International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.216 Mitigation. (a) The...
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
Monitoring plan for borehole logging at 216-Z-1A Tile Field, 216-Z-9 Trench, and 216-Z-12 Crib
International Nuclear Information System (INIS)
Horton, D.G.
1998-04-01
This plan describes the fiscal year 1998 vadose monitoring of three inactive, liquid waste disposal facilities associated with the Plutonium Finishing Plant (Z-Plant): the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib. Monitoring will consist of spectral gamma ray logging of 21 boreholes. This plan describes the physical characteristics of the facilities, their operational histories, the subsurface geology and known contamination distribution at each facility. The plan then describes the specific monitoring to be done including the boreholes to be logged, the methods of data acquisition, data reduction, and data evaluation, and finally, the quality control, data management and data reporting for this effort. The three liquid waste disposal facilities at the Z Plant were chosen to be monitored because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford vadose zone. Johnson's analysis was based on the relative hazard obtained by combining curie quantities disposed to the facilities with appropriate health risk standards. The basic question to be addressed by this logging activity addresses the configuration of subsurface contamination since it was last measured. Historical data from the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib form the baseline for comparisons to answer this question
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Introduction. 216.1 Section 216.1 Energy DEPARTMENT OF ENERGY OIL MATERIALS ALLOCATION AND PRIORITY PERFORMANCE UNDER CONTRACTS OR ORDERS TO MAXIMIZE DOMESTIC ENERGY SUPPLIES § 216.1 Introduction. (a) This part describes and establishes the procedures to be used...
Mincione, Gabriella; Di Marcantonio, Maria Carmela; Tarantelli, Chiara; Savino, Luca; Ponti, Donatella; Marchisio, Marco; Lanuti, Paola; Sancilio, Silvia; Calogero, Antonella; Di Pietro, Roberta; Muraro, Raffaella
2016-01-01
Epidermal Growth Factor Receptor (EGFR), a member of the ErbB family of receptor tyrosine kinase (RTK) proteins, is aberrantly expressed or deregulated in tumors and plays pivotal roles in cancer onset and metastatic progression. ZNF216 gene has been identified as one of Immediate Early Genes (IEGs) induced by RTKs. Overexpression of ZNF216 protein sensitizes 293 cell line to TNF-α induced apoptosis. However, ZNF216 overexpression has been reported in medulloblastomas and metastatic nasopharyngeal carcinomas. Thus, the role of this protein is still not clearly understood. In this study, the inverse correlation between EGFR and ZNF216 expression was confirmed in various human cancer cell lines differently expressing EGFR. EGF treatment of NIH3T3 cells overexpressing both EGFR and ZNF216 (NIH3T3-EGFR/ZNF216), induced a long lasting activation of EGFR in the cytosolic fraction and an accumulation of phosphorylated EGFR (pEGFR) more in the nuclear than in the cytosolic fraction compared to NIH3T3-EGFR cells. Moreover, EGF was able to stimulate an increased expression of ZNF216 in the cytosolic compartment and its nuclear translocation in a time-dependent manner in NIH3T3-EGFR/ZNF216. A similar trend was observed in A431 cells endogenously expressing the EGFR and transfected with Znf216. The increased levels of pEGFR and ZNF216 in the nuclear fraction of NIH3T3-EGFR/ZNF216 cells were paralleled by increased levels of phospho-MAPK and phospho-Akt. Surprisingly, EGF treatment of NIH3T3-EGFR/ZNF216 cells induced a significant increase of apoptosis thus indicating that ZNF216 could sensitize cells to EGF-induced apoptosis and suggesting that it may be involved in the regulation and effects of EGFR signaling. PMID:27732953
2010-10-01
... hazard of death or injury to persons, or has caused death or injury, a penalty not to exceed $100,000 per... 49 Transportation 4 2010-10-01 2010-10-01 false Penalties. 216.7 Section 216.7 Transportation... § 216.7 Penalties. Any person (an entity of any type covered under 1 U.S.C. 1, including but not limited...
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
216-T-4 interim stabilization final report
International Nuclear Information System (INIS)
Smith, D.L.
1996-01-01
This report provides a general description of the activities performed for the interim stabilization of the 216-T-4-1 ditch, 216-T-4-2 ditch, and 216-T-4-2 pond. Interim stabilization was required to reduce the amount of surface-contaminated acres and to minimize the migration of radioactive contamination. Work associated with the 216-T4-1 ditch and 216-T-4-2 pond was performed by the Radiation Area Remedial Action (RARA) Project. Work associated with the 216-T-4-2 ditch was done concurrently but was funded by Westinghouse Hanford Company (WHC) Tank Waste Remediation Systems (TWRS)
50 CFR 216.86 - Local regulations.
2010-10-01
... Pribilof Islands Administration § 216.86 Local regulations. Local regulations will be published from time... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Local regulations. 216.86 Section 216.86 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...
