon and radon daughter concentrations in three buildings were in excess of current federal guidelines for nonoccupational radiation exposure.

  6. Determination of radium in water

    Energy Technology Data Exchange (ETDEWEB)

    Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

    1995-10-01

    These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).

  7. An aerial radiological survey of the Nevada Test Site

    International Nuclear Information System (INIS)

    Hendricks, T.J.; Riedhauser, S.R.

    1999-01-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys

  8. Alpha Emitting Radionuclides and Radiopharmaceuticals for Therapy

    International Nuclear Information System (INIS)

    Chérel, Michel; Barbet, Jacques

    2013-01-01

    Today, cancer treatments mainly rely on surgery or external beam radiation to remove or destroy bulky tumors. Chemotherapy is given when tumours cannot be removed or when dissemination is suspected. However, these approaches cannot permanently treat all cancers and relapse occurs in up to 50% of the patients’ population. Radioimmunotherapy (RIT) and peptide receptor radionuclide therapy (PRRT) are effective against some disseminated and metastatic diseases, although they are rarely curative. Most preclinical and clinical developments in this field have involved electron-emitting radionuclides, particularly iodine-131, yttrium-90 and lutetium-177. The large range of the electrons emitted by these radionuclides reduces their efficacy against very small tumour cell clusters or isolated tumour cells present in residual disease and in many haematological tumours (leukaemia, myeloma). The range of alpha particles in biological tissues is very short, less than 0.1 mm, which makes alpha emitters theoretically ideal for treatment of such isolated tumour cells or micro-clusters of malignant cells. Thus, over the last decade, a growing interest for the use of alpha-emitting radionuclides has emerged. Research on targeted alpha therapy (TAT) began years ago in Nantes through cooperation between Subatech, a nuclear physics laboratory, CRCNA, a cancer research centre with a nuclear oncology team and ITU (Karlsruhe, Germany). CD138 was demonstrated as a potential target antigen for Multiple Myeloma, which is a target of huge clinical interest particularly suited for TAT because of the disseminated nature of the disease consisting primarily of isolated cells and small clusters of tumour cells mainly localized in the bone marrow. Thus anti-CD138 antibodies were labelled with bismuth-213 from actinium-225/bismuth-213 generators provided by ITU and used to target multiple myeloma cells. In vitro studies showed cell cycle arrest, synergism with chemotherapy and very little induction

  9. Radiological survey of the Mallinckrodt Chemical Works, St. Louis, Missouri

    International Nuclear Information System (INIS)

    Goldsmith, W.A.; Leggett, R.W.; Haywood, F.F.

    1981-12-01

    The results of a radiological survey of part of the Mallinckrodt Chemical Works (former Destrehan and Broadway Street plants), St. Louis, Missouri, are presented. During the period 1942 through 1957, this site was used for various projects involving the production of purified uranium from pitchblende concentrates. The survey included measurements of the following: residual alpha and beta-gamma contamination levels in the existing buildings that were used in the uranium projects; external gamma radiation levels at 1 m above the surface in these buildings and outdoors around these buildings; radon and radon daughter concentrations in the air in these buildings; uranium, radium, actinium, and thorium concentrations in surface and subsurface soil on the site; concentrations of radionuclides in water and sediment found in drains both inside and outside the buildings; and concentrations of radionuclides in ground and surface water on the site and in river water taken near the site. Alpha and beta-gamma contamination levels inside and outside some of the buildings were above limits set by current federal guidelines concerning the release of property for unrestricted use. Elevated external gamma radiation levels were measured at some outdoor locations and in some of the buildings. Licensable concentrations of uranium were found in soil at some places, and the concentration of uranium in a water sample taken from a core hole between Buildings 100 and 101 was in excess of limits set by current federal standards. Radon and radon daughter concentrations in three buildings were in excess of current federal guidelines for nonoccupational radiation exposure

  10. Alpha-emitting isotopes and chromium in a coastal California aquifer

    Science.gov (United States)

    Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.

    2014-01-01

    The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238U and its daughter 234U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232Th, including its daughter 224Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ53Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development.

  11. Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and Coast of Quintana Roo, Mexico

    International Nuclear Information System (INIS)

    Salas Mar, Bernardo; Martinez Negrete, Marco Antonio; Ruiz Chavarria, Gerardo; Abarca Munguia, Jose

    2008-01-01

    Full text: We describe in this paper the results obtained by the project 'Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and coast of Quintana Roo, Mexico'. The purpose of the study is to identify and quantify the natural and anthropogenic radionuclides present from sediments, sand and seawater from several sites located along the coast of the Gulf of Mexico and the Caribean Sea. The samples are analysed in a Canberra Multichannel analyzer system for gamma spectrometry, equipped with a detector of hyper pure germanium and a Genie 2000 software, in the 'Laboratory of Radiological Analysis of Environmental Samples', belonging to the Physics Department, Faculty of Sciences, National Autonomous University of Mexico (UNAM). The geographic sites were samples were taken include the states of Tamaulipas, Veracruz, Tabasco, Campeche, Yucatan and Quintana Roo. The results of this studies will be published at the end of the project and we hope they will be useful for the national health and industrial sectors. Until now we have identified and measured the presence of natural radionuclides such as Potassium-40 (K-40), Bismuth 212 (Bi-212), Lead-212 (Pb-212), Bismuth-214 (Bi-214), Lead-214 (Pb-214), Radium-226 (Ra-226), Actinium 228 (Ac-228), Uranium-235 (U-235), as well as some anthropogenic radionuclides found near the Laguna Verde Nuclear Power Plant. The project is scheduled to last for three years, finishing in 2009. At its ending we shall be able to present conclusions and identify some tendencies, in connection with the background and possible radioactive contamination of the studied zones. This project takes place under the auspice of the 'Program of Support to Projects of Research and Technological Innovation' of the National Autonomous University of Mexico. (author)

  12. The Properties of Trilaurylmethylammonium Nitrate as an Extractant for Trivalent Actinides. RCN Report

    International Nuclear Information System (INIS)

    Ooyen, J. van

    1970-03-01

    The concept of the group of the actinide elements as a f-type transition series within the periodic system was first launched by G.T. Seaborg in 1944]. In this transition series the filling up of the 5 f electron shell would cause a close similarity with the lanthanide series. This proved to be a very fruitful hypothesis in the prediction of the properties of the new elements americium and curium that soon were discovered. The new hypothesis necessitated a shift of the accepted ideas concerning the place of the elements thorium, protactinium and uranium in the periodic table. In fact, the chemistry of these elements had never been considered to be so closely parallel to that of the lanthanides. On the contrary, the trend in the stability of the oxidation states had been interpreted to indicate that these elements would belong to group IVA, VA and VIA respectively. It is undeniable that there are marked differences in oxidation states between the lanthanide elements and the first six elements of the actinide series. However, physical and chemical investigations both of the newly discovered elements and the elements actinium to uranium disclosed many resemblances with the lanthanides that had not been noticed before in this group. The actinide elements - and more in particular the transuranium elements - have been the subject of a number of monographs covering the discovery, the synthesis, the systematics, the chemistry, and (or) the nuclear properties of these elements. It is for this reason that the scope of the following sections in this chapter will be limited to a summary of the chemistry in sofar as it is relevant to the investigations described in the following chapters, viz., the properties of the elements in aqueous systems and more in particular in those systems containing nitrate ions

  13. An aerial radiological survey of the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Hendricks, T J; Riedhauser, S R

    1999-12-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys.

  14. Cancer radioimmunotherapy with alpha-emitting nuclides

    Energy Technology Data Exchange (ETDEWEB)

    Couturier, Olivier [INSERM U 601, Nantes (France); Place Alexis Ricordeau, Department of Nuclear Medicine, Nantes, Cedex (France); Supiot, Stephane; Degraef-Mougin, Marie; Faivre-Chauvet, Alain; Carlier, Thomas; Chatal, Jean-Francois; Davodeau, Francois; Cherel, Michel [INSERM U 601, Nantes (France)

    2005-04-01

    In lymphoid malignancies and in certain solid cancers such as medullary thyroid carcinoma, somewhat mixed success has been achieved when applying radioimmunotherapy (RIT) with {beta}-emitters for the treatment of refractory cases. The development of novel RIT with {alpha}-emitters has created new opportunities and theoretical advantages due to the high linear energy transfer (LET) and the short path length in biological tissue of {alpha}-particles. These physical properties offer the prospect of achieving selective tumoural cell killing. Thus, RIT with {alpha}-emitters appears particularly suited for the elimination of circulating single cells or cell clusters or for the treatment of micrometastases at an early stage. However, to avoid non-specific irradiation of healthy tissues, it is necessary to identify accessible tumoural targets easily and rapidly. For this purpose, a small number of {alpha}-emitters have been investigated, among which only a few have been used for in vivo preclinical studies. Another problem is the availability and cost of these radionuclides; for instance, the low cost and the development of a reliable actinium-225/bismuth-213 generator were probably determining elements in the choice of bismuth-213 in the only human trial of RIT with an {alpha}-emitter. This article reviews the literature concerning monoclonal antibodies radiolabelled with {alpha}-emitters that have been developed for possible RIT in cancer patients. The principal radio-immunoconjugates are considered, starting with physical and chemical properties of {alpha}-emitters, their mode of production, the possibilities and difficulties of labelling, in vitro studies and finally, when available, in vivo preclinical and clinical studies. (orig.)

  15. Cancer radioimmunotherapy with alpha-emitting nuclides.

    Science.gov (United States)

    Couturier, Olivier; Supiot, Stéphane; Degraef-Mougin, Marie; Faivre-Chauvet, Alain; Carlier, Thomas; Chatal, Jean-François; Davodeau, François; Cherel, Michel

    2005-05-01

    In lymphoid malignancies and in certain solid cancers such as medullary thyroid carcinoma, somewhat mixed success has been achieved when applying radioimmunotherapy (RIT) with beta-emitters for the treatment of refractory cases. The development of novel RIT with alpha-emitters has created new opportunities and theoretical advantages due to the high linear energy transfer (LET) and the short path length in biological tissue of alpha-particles. These physical properties offer the prospect of achieving selective tumoural cell killing. Thus, RIT with alpha-emitters appears particularly suited for the elimination of circulating single cells or cell clusters or for the treatment of micrometastases at an early stage. However, to avoid non-specific irradiation of healthy tissues, it is necessary to identify accessible tumoural targets easily and rapidly. For this purpose, a small number of alpha-emitters have been investigated, among which only a few have been used for in vivo preclinical studies. Another problem is the availability and cost of these radionuclides; for instance, the low cost and the development of a reliable actinium-225/bismuth-213 generator were probably determining elements in the choice of bismuth-213 in the only human trial of RIT with an alpha-emitter. This article reviews the literature concerning monoclonal antibodies radiolabelled with alpha-emitters that have been developed for possible RIT in cancer patients. The principal radio-immunoconjugates are considered, starting with physical and chemical properties of alpha-emitters, their mode of production, the possibilities and difficulties of labelling, in vitro studies and finally, when available, in vivo preclinical and clinical studies.

  16. Cancer radioimmunotherapy with alpha-emitting nuclides

    International Nuclear Information System (INIS)

    Couturier, Olivier; Supiot, Stephane; Degraef-Mougin, Marie; Faivre-Chauvet, Alain; Carlier, Thomas; Chatal, Jean-Francois; Davodeau, Francois; Cherel, Michel

    2005-01-01

    In lymphoid malignancies and in certain solid cancers such as medullary thyroid carcinoma, somewhat mixed success has been achieved when applying radioimmunotherapy (RIT) with β-emitters for the treatment of refractory cases. The development of novel RIT with α-emitters has created new opportunities and theoretical advantages due to the high linear energy transfer (LET) and the short path length in biological tissue of α-particles. These physical properties offer the prospect of achieving selective tumoural cell killing. Thus, RIT with α-emitters appears particularly suited for the elimination of circulating single cells or cell clusters or for the treatment of micrometastases at an early stage. However, to avoid non-specific irradiation of healthy tissues, it is necessary to identify accessible tumoural targets easily and rapidly. For this purpose, a small number of α-emitters have been investigated, among which only a few have been used for in vivo preclinical studies. Another problem is the availability and cost of these radionuclides; for instance, the low cost and the development of a reliable actinium-225/bismuth-213 generator were probably determining elements in the choice of bismuth-213 in the only human trial of RIT with an α-emitter. This article reviews the literature concerning monoclonal antibodies radiolabelled with α-emitters that have been developed for possible RIT in cancer patients. The principal radio-immunoconjugates are considered, starting with physical and chemical properties of α-emitters, their mode of production, the possibilities and difficulties of labelling, in vitro studies and finally, when available, in vivo preclinical and clinical studies. (orig.)

  17. Occupational radiation exposure of the personnel of a nuclear research centre in Belgium

    International Nuclear Information System (INIS)

    Deworm, J.P.; Fieuw, G.; Ghoos, L.; Govaerts, P.

    1980-01-01

    Occupational radiation exposure of the personnel of the SCK-CEN nuclear research centre in Mol, Belgium, is determined by means of a film-badge dose meter. The frequency of renewal of the film badge depends on the job concerned. A computer program permits fast data handling and storage, and use of the data for statistical studies. The average annual collective dose for the research centre fluctuates between 2.6 and 5.3 man.Sv for the last four years, for about 300-400 exposed workers with an annual individual dose of above 1 mSv. The average individual annual dose for radiation workers is about 10.5 mSv for the last four years. The dismantling of actinium hot-cell installations in 1976, together with important tasks before start-up of the BR3 power plant and sea-dumping operations, led to a higher average annual collective dose of 5.3 man.Sv. The most exposed groups are the BR2 research reactor operation and hot-cell staff, the BR3 power plant operation staff and the waste-processing staff. The total collective dose for the BR2 research reactor since its start-up amounts to about 4.70 man.Sv for the operation staff. For the 10.5-MW(e) power plant BR3 the cumulative collective dose since its start-up 16 years ago is about 16 man.Sv. The cumulative collective dose for the dismantling operations of hot-cells was 1.30 man.Sv. (author)

  18. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

    2013-01-01

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  19. Estradiol and progesterone exhibit similar patterns of hepatic gene expression regulation in the bovine model.

    Directory of Open Access Journals (Sweden)

    Carla A Piccinato

    Full Text Available Female sex steroid hormones, estradiol-17β (E2-17β and progesterone (P4 regulate reproductive function and gene expression in a broad range of tissues. Given the central role of the liver in regulating homeostasis including steroid hormone metabolism, we sought to understand how E2-17β and P4 interact to affect global gene expression in liver. Ovariectomized cows (n = 8 were randomly assigned to 4 treatment groups applied in a replicated Latin Square design: 1 No hormone supplementation, 2 E2-17β treatment (ear implant, 3 P4 treatment (intravaginal inserts, and 4 E2-17β combined with P4. After 14 d of treatment, liver biopsies were collected, allowing 28 d intervals between periods. Changes in gene expression in the liver biopsies were monitored using bovine-specific arrays. Treatment with E2-17β altered expression of 479 genes, P4 472 genes, and combined treatment significantly altered expression of 468 genes. In total, 578 genes exhibited altered expression including a remarkable number (346 genes that responded similarly to E2-17β, P4, or combined treatment. Additional evidence for similar gene expression actions of E2-17ß and/or P4 were: principal component analysis placed almost every treatment array at a substantial distance from controls; Venn diagrams indicated overall treatment effects for most regulated genes; clustering analysis indicated the two major clusters had all treatments up-regulating (172 genes or down-regulating (173 genes expression. Thus, unexpectedly, common biological pathways were regulated by E2-17β and/or P4 in liver. This indicates that the mechanism of action of these steroid hormones in the liver might be either indirect or might occur through non-genomic pathways. This unusual pattern of gene expression in response to steroid hormones is consistent with the idea that there are classical and non-classical tissue-specific responses to steroid hormone actions. Future studies are needed to elucidate

  20. Effects of extremely low-frequency pulsed electromagnetic fields on morphological and biochemical properties of human breast carcinoma cells (T47D).

    Science.gov (United States)

    Sadeghipour, Razmin; Ahmadian, Shahin; Bolouri, Bahram; Pazhang, Yaghub; Shafiezadeh, Mahshid

    2012-12-01

    This study was carried out to investigate the effects of 100 and 217 Hz extremely low-frequency pulsed electromagnetic fields (ELF-PEMF) on cell proliferation, actin reorganization, and ROS generation in a human breast carcinoma cells (T47D). Cells were exposed for 24-72 h, at 100 and 217 Hz, 0.1 mT. The treatment induced a time dependent decrease in cell growth after 72 h and revealed an increase in fluorescence intensity in cytoplasm and actin aggregations around the nucleus as detected by fluorescence microscopy. The amount of actin in T47D cells increased after 48 h exposure to 100 Hz and 24 h to 217 Hz while no changes in nuclear morphology were detected. Exposing the cells to 217 Hz for 72 h caused a dramatically increase of intracellular ROS generation while with exposure to 100 Hz it remained nearly unchanged. These results suggest that exposure to ELF-PEMF (100, 217 Hz, 0.1 mT) are able inducing an increase of actin level, its migration toward nucleus but despite of these changes and dramatically increase in ROS generation the symptoms of apoptosis were not observed. Our results support the hypothesis that cell response to EMF may only be observed at certain window effects; such as frequency and intensity of EMF parameters.

  1. Comparison of rates of and charges from pregnancy complications in users of extended and cyclic combined oral contraceptive (COC) regimens: a brief report.

    Science.gov (United States)

    Howard, Brandon; Trussell, James; Grubb, ElizaBeth; Lage, Maureen J

    2014-05-01

    To evaluate pregnancy complication rates and related charges in users of 84/7, 21/7 and 24/4 combined oral contraceptives (COCs). Data were obtained from the i3 InVision Data Mart™ retrospective claims database. Subjects were aged 15-40 years, first prescribed a COC between 1/1/2006 and 4/1/2011 and continuously insured for ≥1 year. 84/7 users were matched 1:1 to 21/7 and 24/4 users. Pregnancy-related complication rates and associated charges were significantly lower with 84/7 vs. 21/7 and 24/4 regimens. Preliminary data suggest 84/7 regimens may be associated with fewer pregnancy complications and lower related charges. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Thermoelectric materials evaluation program. Quarterly technical task report No. 46

    International Nuclear Information System (INIS)

    Hampl, E.F. Jr.

    1976-02-01

    This forty-sixth Technical Task Report prepared under contract E(11-1)-2331 with the U.S. AEC and U.S. ERDA covers the performance period from October 1, 1975, to December 31, 1975. Highlights include the following tasks: N-type material development (material synthesis--gadolinium selenide compositions; material analyses; material processing; element contacting; ingradient compatibility and life testing; mechanical property characterization), TPM-217 P-type characterization (material preparation and analyses; element contacting; thermodynamic stability; isothermal chemical compatibility; ingradient compatibility and ingradient life testing; performance mapping of contacted and noncontacted elements; high-temperature partitioned P-legs), couple development (design and development of TPM-217/gadolinium selenide rare earth chalcogenide couple; design and development of TPM-217/3N-PbTe couples; advanced generator concepts), module development, liaison with Jet Propulsion Laboratory and material supply, liaison with GGA, and program management. 24 figures, 27 tables

  3. Pre-Exposure Prophylaxis YouTube Videos: Content Evaluation.

    Science.gov (United States)

    Kecojevic, Aleksandar; Basch, Corey; Basch, Charles; Kernan, William

    2018-02-16

    Antiretroviral (ARV) medicines reduce the risk of transmitting the HIV virus and are recommended as daily pre-exposure prophylaxis (PrEP) in combination with safer sex practices for HIV-negative individuals at a high risk for infection, but are underused in HIV prevention. Previous literature suggests that YouTube is extensively used to share health information. While pre-exposure prophylaxis (PrEP) is a novel and promising approach to HIV prevention, there is limited understanding of YouTube videos as a source of information on PrEP. The objective of this study was to describe the sources, characteristics, and content of the most widely viewed PrEP YouTube videos published up to October 1, 2016. The keywords "pre-exposure prophylaxis" and "Truvada" were used to find 217 videos with a view count >100. Videos were coded for source, view count, length, number of comments, and selected aspects of content. Videos were also assessed for the most likely target audience. The total cumulative number of views was >2.3 million, however, a single Centers for Disease Control and Prevention video accounted for >1.2 million of the total cumulative views. A great majority (181/217, 83.4%) of the videos promoted the use of PrEP, whereas 60.8% (132/217) identified the specific target audience. In contrast, only 35.9% (78/217) of the videos mentioned how to obtain PrEP, whereas less than one third addressed the costs, side effects, and safety aspects relating to PrEP. Medical and academic institutions were the sources of the largest number of videos (66/217, 30.4%), followed by consumers (63/217, 29.0%), community-based organizations (CBO; 48/217, 22.1%), and media (40/217, 18.4%). Videos uploaded by the media sources were more likely to discuss the cost of PrEP (PYouTube videos can be used to share reliable PrEP information with individuals. Further research is needed to identify the best practices for using this medium to promote and increase PrEP uptake. ©Aleksandar Kecojevic

  4. ORYX-E: ORIGEN yields and cross sections, nuclear transmutation and decay data from ENDF/B. [In FORTRAN IV for IBM 360

    Energy Technology Data Exchange (ETDEWEB)

    1976-01-01

    ORYX-E increases the versatility of CCC-217/ORIGEN, the isotope generation and depletion code package, by providing basic cross section and decay information for light element, fission-product, and actinide nuclides. This data library package results from data compiled for ORNL Chemical Technology Division's work with ORIGEN and from a 2-year effort of the Cross Section Evaluation Working Group (CSEWG) Fission Product Task Force. The data are generated from ENDF/B-IV, and are formated for input to the ORIGEN (CCC-217) code. Applications include calculations for waste projection, decay heat, nuclear safeguards, and fuel cycle economics. (RWR)

  5. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  6. One Team, One Fight, One Organizational Identity...Or Not: The United States Air Force at a Turning Point

    Science.gov (United States)

    2014-06-01

    Warner Burke defines organizational identity as the organization’s statement about how it will achieve its long- term mission and is dominant approach...Unconscious Life of Organizations, 216‐217.  85 Diamond, Unconscious Life of Organizations, 217.  86 W.  Warner  Burke, Organization Change: Theory...States Air Force began its organizational identity journey in 1903 when the Wright Brothers first “slipped the surly bonds of earth.”2 In the

  7. Thyroid cancer: experiences at Uttar Pradesh

    International Nuclear Information System (INIS)

    Varma, K.D.