50 CFR 216.87 - Wildlife research.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Wildlife research. 216.87 Section 216.87 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Pribilof Islands Administration § 216.87 Wildlife research. (a) Wildlife research, other than research on...
48 CFR 216.603-2 - Application.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Application. 216.603-2 Section 216.603-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM...-Hour, and Letter Contracts 216.603-2 Application. (c)(3) In accordance with 10 U.S.C. 2326, establish...
22 CFR 216.5 - Endangered species.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Endangered species. 216.5 Section 216.5 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.5 Endangered species. It is A... endangered or threatened species and their critical habitats. The Initial Environmental Examination for each...
22 CFR 216.8 - Public hearings.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public hearings. 216.8 Section 216.8 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.8 Public hearings. (a) In most instances AID will be able to gain the benefit of public participation in the impact statement process...
50 CFR 216.42 - Photography. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Photography. [Reserved] 216.42 Section 216.42 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Special Exceptions § 216.42...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.216 Section 28.216 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.216...
50 CFR 216.82 - Dogs prohibited.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dogs prohibited. 216.82 Section 216.82... Pribilof Islands Administration § 216.82 Dogs prohibited. In order to prevent molestation of fur seal herds, the landing of any dogs at Pribilof Islands is prohibited. [41 FR 49488, Nov. 9, 1976. Redesignated at...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Privacy Act. 0.216 Section 0.216... RULES OF CONDUCT Rules of Conduct § 0.216 Privacy Act. Employees involved in the design, development, operation, or maintenance of any system of records or in maintaining records subject to the Privacy Act of...
25 CFR 216.8 - Performance bond.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Performance bond. 216.8 Section 216.8 Indians BUREAU OF... RECLAMATION OF LANDS General Provisions § 216.8 Performance bond. (a) Upon approval of an exploration plan or mining plan, the operator shall be required to file a suitable performance bond of not less than $2,000...
22 CFR 216.10 - Records and reports.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Records and reports. 216.10 Section 216.10 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.10 Records and... statements, Determinations and Declarations which will be available to the public under the Freedom of...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Notice. 93.216 Section 93.216 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 216.184 Section 216.184 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... the coast from 47°07′ N. to 48°30′ N. latitude December January, March and May. (9) Flower Garden...
50 CFR 216.253 - Prohibitions.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.253... shall: (a) Take any marine mammal not specified in § 216.250(b); (b) Take any marine mammal specified in...
48 CFR 216.470 - Other applications of award fees.
2010-10-01
... award fees. 216.470 Section 216.470 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contracts 216.470 Other applications of award fees. See PGI 216.470 for guidance on other applications of award fees. [71 FR 39008, July 11, 2006] ...
48 CFR 216.405 - Cost-reimbursement incentive contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-reimbursement incentive contracts. 216.405 Section 216.405 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contracts 216.405 Cost-reimbursement incentive contracts. ...
42 CFR 2.16 - Security for written records.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Security for written records. 2.16 Section 2.16 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.16 Security for written records...
29 CFR 553.216 - Other exemptions.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Other exemptions. 553.216 Section 553.216 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE FAIR LABOR STANDARDS ACT TO EMPLOYEES OF STATE AND LOCAL GOVERNMENTS Fire Protection and Law...
10 CFR 216.7 - Conflict in priority orders.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Conflict in priority orders. 216.7 Section 216.7 Energy... DOMESTIC ENERGY SUPPLIES § 216.7 Conflict in priority orders. If it appears that the use of assistance pursuant to DPA section 101(c) creates or threatens to create a conflict with priorities and allocation...
Addiction-Related Effects of DOV 216,303 and Cocaine
DEFF Research Database (Denmark)
Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T
2014-01-01
DOV 216,303, an inhibitor of serotonin, noradrenaline and dopamine reuptake, belongs to a new line of drugs called 'triple reuptake inhibitors' that have been proposed for treatment of depression. The addictive drug cocaine has similar mechanism of action and exerts rewarding effects by blocking...... of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis......, and we measured monoamine receptor occupancy as well as brain and plasma exposure. DOV 216,303 was self-administered acutely in the same dose range as cocaine. However, in the CPP model, DOV 216,303 did not induce place preference at doses where cocaine caused place preference. Higher doses of DOV 216...
9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...
International Nuclear Information System (INIS)
Horton, D.G.; Randall, R.R.