    1999-01-01

    The highest incidence of goitre and also carcinoma of the thyroid was found to be in Terai. Although patients having thyroid carcinoma are being treated since 1964, because of the poor follow-up of the patients, only 1140 patients seen over 20 years (1978-1997) have been included in the study. Of the 217 cases of anaplastic carcinomas, surgery was feasible in only 19.4% (43/217) of cases. Even in these cases, the disease recurred within a short period to poor results. The main treatment has been external beam radiotherapy with doxorubicin as a radiosensitiser

  8. Differences between users and non-users of emergency contraception after a recognized unprotected intercourse

    DEFF Research Database (Denmark)

    Sørensen, M B; Pedersen, B L; Nyrnberg, L E

    2000-01-01

    Knowledge of emergency contraception is crucial but might not transform into use. Factors influencing decision-making related to use of emergency contraception after an unprotected intercourse and the characteristics of users of emergency contraception (EC) were assessed. In an abortion clinic...... setting, 217 women referred for termination of pregnancy were asked to fill in a questionnaire. Of the 217 women, 139 (64%) were aware of pregnancy risk but only 9 (4%) had used EC after the unprotected intercourse. 42% were estimated to have sufficient knowledge to use hormonal emergency contraception...

  9. Několik poznámek k problematice ochrany duševního vlastnictví

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich

    2011-01-01

    Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf

  10. Diethylstilbestrol can effectively accelerate estradiol-17-O-glucuronidation, while potently inhibiting estradiol-3-O-glucuronidation

    International Nuclear Information System (INIS)

    Zhu, Liangliang; Xiao, Ling; Xia, Yangliu; Zhou, Kun; Wang, Huili; Huang, Minyi; Ge, Guangbo; Wu, Yan; Wu, Ganlin; Yang, Ling

    2015-01-01

    This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), K m values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while V max values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate V max from 0.016 to 0.81 nmol/min/mg, while lifting K m in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with K A , α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the activity of UGT1A4

  11. Projected changes in flood-generating precipitation extremes over the Czech Republic in high-resolution regional climate models

    Czech Academy of Sciences Publication Activity Database

    Kyselý, Jan; Gaál, Ladislav; Beranová, Romana

    2011-01-01

    Roč. 59, č. 4 (2011), s. 217-227 ISSN 0042-790X R&D Projects: GA ČR GAP209/10/2045; GA AV ČR KJB300420801 Institutional research plan: CEZ:AV0Z30420517 Keywords : precipitation extremes * regional frequency analysis * climate change * regional climate models * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.340, year: 2011 http://dlib.lib.cas.cz/6965/1/2011_59_4_kysely_217.pdf

  12. Luteinizing hormone secretion as affected by hypophyseal stalk transection and estradiol-17beta in ovariectomized gilts.

    Science.gov (United States)

    Ford, J J; Berardinelli, J G; Christenson, R K; Anderson, L L

    2000-11-01

    The objectives were to determine hypothalamic regulation of pulsatile luteinizing hormone (LH) secretion in female pigs and the biphasic feedback actions of estradiol-17beta (E(2)-17beta). In the first study, the minimum effective dosage of E(2)-17beta that would induce estrus in ovariectomized gilts was determined to be 20microg/kg body weight. In the second study, ovariectomized gilts were assigned randomly on day 0 to treatments: (a) hypophyseal stalk transection (HST), (b) cranial sham-operated control (SOC), and (c) unoperated control (UOC). On day 3, gilts from each group received a single i.m. injection of either E(2)-17beta (20microg/kg body weight) or sesame oil. Blood was collected from an indwelling jugular cannula at 15min intervals for 3h before (day -2) and after treatment (day 2) from HST, SOC and UOC gilts. On day 3, blood was collected at 2h intervals for 12h after E(2)-17beta or sesame oil injection and at 4h intervals thereafter for 108h. Pulsatile LH secretion in all gilts 2 days after ovariectomy exhibited a frequency of 0.9+/-0.06peaks/h, amplitude of 1.3+/-0.13ng/ml, baseline of 0.8+/-0.07. Serum LH concentrations from SOC and UOC gilts were similar on day 2 and profiles did not differ from those on day -2. In HST gilts pulsatile LH release was abolished and mean LH concentration decreased compared with controls (0 versus 0.9+/-0. 06peaks/h and 0.77+/-0.03 versus 1.07+/-0.07ng/ml, respectively; Pgilts, and LH remained constant throughout 120h (0.7+/-0. 07ng/ml). In SOC and UOC control gilts, E(2)-17beta induced a 60% decrease (Pgilts compared with controls (228 versus 332mg, Pgilts. The third and fourth studies determined that hourly i. v. infusions of LHRH (2microg) and a second injection of E(2)-17beta 48h after the first had no effect on the positive feedback action of estrogen in UOC. However, in HST gilts that received LHRH hourly, the first injection of E(2)-17beta decreased (Pfeedback action of E(2)-17beta on LH secretion depend on

  13. MULTIPLEXED IMMUNOASSAYS FOR SIMULTANEOUS QUANTIFICATION OF CARDIOVASCULAR BIOMARKERS IN THE MODEL OF H-G-NITRO-L-ARGININE METHYLESTER (L-NAME) HYPERTENSIVE RAT

    Czech Academy of Sciences Publication Activity Database

    Adamcova, M.; Růžičková, Šárka; Simko, F.

    2013-01-01

    Roč. 64, č. 2 (2013), s. 211-217 ISSN 0867-5910 Institutional research plan: CEZ:AV0Z50520701 Keywords : cardiac biomarkers * multiplex assay * cardiac troponin Subject RIV: ED - Physiology Impact factor: 2.720, year: 2013

  14. Association Analysis of Arg16Gly Polymorphism of the Beta2-adreneric Receptor Gene in Offspring from Hypertensive and Normotensive Families

    Czech Academy of Sciences Publication Activity Database

    Jindra, A.; Horký, K.; Peleška, Jan; Jáchymová, M.; Bultas, J.; Umnerová, V.; Heller, S.; Hlubocká, Z.

    2002-01-01

    Roč. 11, č. 4 (2002), s. 213-217 ISSN 0803-7051 R&D Projects: GA MZd NA5615 Keywords : Arg16Gly polymorphism of the beta2-adrenergic receptor gene * normotensive offspring * essential hypertension Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.344, year: 2002

  15. Search for the Xb and other hidden-beauty states in the π+π−Υ(1S) channel at ATLAS

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2015-01-01

    Roč. 740, Jan (2015), 199-217 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : experimental results * ATLAS * CERN LHC Coll Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.787, year: 2015

  16. Birth Order and Maladaptive Behavior in School-Aged Children.

    Science.gov (United States)

    Carmichael, Karla D.

    Drawing on Alfred Adler's theories on the effect of birth order on maladaptive behavior in children, this study focused on the relationship between birth order and the referral to counseling of school-aged children with maladaptive disorder. School-aged children (N=217) with academic or behavioral problems, ages 5 to 18, were referred to the staff…

  17. Untitled

    Indian Academy of Sciences (India)

    similar to that of rock-Salt and it also exhibits similar cleavage properties. But in other respects, lithium fluoride differs markedly from rock-salt. Though the atomic Weights of both the component elements in lithium fluoride are much smaller, its density is Substantially greater than that of rock-salt, being 260 as against 217.

  18. Problems of Implementation of Strategic Plans for Secondary Schools' Improvement in Anambra State

    Science.gov (United States)

    Chukwumah, Fides Okwukweka; Ezeugbor, Carol Obiageli

    2015-01-01

    This study investigated the extent of problems of strategic plans implementation for secondary schools' improvement in Anambra State, Nigeria for quality education provision. The study used a descriptive survey design paradigm. Respondents comprised 217 principals. There was no sampling. All the principals were used. Data were collected using…

  19. Developing Quality Strategic Plan in Secondary Schools for Successful School Improvement

    Science.gov (United States)

    Chukwumah, Fides Okwukweka

    2015-01-01

    The study examined the extent to which development of quality strategic plans for Anambra State secondary schools' improvement had been done by schools. The research design used was a descriptive survey. Respondents comprised 217 principals. There was no sampling since all the principals were used. Data were collected using "Schools'…

  20. Diversity and phylogeny of insect trypanosomatids: all that is hidden shall be revealed

    Czech Academy of Sciences Publication Activity Database

    Maslov, D. A.; Votýpka, Jan; Yurchenko, V.; Lukeš, Julius

    2013-01-01

    Roč. 29, č. 1 (2013), s. 43-52 ISSN 1471-4922 R&D Projects: GA ČR GA204/09/1667 Institutional support: RVO:60077344 Keywords : biodiversity * Kinetoplastea * insect trypanosomatids * monoxenous parasites * phylogeny * taxonomy * Trypanosomatidae Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.217, year: 2013

  1. A Demographic Study of Certified Orientation and Mobility Specialists.

    Science.gov (United States)

    Wiener, William R.; Siffermann, Eileen

    2000-01-01

    A survey of 217 AER-certified orientation and mobility specialists (COMSs) found the median annual income for full-time employed COMSs was $39,000. Of the respondents, 63.7 were women, 91.5 percent were white, and the median age was 43 years. The majority entering into the field had master's degrees. (Contains references.) (CR)

  2. Lidský potenciál jako psychologický konstrukt

    Czech Academy of Sciences Publication Activity Database

    Mudrák, J.; Zábrodská, Kateřina

    2013-01-01

    Roč. 57, č. 3 (2013), s. 201-217 ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional support: RVO:68081740 Keywords : learning * motivation * giftedness Subject RIV: AN - Psychology Impact factor: 0.292, year: 2013

  3. Radiographic diagnosis of scapholunate dissociation among intra-articular fractures of the distal radius: interobserver reliability

    NARCIS (Netherlands)