1998-09-01
This document describes the results of fiscal year 1998 vadose zone monitoring of three inactive liquid waste disposal facilities associated with the Plutonium Finishing Plant: the 216-Z-1A tile field, the 216-Z-9 trench, and the 216-Z-12 crib. Monitoring consisted of spectral gamma-ray logging of 21 boreholes. This work was performed by Pacific Northwest National Laboratory in conjunction with Three Rivers Scientific and Waste management Federal Services, inc. Northwest Operations. These three liquid waste disposal facilities were chosen for monitoring because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford Site vadose zone. The basic question addressed by this logging activity is ''Has the configuration of subsurface contamination changed since it was last measured?'' Previous borehole logging and laboratory analyses provide the baseline data to help answer this question
50 CFR 216.83 - Importation of birds or mammals.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Importation of birds or mammals. 216.83 Section 216.83 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... MAMMALS Pribilof Islands Administration § 216.83 Importation of birds or mammals. No mammals or birds...
17 CFR 256.216 - Unappropriated retained earnings.
2010-04-01
... retained earnings. This account shall include the balance, either debit or credit, arising from earnings... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Unappropriated retained earnings. 256.216 Section 256.216 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...
48 CFR 452.216-74 - Ceiling Price.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Ceiling Price. 452.216-74... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-74 Ceiling Price. As prescribed in 416.670, insert the following clause: Ceiling Price (FEB 1988) The ceiling price of this...
Combination RCRA groundwater monitoring plan for the 216-A-10, 216-A-36B, and 216-A-37-1 PUREX cribs
International Nuclear Information System (INIS)
Lindberg, J.W.
1997-06-01
This document presents a groundwater quality assessment monitoring plan, under Resource Conservation and Recovery Act of 1976 (RCRA) regulatory requirements for three RCRA sites in the Hanford Site's 200 East Area: 216-A-10, 216-A-36B, and 216-A-37-1 cribs (PUREX cribs). The objectives of this monitoring plan are to combine the three facilities into one groundwater quality assessment program and to assess the nature, extent, and rate of contaminant migration from these facilities. A groundwater quality assessment plan is proposed because at least one downgradient well in the existing monitoring well networks has concentrations of groundwater constituents indicating that the facilities have contributed to groundwater contamination. The proposed combined groundwater monitoring well network includes 11 existing near-field wells to monitor contamination in the aquifer in the immediate vicinity of the PUREX cribs. Because groundwater contamination from these cribs is known to have migrated as far away as the 300 Area (more than 25 km from the PUREX cribs), the plan proposes to use results of groundwater analyses from 57 additional wells monitored to meet environmental monitoring requirements of US Department of Energy Order 5400.1 to supplement the near-field data. Assessments of data collected from these wells will help with a future decision of whether additional wells are needed
48 CFR 452.216-70 - Award Fee.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Award Fee. 452.216-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-70 Award Fee. As prescribed in 416.405, insert a clause substantially as follows: Award Fee (FEB 1988) The amount of award fee...
48 CFR 1352.216-77 - Ceiling price.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Ceiling price. 1352.216-77... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.216-77 Ceiling price. As prescribed in 48 CFR 1316.601-70 and 1316.602-70, insert the following clause: Ceiling Price (APR 2010) The...
50 CFR 216.107 - Incidental harassment authorization for Arctic waters.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Incidental harassment authorization for Arctic waters. 216.107 Section 216.107 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL... Incidental to Specified Activities § 216.107 Incidental harassment authorization for Arctic waters. (a...
38 CFR 3.216 - Mandatory disclosure of social security numbers.
2010-07-01
... social security numbers. 3.216 Section 3.216 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF... Requirements § 3.216 Mandatory disclosure of social security numbers. Any person who applies for or receives..., furnish the Department of Veterans Affairs upon request with his or her social security number and the...
48 CFR 52.216-16 - Incentive Price Revision-Firm Target.
2010-10-01
...-Firm Target. 52.216-16 Section 52.216-16 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.216-16 Incentive Price Revision—Firm Target. As prescribed in 16.406(a), insert the following clause: Incentive Price Revision—Firm Target (OCT 1997) (a) General. The supplies or services identified...
50 CFR 216.41 - Permits for scientific research and enhancement.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Permits for scientific research and... AND IMPORTING OF MARINE MAMMALS Special Exceptions § 216.41 Permits for scientific research and enhancement. In addition to the requirements under §§ 216.33 through 216.38, permits for scientific research...
29 CFR 1952.216 - Where the plan may be inspected.
2010-07-01
... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.216 Section 1952.216..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Maryland § 1952.216...
27 CFR 40.216 - Notice for smokeless tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for smokeless tobacco. 40.216 Section 40.216 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...
48 CFR 216.104-70 - Research and development.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Research and development... Contract Types § 216.104-70 Research and development. Follow the procedures at PGI 216.104-70 for selecting the appropriate research and development contract type. [71 FR 39007, July 11, 2006] ...