    Gradl, Gertraud; Neuhaus, Valentin; Fuchsberger, Thomas; Guitton, Thierry G.; Prommersberger, Karl-Josef; Ring, David; Wahegaonkar, Abhijeet L.; Shafritz, Adam B.; Garcia, Aida E.; Caputo, Andrew E.; Terrono, Andrew L.; Spoor, Andy B.; Eschler, Anica; Vochteloo, Anne J. H.; Beumer, Annechien; Barquet, Antonio; Kristan, Anze; van der Zwan, Arnard L.; Berner, Arne; Ilyas, Asif; Jubel, Axel; Sutker, Ben; Nolan, Betsy M.; Petrisor, Brad; Cross, Brian J.; Wills, Brian P. D.; Barreto, Camilo J. R.; Fernandes, Carlos H.; Swigart, Carrie; Zalavras, Charalampos; Goldfarb, Charles A.; Cassidy, Charles; Eaton, Charles; Wilson, Chris; Cheng, Christine J.; Wall, Christopher J.; Walsh, Christopher J.; Jones, Christopher M.; Garnavos, Christos; Klostermann, Cyrus; Kirkpatrick, D. Kay; Osei, Daniel A.; Rikli, Daniel A.; Wascher, Daniel C.; Polatsch, Daniel; Silva, Dario Mejia; Nelson, David L.; Kalainov, David M.; Ruchelsman, David; Hoffmann, David Victoria; Weiss, David; Eygendaal, Denise; van Deurzen, Derek F. P.; McKee, Desirae M.; Verbeek, Diederik O. F.; Hanel, Doug; Hutchinson, Douglas T.; Brilej, Drago; Harvey, Edward; Stojkovska Pemovska, Emilija; Calvo, Emilio; Hammerberg, Eric Mark; Hofmeister, Eric P.; Kaplan, F. Thomas D.; Suarez, Fabio; Beeres, Frank J. P.; Walter, Frank L.; Frykman, Gary K.; Pess, Gary M.; Kuzma, Gary R.; Dyer, George S. M.; Thomas, George; Kohut, Georges; Kraan, Gerald A.; DeSilva, Gregory; Della Rocca, Gregory J.; Lob, Guenter; Gadbled, Guillaume; Bamberger, H. Brent; Mc Cutchan, Hal; Goost, Hans; Kreder, Hans J.; Grünwald, Heinz; Broekhuyse, Henry; Kimball, Hervey L.; Durchholz, Holger; van der Heide, Huub; McGraw, Iain; Choueka, Jack; Forigua, Jaime E.; Nappi, James F.; Reid, James G.; Kellam, James; Boler, James M.; Biert, Jan; Fanuele, Jason C.; Tavakolian, Jason D.; Jones, Jedediah; Johnson, Jeff W.; Wolf, Jennifer Moriatis; Murachovsky, Joel; Scheer, Johan H.; Rueger, Johannes M.; Erickson, John M.; McAuliffe, John; Boretto, Jorge G.; Rubio, Jorge; Ortiz, Jose A.; Ribeiro Filho, Jose Eduardo Grandi; Di Giovanni, José Fernando; Izzi, Joseph A.; Conflitti, Joseph M.; Abzug, Joshua M.; Cagnone, Juan Carlos; Adams, Julie; Chivers, Karel; Lee, Kendrick; Eng, Kevin; Malone, Kevin J.; Erol, Konul; Ponsen, Kornelis J.; Kabir, Koroush; Jeray, Kyle; Mica, Ladislav; Brunton, Lance M.; Adolfsson, Lars E.; Weiss, Lawrence; Katolik, Leonid; Paz, Lior; Poelhekke, Lodewijk M. S. J.; Escobar, Luis Felipe Naquira; Campinhos, Luiz Augusto B.; Abdel-Ghany, Mahmoud I.; Richard, Marc J. Richard; Swiontkowski, Marc; Rizzo, Marco; Pirpiris, Marinis; Boyer, Martin; Richardson, Martin; Kastelec, Matej; Turina, Matthias; Soong, Maximillian; Wood, Megan M.; Baskies, Michael; Behrman, Michael; Nancollas, Michael; Prayson, Michael; Quell, Michael; Verhofstad, Michael; Grafe, Michael W.; Kessler, Michael W.; van den Bekerom, Michel P. J.; van de Sande, Michiel A. J.; Mckee, Mike; Patel, Milan M.; Merchant, Milind; Tyllianakis, Minos; Wiegand, Mischa Ralph; Waseem, Mohammad; Parnes, Nata; Wilson, Neil; Elias, Nelson; Shortt, Nicholas L.; Schep, Niels; Semenkin, Oleg M.; Henry, Patrick D. G.; Martineau, Paul A.; Jebson, Peter; Kloen, Peter; Brink, Peter R. G.; Schandelmaier, Peter; Blazar, Philip; Streubel, Philipp N.; Vial, Philippe; Choudhari, Pradeep; Inna, Prashanth; Costanzo, Ralph M.; de Bedout, Ramon; Hauck, Randy; Smith, Raymond Malcolm; Fricker, Renato M.; Omid, Reza; Buckley, Richard; Jenkinson, Richard; Hutchison, Richard L.; GIlbert, Richard S.; Page, Richard S.; Nelissen, Rob; Haverlag, Robert; Wagenmakers, Robert; Pesantez, Rodrigo; Klinefelter, Ryan; Calfee, Ryan P.; Moghtaderi, Sam; Spruijt, Sander; Kakar, Sanjeev; Kaplan, Saul; Duncan, Scott F.; Mitchell, Scott; Rowinski, Sergio; Dodds, Seth; Kennedy, Stephen A.; Westly, Stephen K.; Kronlage, Steve; Beldner, Steven; McCabe, Steven J.; Rhemrev, Steven J.; Gosens, Taco; Baxamusa, Taizoon; Apard, Thomas; Dienstknecht, Thomas; Varecka, Thomas F.; Hughes, Thomas; Mittlmeier, Thomas; Pillukat, Thomas; Wright, Thomas; Havenhill, Timothy G.; Omara, Timothy; Siff, Todd; Giordano, Vincenzo; Hammert, Warren C.; Satora, Wojciech

    2013-01-01

    To evaluate the reliability and accuracy of diagnosis of scapholunate dissociation (SLD) among AO type C (compression articular) fractures of the distal radius. A total of 217 surgeons evaluated 21 sets of radiographs with type C fractures of the distal radius for which the status of the

  4. The Effect of Administrative Pay and Local Property Taxes on Student Achievement Scores: Evidence from New Jersey Public Schools

    Science.gov (United States)

    Mensah, Yaw M.; Schoderbek, Michael P.; Sahay, Savita P.

    2013-01-01

    We theorized that student test score performance will be positively related to the percentage of school district revenues raised from local taxes and with salary levels of school district administrators. Using both fixed and random effects panel analyses, we examine data for 217 Kindergarten-to-Grade 12 school districts in New Jersey for the years…

  5. Mapas do Futurismo português. O Futurismo em Coimbra

    OpenAIRE

    Marnoto, Rita

    2010-01-01

    2010). Mapas do Futurismo português. O Futurismo em Coimbra. In Sandra Bagno, Andréia Guerini & Patricia Peterle, Cem anos de Futurismo. Do italiano ao português (197-217). Rio de Janeiro: 7 Letras. ISBN 978 85 7577 708 4 Pnorama do Futurismo em Coimbra

  6. Sanomy Pathak

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Sanomy Pathak. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 2 February 2018 pp 197-217 General Article. Thymus: The site for Development of Cellular Immunity · Shamik Majumdar Sanomy Pathak Deepak Nandi.

  7. The lungs in rheumatoid arthritis - a clinical, radiographic and ...

    African Journals Online (AJOL)

    Five patients had digital clubbing, of whom 2 had fibrosing alveolitis and 1 bronchiectasis. No cause of the ..... Junk AG. Davidsen O. Graudal H. Prevalence of pulmonary involvement in rheumatoid arthrrtis and its relationship to some characterist,cs of the patients. Scand J RhelJmatol1982: 11: 217-224. 21. Hyland RH.

  8. Biological flora of Central Europe: Atriplex tatarica L

    Czech Academy of Sciences Publication Activity Database

    Kochánková, J.; Mandák, Bohumil

    2008-01-01

    Roč. 10, č. 4 (2008), s. 217-229 ISSN 1433-8319 R&D Projects: GA AV ČR(CZ) IAA600050707 Institutional research plan: CEZ:AV0Z60050516 Keywords : Atriplex tatarica * heterocarpy * ecology Subject RIV: EF - Botanics Impact factor: 3.680, year: 2008

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ed Lorenz: Father of the 'Butterfly Effect' · G Ambika · More Details Fulltext PDF. pp 206-216 General Article. Multivariable Chinese Remainder Theorem · B Sury · More Details Fulltext PDF. pp 217-234 General Article. C-II Acid and the Stereochemistry of Abietic Acid · S N Balasubrahmanyam · More Details Fulltext PDF.

  10. 26 CFR 31.3121(a)(11)-1 - Moving expenses.

    Science.gov (United States)

    2010-04-01

    ...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Insurance Contributions Act (Chapter 21, Internal Revenue Code of 1954) General Provisions... under section 217. The reasonable belief contemplated by the statute may be based upon any evidence...

  11. Are negative intra-specific interactions important for recruitment dynamics? A case study of Atlantic fish stocks.

    Czech Academy of Sciences Publication Activity Database

    Ricard, Daniel; Zimmermann, F.; Heino, M.

    2016-01-01

    Roč. 547, April (2016), s. 211-217 ISSN 0171-8630 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : cannibalism * intra-specific competition * recruitment * population dynamics * Atlantic Ocean Subject RIV: EH - Ecology , Behaviour Impact factor: 2.292, year: 2016

  12. Bad Luck or Bad Decisions: College Students' Perceptions of the Reasons for and Consequences of Their Alcohol Overdose

    Science.gov (United States)

    Reis, Janet

    2007-01-01

    Reasons for and immediate consequences of an alcohol overdose were explored for 217 undergraduate students requiring a medical emergency transport because of excessive alcohol consumption. The sample was categorized into 26 students attributing their overdose solely to bad luck and 191 students citing bad decision making as an explanation. A…

  13. Translations on Latin America, Number 1616

    Science.gov (United States)

    1977-03-04

    PROSPECTING AREA—An area of 2,217 square kilometers, located in the provinces of Cajatambo, Chancay (Lima) and Daniel Alcides Carrion (Pasco), has...Checras and Santa Leonor (Chancay) and part of the district of Yanahuanca in the province of Daniel Alcides Carrion (Pasco). [Text] [Lima LA PRENSA in Spanish 16 Jan 77 p 1] 8735 CSO: 3010 END 57

  14. 77 FR 65937 - Rail Switching Services, Inc.-Operation Exemption-Pemiscot County Port Authority

    Science.gov (United States)

    2012-10-31

    ...) interchange at milepost 212.32, at Hayti, Mo., and milepost 217.22, at Pemiscot Port Harbor, on the... has located on the Line and wishes to receive shipments from the BNSF interchange. RSS now seeks an... Services, Inc., 1318 S. Johanson Road, Peoria, IL 61607. Board decisions and notices are available on our...

  15. Studies in the Antrodia serialis group (Polyporales, Basidiomycota)

    Czech Academy of Sciences Publication Activity Database

    Spirin, V.; Vlasák, Josef; Miettinen, O.

    2017-01-01

    Roč. 109, č. 2 (2017), s. 217-230 ISSN 0027-5514 Institutional support: RVO:60077344 Keywords : fungi * Brown-rot fungi * phylogeny * taxonomy Subject RIV: EF - Botanics OBOR OECD: Mycology Impact factor: 2.550, year: 2016

  16. 40 CFR 81.409 - Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Hawaii. 81.409 Section 81.409... Visibility Is an Important Value § 81.409 Hawaii. Area name Acreage Public Law establishing Federal land manager Haleakala NP 27,208 87-744 USDI-NPS Hawaii Volcanoes 217,029 64-171 USDI-NPS ...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 217 ... N Wanjala, S Khainga. Vol 4 (2009), Anatomy training for surgeons: Which way for the future? ... Vol 9, No 2 (2012), Breast transillumination a viable option for breast cancer screening in limited resource settings? ... Vol 7 (2011), Clinical Outcomes of Colorectal Cancer in Kenya, Abstract PDF. H Saidi, M ...

  18. 47 CFR 90.259 - Assignment and use of frequencies in the bands 216-220 MHz and 1427-1432 MHz.

    Science.gov (United States)

    2010-10-01

    ... COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Standards for... applicants that establish eligibility in the Industrial/Business Pool. (2) All operation is secondary to the fixed and mobile services, including the Low Power Radio Service. (3) In the 216-217 MHz band, no new...

  19. Renversements de l'intentionnalité: Jean-Luc Marion et la mise en question de la subjectivité de l'apparaître

    Czech Academy of Sciences Publication Activity Database

    Novotný, Karel

    2015-01-01

    Roč. 25, č. 2 (2015), s. 217-229 ISSN 1591-9625 R&D Projects: GA ČR(CZ) GA15-10832S Institutional support: RVO:67985955 Keywords : phenomenon * reduction * givenness * interpretation * hermeneutics Subject RIV: AA - Philosophy ; Religion

  20. The School-to-Community Transition Experiences of Hearing Young Adults and Young Adults Who Are Deaf.

    Science.gov (United States)

    Bullis, Michael; And Others

    1995-01-01

    Comparison of hearing (n=222) and deaf (n=217) young adults on employment, independent living, and social experience outcomes found that the hearing group was generally more successful than deaf persons from mainstream or residential schools. Gender differences did not uniformly favor men. Suggestions for improving transition programs for the deaf…

  1. Chemical control of blossom blight disease of sarpagandha caused ...

    African Journals Online (AJOL)

    ONOS

    2010-09-20

    Sep 20, 2010 ... Sarpagandha (Rauvolfia serpentina Benth) is grown in different parts of India and its adjoining countries for its root which is the chief source of ... There are many reports on the chemical control of the diseases caused by the pathogen, .... infection of weed seedlings by H. sativum. J. Agric. Res. 5: 195-217.

  2. Detection of Bacteroides forsythus and Porphyromonas gingivalis in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-05-18

    May 18, 2009 ... periodontitis among Chinese patients. 217 patients with chronic periapcial periodontitis were recruited and a total of 266 teeth were collected. The subjects had no systemic diseases, no antibiotics taken, no root canal treatment (RCT) performed on the infected teeth in the last 3 months. The DNA of bacteria ...

  3. AcEST: DK962549 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YTS Sbjct: 80 QHRAGVSPYTS 90 >tr|Q1R3T7|Q1R3T7_ECOUT Putative uncharacterized protein OS=Escherichia coli (strain UTI89 / UPEC...S=Escherichia coli (strain UTI89 / UPEC) GN=UTI89_C3718 PE=4 SV=1 Length = 80 Score = 88.2 bits (217), Expec

  4. Response to cadmium of Daucus carota hairy roots dual cultures with glomus intraradices or Gigaspora margarita

    Czech Academy of Sciences Publication Activity Database

    Janoušková, Martina; Vosátka, Miroslav

    2005-01-01

    Roč. 15, - (2005), s. 217-224 ISSN 0940-6360 R&D Projects: GA ČR(CZ) GA526/02/0293 Institutional research plan: CEZ:AV0Z60050516 Keywords : arbuscular mycorrhiza * heavy metal * monoxenic culture Subject RIV: EF - Botanics Impact factor: 1.753, year: 2005

  5. TABLE OF CONTENTS TABLE OF CONTENTS

    African Journals Online (AJOL)

    eobe

    SECTION A:BUILDING,CIVIL AND GEOTECHNICAL ENGINEERING. Optimizing Compression Zone of Flanged Hollow Cored. Concrete Beams Using Moment of Inertia Theory. O. Orie and B. Idolor 217. Assessment of Bagasse Ash Effect on the California. Bearing Ratio of Used Oil Contaminated Lateritic Soils.

  6. Herbal medicine use among Turkish patients with chronic diseases

    Directory of Open Access Journals (Sweden)

    Munevver Tulunay

    2015-09-01

    Conclusions: In this study herbal medicine use was found to be higher among patients who had been diagnosed with chronic diseases. Therefore physicians should be aware of herbal medicine usage of their patients and inform them about the effectivity and side effects of herbal medicines. [J Intercult Ethnopharmacol 2015; 4(3.000: 217-220

  7. small cell lung cancer in a Chinese population

    African Journals Online (AJOL)

    Chan IS, Ginsburg GS. Personalized medicine: progress and promise. Annu Rev Genomics Hum Genet 2011;. 12:217-244. 12. World Medical Association. World Medical Association. Declaration of Helsinki: Ethical Principles for Medical. Research Involving Human Subjects. Seoul: From the. 59th World Medical Association ...

  8. Small strain oscillations of an elastoplastic Kirchhoff plate

    Czech Academy of Sciences Publication Activity Database

    Guenther, R.; Krejčí, Pavel; Sprekels, J.

    2008-01-01

    Roč. 88, č. 3 (2008), s. 199-217 ISSN 0044-2267 Institutional research plan: CEZ:AV0Z10190503 Keywords : Prandtl-Ishlinskii operator * tensorial von Mises plasticity model * viscous approximations Subject RIV: BA - General Mathematics Impact factor: 0.644, year: 2008 http://onlinelibrary.wiley.com/doi/10.1002/zamm.200700111/pdf

  9. Parenting in complex conditions : Does preterm birth provide a context for the development of less optimal parental behavior?

    NARCIS (Netherlands)

    Hoffenkamp, H.N.; Braeken, J.; Hall, R.A.S.; Tooten, A.; Vingerhoets, A.J.J.M.; van Bakel, H.J.A.

    2015-01-01

    Objective  To examine the predictive value of parent, infant, and contextual factors related to preterm childbirth for later parenting behaviors. Methods  Mothers (n = 217) and fathers (n = 204) of term, moderately preterm, and very preterm infants were interviewed 1 month postpartum using the

  10. Planck 2013 results. VI. High Frequency Instrument data processing

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

    2013-01-01

    We describe the processing of the 531 billion raw data samples from the High Frequency Instrument (HFI), which we performed to produce six temperature maps from the first 473 days of Planck-HFI survey data. These maps provide an accurate rendition of the sky emission at 100, 143,217, 353, 545...

  11. Instrument platforms for nano liquid chromatography

    Czech Academy of Sciences Publication Activity Database

    Šesták, Jozef; Moravcová, Dana; Kahle, Vladislav

    2015-01-01

    Roč. 1421, NOV (2015), s. 2-17 ISSN 0021-9673 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : nano liquid chromatography * splitless gradient generation * nano LC platforms Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2015 http://hdl.handle.net/11104/0250900

  12. Evaluation of toxicity of pesticides and their biodegradation products using human cells

    Czech Academy of Sciences Publication Activity Database

    Forman, S.; Novák, Jaroslav; Tykva, Richard; Káš, J.; Wimmer, Zdeněk; Ruml, T.

    2002-01-01

    Roč. 46, - (2002), s. 209-217 ISSN 0045-6535 R&D Projects: GA ČR GA203/99/1447 Institutional research plan: CEZ:AV0Z4055905 Keywords : juvenile hormone Subject RIV: CE - Biochemistry Impact factor: 1.461, year: 2002

  13. AcEST: DK953483 [AcEST

    Lifescience Database Archive (English)

    Full Text Available haracterized protein OS=Popul... 217 5e-55 tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annon...VPVRVHKNNGEANN 179 Query: 560 HVPN 571 PN Sbjct: 180 FFPN 183 >tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona

  14. AcEST: DK951051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona... 271 2e-71 tr|A7QUM9|A7QU...RGGL+K +W+ APFVS Sbjct: 180 FFPNEKPMYLFSSIWNADDWATRGGLEKTDWKKAPFVS 217 >tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Ann...ona cherimola GN=XET3 PE=2 SV=1 Length = 294 Score = 271

  15. Peritoneoscopy in Medical Cases

    African Journals Online (AJOL)

    1974-03-16

    Mar 16, 1974 ... toneoscopy: 217 were Blacks (128 male and 89 female), .... (i) Shnmken liver in Black boy, aged 17 years, with .... films were normal. Peritoneal carcinomatosis provides the highest yield in conclusive biopsies (7 carcinomata in 8 biopsies). Histo- logical proof of carcinoma of the liver may be obtained.

  16. Cross-gain modulation effect on the behaviour of packetized cascaded EDFAs

    Czech Academy of Sciences Publication Activity Database

    Menif, M.; Karásek, Miroslav; Fouli, K.; Rusch, L. A.

    2001-01-01

    Roč. 3, č. 3 (2001), s. 210-217 ISSN 1464-4258 Grant - others:EU COST(XE) OC 266.10 Institutional research plan: CEZ:AV0Z2067918 Keywords : wavelength division multiplexing * optical crosstalk * fractals Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.970, year: 2001

  17. Rosiglitazone evaluated for cardiovascular outcomes--an interim analysis

    DEFF Research Database (Denmark)

    Home, Philip D; Pocock, Stuart J; Beck-Nielsen, Henning

    2007-01-01

    group). The primary end point was hospitalization or death from cardiovascular causes. RESULTS: Because the mean follow-up was only 3.75 years, our interim analysis had limited statistical power to detect treatment differences. A total of 217 patients in the rosiglitazone group and 202 patients...

  18. 77 FR 21866 - Safety Zone; Sunken Vessel, Puget Sound, Everett, WA

    Science.gov (United States)

    2012-04-12

    ...-AA00 Safety Zone; Sunken Vessel, Puget Sound, Everett, WA AGENCY: Coast Guard, DHS. ACTION: Temporary... Puget Sound; Coast Guard; telephone 206-217-6045; email SectorPugetSound[email protected] . If you have... pollution response and salvage operations. Background and Purpose On March 18, 2012 at approximately 12:46 p...

  19. Capacitive contribution to Li-storage in TiO2 (B) and TiO2 (anatase)

    Czech Academy of Sciences Publication Activity Database

    Lásková, Barbora; Zukalová, Markéta; Zukal, Arnošt; Bouša, Milan; Kavan, Ladislav

    2014-01-01

    Roč. 246, JAN 2014 (2014), s. 103-109 ISSN 0378-7753 R&D Projects: GA ČR(CZ) GAP108/12/0814; GA ČR GA13-07724S Institutional support: RVO:61388955 Keywords : titanium dioxide * TiO2 (B) * Li-insertion Subject RIV: CG - Electrochemistry Impact factor: 6.217, year: 2014

  20. Příklady výzkumu epigenetických změn u mnohočetného myelomu

    Czech Academy of Sciences Publication Activity Database

    Kroupová, Jana; Bártová, Eva; Harničarová, Andrea; Hájek, R.

    2008-01-01

    Roč. 21, č. 1 (2008), s. 217-219 ISSN 0862-495X R&D Projects: GA MŠk(CZ) LC06027 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : multiple myeloma * genome * epigenome Subject RIV: AQ - Safety, Health Protection, Human - Machine

  1. A colourful university life? Transnational higher education and the spatial dimensions of institutional social capital in Hong Kong

    NARCIS (Netherlands)

    Waters, J.; Leung, W.H.M.

    2013-01-01

    Transnational higher education represents a lesser-known aspect of the international education industry. In relation to the UK, transnational education is a booming business. British qualifications are offered in 217 countries outside the UK, representing in excess of 388,000 students in

  2. Randomized Controlled Trial of a Preventive Intervention for Perinatal Depression in High-Risk Latinas

    Science.gov (United States)

    Le, Huynh-Nhu; Perry, Deborah F.; Stuart, Elizabeth A.

    2011-01-01

    Objective: A randomized controlled trial was conducted to evaluate the efficacy of a cognitive-behavioral (CBT) intervention to prevent perinatal depression in high-risk Latinas. Method: A sample of 217 participants, predominantly low-income Central American immigrants who met demographic and depression risk criteria, were randomized into usual…

  3. Ionic π-Conjugated Polymer Networks by Catalyst-Free Polymerization, Photoluminescence and Gas Sorption Behavior

    Czech Academy of Sciences Publication Activity Database

    Faukner, T.; Zukal, Arnošt; Brus, Jiří; Zedník, J.; Sedláček, J.

    2016-01-01

    Roč. 217, č. 17 (2016), s. 1886-1898 ISSN 1022-1352 R&D Projects: GA ČR(CZ) GA15-09637S Institutional support: RVO:61388955 ; RVO:61389013 Keywords : conjugated polyacetylene * ethanol vapors * gas sorption Subject RIV: CF - Physical ; Theoretical Chemistry; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 2.500, year: 2016

  4. Low temperature synthesis of Ba1–xSrxSnO3 (x = 0–1) from molten ...

    Indian Academy of Sciences (India)

    Administrator

    Udawatte C P, Kakihana M and Yoshimura M 2000 Solid State. Ionics 128 217. Uma S and Gopalakrishnan J 1993 J. Solid State Chem. 105 595. Upadhyay S, Parkash O and Kumar D 2007 J. Electroceram. 18. 45. Wagner G and Binder H 1958 Z. Anorg. Allg. Chem. 297 328. Wernicke R 1978 Ber. Deut. Keram. Ges.

  5. A Double-Blind, Placebo-Controlled Trial of Oral Human Immunoglobulin for Gastrointestinal Dysfunction in Children with Autistic Disorder

    Science.gov (United States)

    Handen, Benjamin L.; Melmed, Raun D.; Hansen, Robin L.; Aman, Michael G.; Burnham, David L.; Bruss, Jon B.; McDougle, Christopher J.

    2009-01-01

    Controversy exists regarding the extent and possible causal relationship between gastrointestinal symptoms and autism. A randomized, double-blind, placebo-controlled, parallel groups, dose-ranging study of oral, human immunoglobulin (IGOH 140, 420, or 840 mg/day) was utilized with 125 children (ages 2-17 years) with autism and persistent GI…

  6. Prematuur geboren en lage sociaal-economische status

    NARCIS (Netherlands)

    de Laat, S. A. A.; Essink-Bot, M. L.; van Wassenaer-Leemhuis, A. G.; Vrijkotte, T. G. M.

    2015-01-01

    Comparison of the association between socioeconomic status (SES) and psychosocial problems in preterm-born and term-born children. Cohort study (Amsterdam Born Children and their Development (ABCD) cohort). For 217 preterm-born children (mean gestation 34 weeks), Strengths and Difficulties

  7. Predictors of Changes in Body Image Concerns of Chinese Adolescents

    Science.gov (United States)

    Chen, Hong; Jackson, Todd

    2009-01-01

    This nine-month prospective study tested the extent to which risk factors implicated in recent accounts of body dissatisfaction predicted changes in body image concerns of adolescent boys and girls in China. A sample of 593 Chinese adolescents (217 boys, 376 girls) completed measures of weight esteem, appearance esteem and physical stature concern…

  8. Molecular Evolution at a Meiosis Gene Mediates Species Differences in the Rate and Patterning of Recombination.

    Science.gov (United States)

    Brand, Cara L; Cattani, M Victoria; Kingan, Sarah B; Landeen, Emily L; Presgraves, Daven C

    2018-04-23

    Crossing over between homologous chromosomes during meiosis repairs programmed DNA double-strand breaks, ensures proper segregation at meiosis I [1], shapes the genomic distribution of nucleotide variability in populations, and enhances the efficacy of natural selection among genetically linked sites [2]. Between closely related Drosophila species, large differences exist in the rate and chromosomal distribution of crossing over. Little, however, is known about the molecular genetic changes or population genetic forces that mediate evolved differences in recombination between species [3, 4]. Here, we show that a meiosis gene with a history of rapid evolution acts as a trans-acting modifier of species differences in crossing over. In transgenic flies, the dicistronic gene, mei-217/mei-218, recapitulates a large part of the species differences in the rate and chromosomal distribution of crossing over. These phenotypic differences appear to result from changes in protein sequence not gene expression. Our population genetics analyses show that the protein-coding sequence of mei-218, but not mei-217, has a history of recurrent positive natural selection. By modulating the intensity of centromeric and telomeric suppression of crossing over, evolution at mei-217/-218 has incidentally shaped gross differences in the chromosomal distribution of nucleotide variability between species. We speculate that recurrent bouts of adaptive evolution at mei-217/-218 might reflect a history of coevolution with selfish genetic elements. Copyright © 2018 Elsevier Ltd. All rights reserved.

  9. Adsorption and photocatalytic detoxification of diazinon using iron and nanotitania modified activated carbons

    Czech Academy of Sciences Publication Activity Database

    Hassan, A F.; Elhadidy, Hassan; Abdel-Mohsen, A. M.

    2017-01-01

    Roč. 75, JUN (2017), s. 299-306 ISSN 1876-1070 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Detoxification * Diazinon * Flamboyant pods * Photocatalyst * Characterization Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.217, year: 2016

  10. Genetic and serological typing of European infectious haematopoietic necrosis virus (IHNV) isolates

    DEFF Research Database (Denmark)

    Johansson, Tove; Einer-Jensen, Katja; Batts, William

    2009-01-01

    Infectious haematopoietic necrosis virus (IHNV) causes the lethal disease infectious haematopoietic necrosis (IHN) in juvenile salmon and trout. The nucleocapsid (N) protein gene and partial glycoprotein (G) gene (nucleotides 457 to 1061) of the European isolates IT-217A, FR-32/87, DE-DF 13/98 11...

  11. 78 FR 37594 - Application and Amendment to Facility Operating License Involving Proposed No Significant Hazards...

    Science.gov (United States)

    2013-06-21

    .... ML13165A217), the licensee notified the NRC that in light of the decision to permanently cease power operation... time that a document is referenced. NRC's PDR: You may examine and purchase copies of public documents... generator structural integrity performance criterion (SIPC) be demonstrated up to 70% Rated Thermal Power...

  12. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Yan Wang. Articles written in Journal of Chemical Sciences. Volume 121 Issue 2 March 2009 pp 217-223 Full Papers. Linear sweep voltammetric studies on the supramolecular complex of alizarin red S with lysozyme and determination of lysozyme · Wei Sun Na Zhao ...

  13. Social work in diverse ethno-cultural contexts: a case study of Nigeria

    African Journals Online (AJOL)

    A case study of Nigeria was conducted to ascertain the impact of social work on the country's ethno-cultural diversity and its impartation of local knowledge to the ... a quite limited focus (2.17% of articles from an average of 69, s=57.8) on social work related to ethno-cultural diversity due to basic constitutional inadequacies, ...

  14. Zum Stand und den Perspektiven der allgemeinsprachlichen ...

    African Journals Online (AJOL)

    Mev. R.B. Ruthven

    Kritische Anmerkun- gen zur neueren und neuesten Wörterbuchforschung. Lexicographica 17: 217-248. Wiegand, Herbert Ernst. 2001a. Sprachkontaktwörterbücher, Typen, Funktionen, Strukturen. Igla,. Birgit, Pavel Petkov und Herbert Ernst Wiegand (Hrsg.). 2001. Theoretische und praktische. Probleme der Lexikographie.

  15. Integrative Cardiac Health Project

    Science.gov (United States)

    2014-10-01

    Postprandial dietary lipid -specific effects on human peripheral blood mononuclear cell gene expression profiles. Am J Clin Nutr. 2010;91:208–217. 20...PI – COL Robert Vigersky, Diabetes Institute). Status: Task #7: Continue study entitled “ Metabolic and Biomolecular Biology Study Studies in...function, including cytokine production, carbohydrate metabolism , and steroid hormones. Prescription medications did not significantly affect changes

  16. Body composition, disordered eating and menstrual regularity in a ...

    African Journals Online (AJOL)

    Of the total group 2.17% had primary amenorrhea, 21.74% secondary amenorrhoea and 8.70% oligomenorrhoea. Of all the athletes, 10.7% used oral contraceptives to regulate their menstrual cycles. There was a low risk for disordered eating amongst all the athletes even though 28% reported a history of eating binges, 9% ...

  17. New approach of data mining from the complex impedance plane: parameters you have always wanted to have

    Czech Academy of Sciences Publication Activity Database

    Macák, J. M.; Patil, D. S.; Fraenkl, M.; Zima, Vítězslav; Shimakawa, K.; Wágner, T.

    2014-01-01

    Roč. 61, č. 1 (2014), s. 217-221 ISSN 1938-5862. [ECS Meeting /225./. Orlando , 11.05.2014-15.05.2014] Institutional support: RVO:61389013 Keywords : impedance * random-walk approach * conductivity Subject RIV: CA - Inorganic Chemistry

  18. Structural dynamic modifications via models

    Indian Academy of Sciences (India)

    2nd Int. Modal Analysis Conference (Orlando) 2: 930±936. Natke H G (ed.) 1982 Identification of vibrating structures (New York: Springer Verlag, Wein). Rao S S 1989 Optimum design of structures under shock and vibration environment. Shock Vibr. Dig. 21(7):. Ravi S S A 1994 Structural dynamic modifications and design ...

  19. Ideas. Innovation. Impact.

    International Development Research Centre (IDRC) Digital Library (Canada)

    A BRIEF HISTORY. Ideas. Innovation. Impact. SINCE 1970. 12,828 research activities funded. $2.8 billion in grants provided. 4,217 recipient institutions involved. 4,000+ ... communications linking the people of Mongolia. A smooth transition from apartheid ... and communication technologies for development, to name a few.

  20. Enhanced lipase production by mutation induced Aspergillus ...

    African Journals Online (AJOL)

    ... the HNO2 mutant (AHN3) and 217% higher than the UV mutant (AUV3) and 276% higher lipase activity than the parent strain. The results indicated that UV, HNO2 and NTG treatment were effective physical and chemical mutagenic agents for strain improvement of Aspergillus japonicus for enhanced lipase productivity.

  1. Prognostic value of an electrocardiogram at rest and exercise test in patients admitted with suspected acute myocardial infarction, in whom the diagnosis is not confirmed

    DEFF Research Database (Denmark)

    Madsen, J K; Hommel, E; Hansen, J F

    1987-01-01

    The prognosis following discharge in 217 patients admitted with suspected acute myocardial infarction (AMI) due to chest pain, but in whom AMI was not confirmed, was related to the electrocardiogram (ECG) at rest and a symptom-limited exercise test. The patients were followed for 12 to 24 months...

  2. Hazardous Waste Cleanup: IBM Corporation-TJ Watson Research Center in Yorktown Heights, New York

    Science.gov (United States)

    IBM Corporation -TJ Watson Research Center is located in southern Yorktown near the boundary separating the Town of Yorktown from the Town of New Castle. The site occupies an area of approximately 217 acres and adjoins land uses are predominantly residenti

  3. Motorcycle limb injuries in a developing Country | Oluwadiya | West ...

    African Journals Online (AJOL)

    42.2% were due to collision with automobiles, 22% pedestrian while 8.7% were collisions between motorcycles. The use of protective/safety devices was practically non-existent. Seventy-six (66.1%) patients had lower limbs injuries, 25 (21.7%) patients had upper limb injuries while the remaining 14 (12.2%) injured both ...

  4. 77 FR 73662 - Disease, Disability, and Injury Prevention and Control Special Emphasis Panel (SEP): Initial Review

    Science.gov (United States)

    2012-12-11

    ... announced below concerns Occupational Safety and Health Education and Research Centers (ERC) PAR 10-217...). 8:00 a.m.-12:00 p.m., February 28, 2013 (Closed). Place: Renaissance Atlanta Midtown Hotel, 866 W... evaluation of applications received in response to ``Occupational Safety and Health Education and Research...

  5. 1927-IJBCS-Article-Abdou Maman Mansour

    African Journals Online (AJOL)

    hp

    Landwirtschaft und. Veterinaermedizin, 28: 217–229. Isaac ME, Harmand JM, Lesueur D, Lelon J. 2011. Tree age and soil phosphorus conditions influence N2 fixation rates and soil N dynamics in natural populations of. Acacia senegal. Forest Ecology and. Management, 261: 582-588. Jaiyeoba IA. 1996. Amelioration of ...

  6. Technologie sumerských staveb

    Czech Academy of Sciences Publication Activity Database

    Hanzlíček, Tomáš; Straka, Pavel

    82(133), č. 4 (2003), s. 217-218 ISSN 0042-4544 R&D Projects: GA AV ČR IBS3046004 Institutional research plan: CEZ:AV0Z3046908 Keywords : Sumer * technology of building s Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  7. Social and cultural issues in genetic counselling

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 40; Issue 2. Social and cultural issues in genetic counselling. Meenakshi Bhat. Perspectives Volume 40 Issue 2 June 2015 pp 217-220. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/jbsc/040/02/0217-0220. Keywords. Genetic ...

  8. Substrate evokes translocation of both domains in the mitochondrial processing peptidase alfa-subunit during which the C-terminus acts as a stabilizing element

    Czech Academy of Sciences Publication Activity Database

    Janata, Jiří; Holá, Klára; Kubala, Martin; Gakh, A.; Parkhomenko, Natalia; Matušková, Anna; Kutejová, E.; Amler, Evžen

    2004-01-01

    Roč. 316, - (2004), s. 211-217 ISSN 0006-291X R&D Projects: GA ČR GA204/01/1001 Institutional research plan: CEZ:AV0Z5020903 Keywords : metallopeptidase * mitochondria * mitochondrial processing peptidase Subject RIV: EE - Microbiology, Virology Impact factor: 2.904, year: 2004

  9. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R.S.; Noronha, R.J.; Fondekar, S.P.; SenGupta, R.

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  10. Flavivirus methyltransferase as target for virus treatment

    Czech Academy of Sciences Publication Activity Database

    Krafčíková, Petra; Chalupská, Dominika; Hercík, Kamil; Nencka, Radim; Bouřa, Evžen

    2017-01-01

    Roč. 284, Suppl 1 (2017), s. 216-217 ISSN 1742-464X. [FEBS Congress /42./ From Molecules to Cells and Back. 10.09.2017-14.09.2017, Jerusalem] Institutional support: RVO:61388963 Keywords : flavivirus methyltransferase * antivirals Subject RIV: CE - Biochemistry

  11. Acute toxicity and histopathology of channel catfish fry exposed to peracetic acid

    Science.gov (United States)

    Channel catfish Ictalurus punctatus yolk-sac fry and swim-up fry were exposed to peracetic acid (PAA) for 48h in static toxicity bioassays at 23C. The test water was 217 and 126 mg/L (as CaCO3) total alkalinity and total hardness, respectively. Probit LC50 values were estimated with the trimmed Sp...

  12. Public sector procurement and black economic empowerment in ...

    African Journals Online (AJOL)

    South Africa's public sector procurement facility is envisaged as one of the key tools to remedy past injustices in that country in which blacks were disadvantaged. Section 217 of the country's Constitution makes express provision for a procurement policy providing for the preferential allocation of contracts and the ...

  13. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 165-170 Research Article. Microsatellite DNA typing for assessment of genetic variability in Tharparkar breed of Indian zebu (Bos indicus) cattle, a major breed of Rajasthan .... pp 217-220 Research Note. Single-nucleotide polymorphisms in the B7H3 gene are not associated with human autoimmune myasthenia gravis.

  14. Assessment of magmatic vs. metasomatic processes in rare-metal granites: A case study of the Cínovec/Zinnwald Sn–W–Li deposit, Central Europe

    Czech Academy of Sciences Publication Activity Database

    Breiter, Karel; Ďurišová, Jana; Hrstka, Tomáš; Korbelová, Zuzana; Hložková Vaňková, M.; Vašinová Galiová, M.; Kanický, V.; Rambousek, P.; Knésl, I.; Dobeš, P.; Dosbaba, M.

    292/293, November (2017), s. 198-217 ISSN 0024-4937 R&D Projects: GA ČR GA14-13600S Institutional support: RVO:67985831 Keywords : rare-metal granite * Cínovec/Zinnwald deposit * rock textures * metasomatic processes * magmatic processes Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

  15. International Journal of Health Research - Vol 3, No 4 (2010)

    African Journals Online (AJOL)

    Phytochemical, Proximate and Metal Content Analysis of the Leaves of Psidium guajava Linn (Myrtaceae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. LO Okunrobo, KE Imafidon, AA Alabi, 217-221. http://dx.doi.org/10.4314/ijhr.v3i4.70426 ...

  16. Investigation of uptake, translocation and fate of trichloroacetic acid in Norway spruce (Picea abies/L./Karst.) using 14C-labelling

    Czech Academy of Sciences Publication Activity Database

    Matucha, Miroslav; Uhlířová, H.; Bubner, M.

    2001-01-01

    Roč. 44, č. 2 (2001), s. 217-222 ISSN 0045-6535 R&D Projects: GA ČR GA522/99/1465 Institutional research plan: CEZ:AV0Z5038910 Keywords : Secondary air pollutants * Forest decline * Conifers Subject RIV: EF - Botanics Impact factor: 1.181, year: 2001

  17. Correlates of Early Alcohol and Drug Use in Hispanic Adolescents: Examining the Role of ADHD with Comorbid Conduct Disorder, Family, School, and Peers

    Science.gov (United States)

    Lopez, Barbara; Schwartz, Seth J.; Prado, Guillermo; Huang, Shi; Rothe, Eugenio M.; Wang, Wei; Pantin, Hilda

    2008-01-01

    This study examined correlates of early adolescent alcohol and drug use in a community sample of 217 eighth-grade adolescents with behavior problems and from Hispanic/Latino immigrant families. Structural equation modeling was used to examine relationships of multiple contexts (e.g., family, school, and peers) to alcohol and drug use. Results…

  18. 77 FR 18651 - Qualifying Urban Areas for the 2010 Census

    Science.gov (United States)

    2012-03-27

    ... Beulah, ND 2,949 Bicknell, IN 3,217 Big Bear City, CA 15,873 Big Lake, TX 2,919 Big Pine Key, FL 7,540...,514 Dunlap, TN 3,691 Dunn, NC 14,823 Durand, MI 4,854 Durango, CO 17,982 Durant, MS 2,525 Durant, OK...

  19. Single Electrode Heat Effects

    DEFF Research Database (Denmark)

    Jacobsen, Torben; Broers, G. H. J.

    1977-01-01

    Standard Peltier entropies for the reactions in molten carbonate paste electrolytes at 1000°K have been determined fromthermogalvanic measurements. The results are –217 and –118 J/mole°K,respectively. No dependence on electrolyte composition is observed. The reversiblepart of the Peltier entropy...

  20. Chaos and stability of age-0 fish assemblages in a temperate deep reservoir: unpredictable success and stable habitat use

    Czech Academy of Sciences Publication Activity Database

    Jůza, Tomáš; Vašek, Mojmír; Kratochvíl, Michal; Blabolil, Petr; Čech, Martin; Draštík, Vladislav; Frouzová, Jaroslava; Muška, Milan; Peterka, Jiří; Prchalová, Marie; Říha, Milan; Tušer, Michal; Kubečka, Jan

    2014-01-01

    Roč. 724, č. 1 (2014), s. 217-234 ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : horizontal migration * Římov reservoir * trawling * seining * fry distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014

  1. Growth, biochemical and enzymatic responses of thermal cynobacterium Gloeocapsa sp. (Cyanophyceae) to temperature and irradiance

    Czech Academy of Sciences Publication Activity Database

    Gacheva, G. V.; Gigova, L. G.; Ivanova, N. Y.; Pilarski, P. S.; Lukavský, Jaromír

    2013-01-01

    Roč. 61, č. 3 (2013), s. 217-227 ISSN 1322-0829 R&D Projects: GA TA ČR TE01020080 Institutional support: RVO:67985939 Keywords : antioxidant enzymes * Gloeocapsa * temperature, light Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.955, year: 2013

  2. Crayfish in Czech cultural space: the longest documented relationship between humans and crayfish in Europe

    Czech Academy of Sciences Publication Activity Database

    Patoka, J.; Kocánová, Barbora; Kalous, L.

    2016-01-01

    Roč. 417, č. 5 (2016), s. 1-9 ISSN 1961-9502 Institutional support: RVO:67985955 Keywords : Freshwater invertebrate * exploitation * history * aquaculture * Czech Republic Subject RIV: AB - History Impact factor: 1.217, year: 2016 https://www.kmae-journal.org/articles/kmae/full_html/2016/01/kmae150112/kmae150112.html

  3. Midinfrared optical parametric oscillator based on the wide-bandgap BaGa4S7 nonlinear crystal.

    Science.gov (United States)

    Tyazhev, Aleksey; Kolker, Dmitri; Marchev, Georgi; Badikov, Valeriy; Badikov, Dmitrii; Shevyrdyaeva, Galina; Panyutin, Vladimir; Petrov, Valentin

    2012-10-01

    The orthorhombic biaxial crystal BaGa(4)S(7) has been employed in a 1064 nm pumped optical parametric oscillator generating 217 μm and average power of ~50 mW at 100 Hz. Notwithstanding the relatively low nonlinearity, ~3 times above threshold operation has been achieved at pump intensities more than 5 times below the crystal surface damage limit.

  4. 385-IJBCS-Aticle- Odin E M

    African Journals Online (AJOL)

    DR GATSING

    Escherichia coli, 1.53 μg/ml against. Citrobacter species and 2.17 μg/ml against salmonella species. This table also revealed compounds 3e to be a more active drug on pseudomonas species, shigella species,. Escherichia coli, Salmonella species and. Citrobecter species than the standard antibiotic, streptomycin SO4.

  5. On the shear-thinning and viscoelastic effects of blood flow under various flow rates

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš; Sequeira, A.; Prosi, M.

    2011-01-01

    Roč. 217, č. 11 (2011), s. 5055-5067 ISSN 0096-3003 Institutional research plan: CEZ:AV0Z20760514 Keywords : non-Newtonian * viscoelastic * Oldroyd-B * finite-volume * blood flow Subject RIV: BK - Fluid Dynamics Impact factor: 1.317, year: 2011 http://www.sciencedirect.com/science/article/pii/S009630031000799X

  6. Organization of Hospital Nursing, Provision of Nursing Care, and Patient Experiences with Care in Europe

    NARCIS (Netherlands)

    L. Bruyneel (Luk); B. Li (Baoyue); D. Ausserhofer (Dietmar); E.M.E.H. Lesaffre (Emmanuel); I. Dumitrescu (Irina); H.L. Smith (Herbert L.); D.M. Sloane (Douglas M.); L.H. Aiken (Linda); W. Sermeus (Walter)

    2015-01-01

    textabstractThis study integrates previously isolated findings of nursing outcomes research into an explanatory framework in which care left undone and nurse education levels are of key importance. A moderated mediation analysis of survey data from 11,549 patients and 10,733 nurses in 217 hospitals

  7. Phosphatidic acid produced by phospholipase D is required for tobacco pollen tube growth

    Czech Academy of Sciences Publication Activity Database

    Potocký, Martin; Eliáš, M.; Profotová, Bronislava; Novotná, Z.; Valentová, O.; Žárský, Viktor

    2003-01-01

    Roč. 217, č. 1 (2003), s. 122-130 ISSN 0032-0935 R&D Projects: GA MŠk LN00A081 Institutional research plan: CEZ:AV0Z5038910 Keywords : Phospholipase D * Phosphatidic acid * Pollen tube growth Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.053, year: 2003

  8. Occupational Gender Stereotypes and Problem-Solving in Italian Adolescents

    Science.gov (United States)

    Ginevra, Maria Cristina; Nota, Laura

    2017-01-01

    The first purpose of the study was to establish how Italian adolescents perceive jobs in the newly emerging economy sectors as well as more traditional jobs from gender-stereotyped and gender-segregated perspectives. The second purpose was to verify the role of problem-solving and gender in gender-role stereotyping. A total of 217 Italian high…

  9. Ethik der Technik als Ausgangspunkt für die Praxis der Technikfolgenbeurteilung in Deutschland und in Tschechien

    Czech Academy of Sciences Publication Activity Database

    Machleidt, Petr

    2009-01-01

    Roč. 31, 3-4 (2009), s. 217-241 ISSN 1210-0250 R&D Projects: GA AV ČR(CZ) IAA900090803 Institutional research plan: CEZ:AV0Z90090514 Keywords : ethics of technology * technology assessment Subject RIV: AA - Philosophy ; Religion

  10. Differences in injury risk and characteristics between Dutch amateur and professional soccer players

    NARCIS (Netherlands)

    Beijsterveldt, A.M.C. van; Stubbe, J.H.; Schmikli, S.L.; Port, I.G.L. van de; Backx, F.J.G.

    2015-01-01

    Objectives: To compare the incidence and characteristics of injuries between Dutch amateur and professional male soccer players during one entire competition season. Design: A prospective two-cohort design. Methods: During the 2009-2010 season, 456 Dutch male amateur soccer players and 217

  11. Cloning of chicken 11beta-hydroxysteroid dehydrogenase type 1 and its tissue distribution

    Czech Academy of Sciences Publication Activity Database

    Klusoňová, Petra; Kučka, Marek; Ergang, Peter; Mikšík, Ivan; Bryndová, Jana; Pácha, Jiří

    2008-01-01

    Roč. 111, 3-5 (2008), s. 217-224 ISSN 0960-0760 R&D Projects: GA AV ČR IAA6011201 Institutional research plan: CEZ:AV0Z50110509 Keywords : chi cken * corticosterone * 11HSD1 Subject RIV: CE - Biochemistry Impact factor: 2.827, year: 2008

  12. Diagnostic Value of Serial Measurement of C-Reactive Protein in the Detection of a Surgical Complication after Laparoscopic Bowel Resection for Endometriosis

    DEFF Research Database (Denmark)

    Riiskjær, Mads; Forman, Axel; Kesmodel, Ulrik Schiøler

    2016-01-01

    endometriosis. METHODS: This is a review of prospectively collected data from 217 patients who underwent laparoscopic bowel resection for endometriosis from January 2009 to April 2015. Patients with an anastomotic leakage or ureteral injury were identified and classified. RESULTS: The frequency of anastomotic...... subsequent postoperative course. The test is recommended when early discharge after rectal resection for deep infiltrating endometriosis is considered....

  13. ISSN 2073-9990 East Cent. Afr. J. surg

    African Journals Online (AJOL)

    Valued eMachines Customer

    Good 39.1%, Fair 10 (21.7%) and Poor 4.3%. ... fractures on the same limb, patients presenting with bilateral supracondylar humerus fractures, ... presentation. Dua A. et al.12 reported the long distance to be the reason of delayed presentation to the hospital and it relates to our study findings where the mean of distance the ...

  14. Revenue and efficiency in multi-unit uniform-price auctions

    Czech Academy of Sciences Publication Activity Database

    Břeský, Michal

    2013-01-01

    Roč. 82, November (2013), s. 205-217 ISSN 0899-8256 R&D Projects: GA ČR(CZ) GAP402/11/1531 Institutional support: RVO:67985998 Keywords : multi-unit auction * multiple-object auction * market efficiency Subject RIV: AH - Economics Impact factor: 1.025, year: 2013

  15. Preparation and photocatalytic activity of rare earth doped TiO2 nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Bakardjieva, Snejana; Murafa, Nataliya

    2009-01-01

    Roč. 114, č. 1 (2009), s. 217-226 ISSN 0254-0584 Institutional research plan: CEZ:AV0Z40320502 Keywords : anatase * urea * rare earth Subject RIV: CA - Inorganic Chemistry Impact factor: 2.015, year: 2009

  16. Protein involvement in the fusion between the equatorial segment of acrosome-reacted human spermatozoa and liposomes

    NARCIS (Netherlands)

    Arts, EGJM; Wijchman, JG; Jager, S; Hoekstra, D

    1997-01-01

    Artificial membranes (liposomes) can interact with the equatorial segment (ES) of human spermatozoa, provided that the acrosome reaction (AR) has occurred [Arts, Kuiken, Jager and Hoekstra (1993) fur. J. Biochem. 217, 1001-1009]. Using fluorescently labelled liposomes, this interaction can be seen

  17. Association between renal function and cardiovascular structure and function in heart failure with preserved ejection fraction

    NARCIS (Netherlands)

    Gori, Mauro; Senni, Michele; Gupta, Deepak K.; Charytan, David M.; Kraigher-Krainer, Elisabeth; Pieske, Burkert; Claggett, Brian; Shah, Amil M.; Santos, Angela B. S.; Zile, Michael R.; Voors, Adriaan A.; McMurray, John J. V.; Packer, Milton; Bransford, Toni; Lefkowitz, Martin; Solomon, Scott D.

    2014-01-01

    Aim Renal dysfunction is a common comorbidity in patients with heart failure and preserved ejection fraction (HFpEF). We sought to determine whether renal dysfunction was associated with measures of cardiovascular structure/function in patients with HFpEF. Methods We studied 217 participants from

  18. Income taxes and benefits among Czech employees: Changes since 1989 and cross-national comparison

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2006-01-01

    Roč. 56, 1-2 (2006), s. 2-17 ISSN 0015-1920 Grant - others:Global Development Network(IN) GDN RRC V-37 Institutional research plan: CEZ:AV0Z70280505 Keywords : income tax * Czech Republic * social benefits Subject RIV: AO - Sociology, Demography Impact factor: 0.190, year: 2006

  19. A Resurgence in Field Research is Essential to Better Understand the Diversity, Ecology, and Evolution of Microbial Eukaryotes

    Czech Academy of Sciences Publication Activity Database

    Heger, T.J.; Edgcomb, V.P.; Kim, E.; Lukeš, Julius; Leander, B. S.; Yubuki, N.

    2014-01-01

    Roč. 61, č. 2 (2014), s. 214-223 ISSN 1066-5234 Institutional support: RVO:60077344 Keywords : Algae * culture * food webs * microscopy * molecular phylogenetics * next-generation sequencing * protist Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.217, year: 2014

  20. 75 FR 14163 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2010-03-24

    ... teachers impacted by the outbreak. Illness among school-aged students (K-12) in many States and cities... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention [30Day-10-10AD... that impacted at least 824,966 students and 53,217 teachers. Although a system was put in place to...