216-U-10 Pond and 216-Z-19 Ditch characterization studies
Energy Technology Data Exchange (ETDEWEB)
Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.
1994-02-01
The chemical, reprocessing of spent nuclear fuels at the US Department of Energy`s Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments.
216-U-10 Pond and 216-Z-19 Ditch characterization studies
International Nuclear Information System (INIS)
Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.
1994-02-01
The chemical, reprocessing of spent nuclear fuels at the US Department of Energy's Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments
48 CFR 216.203 - Fixed-price contracts with economic price adjustment.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Fixed-price contracts with economic price adjustment. 216.203 Section 216.203 Federal Acquisition Regulations System DEFENSE... CONTRACTS Fixed-Price Contracts 216.203 Fixed-price contracts with economic price adjustment. ...
Addiction-Related Effects of DOV 216,303 and Cocaine
DEFF Research Database (Denmark)
Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T
2014-01-01
DOV 216,303, an inhibitor of serotonin, noradrenaline and dopamine reuptake, belongs to a new line of drugs called 'triple reuptake inhibitors' that have been proposed for treatment of depression. The addictive drug cocaine has similar mechanism of action and exerts rewarding effects by blocking...... reuptake of dopamine, leading to increased extracellular concentrations of dopamine in the nucleus accumbens. Thus, DOV 216,303 and other triple reuptake inhibitors might be speculated to exhibit abuse potential, limiting their future therapeutic use. To further elucidate potential addictive properties...... of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis...
48 CFR 1852.216-78 - Firm fixed price.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Firm fixed price. 1852.216... 1852.216-78 Firm fixed price. As prescribed in 1816.202-70, insert the following clause: Firm Fixed Price (DEC 1988) The total firm fixed price of this contract is $[Insert the appropriate amount]. (End...
25 CFR 216.6 - Approval of exploration plan.
2010-04-01
... control fire, soil erosion, pollution of surface and ground water, damage to fish and wildlife or other... 25 Indians 1 2010-04-01 2010-04-01 false Approval of exploration plan. 216.6 Section 216.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND...
12 CFR Appendix B to Part 216 - Sample Clauses
2010-01-01
... CONSUMER FINANCIAL INFORMATION (REGULATION P) Pt. 216, App. B Appendix B to Part 216—Sample Clauses Link to..., such as “call the following toll-free number: (insert number)”]. A-7—Confidentiality and security (all...
36 CFR 2.16 - Horses and pack animals.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Horses and pack animals. 2.16... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.16 Horses and pack animals. The following are prohibited: (a) The use of animals other than those designated as “pack animals” for purposes of transporting...
50 CFR 216.91 - Dolphin-safe labeling standards.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe labeling standards. 216.91... MAMMALS Dolphin Safe Tuna Labeling § 216.91 Dolphin-safe labeling standards. (a) It is a violation of... include on the label of those products the term “dolphin-safe” or any other term or symbol that claims or...
Diagnostic outcome of contrast videofluoroscopic swallowing studies in 216 dysphagic dogs.
Pollard, Rachel E; Marks, Stanley L; Cheney, Diane M; Bonadio, Cecily M
2017-07-01
Determining the anatomic and functional origin for dysphagia is critical for development of an appropriate therapeutic plan and determination of the prognosis. The purpose of this retrospective study was to report the quantitative and qualitative outcome of contrast videofluoroscopic swallowing studies in a large cohort of dysphagic dogs presenting to a tertiary veterinary care hospital. The videofluoroscopic swallowing studies were reviewed to generate values for pharyngeal constriction ratio, timing of swallowing events (maximum pharyngeal contraction, opening of upper esophageal sphincter, closing of upper esophageal sphincter, and reopening of epiglottis), type of esophageal peristalsis generated, and esophageal transit time. One or more anatomic locations for origin of dysphagia were assigned (pharyngeal, cricopharyngeal, esophageal (primary motility disorder), other esophageal (stricture, vascular ring anomaly, mass), lower esophageal sphincter/hiatus. Sixty-one of 216 studies (28%) were deemed unremarkable. Twenty-seven of 216 dogs (13%) had pharyngeal dysphagia, 17/216 dogs (8%) had cricopharyngeal dysphagia, 98/216 dogs (45%) had dysphagia secondary to esophageal dysmotility, 19/216 dogs (9%) had dysphagia secondary to focal esophageal disorders, and 97/216 dogs (45%) had dysphagia of lower esophageal sphincter/hiatus origin. Multiple abnormalities were present in 82/216 (38%) dogs. Elevated pharyngeal constriction ratio was associated with pharyngeal, cricopharyngeal, and esophageal motility disorders, delayed upper esophageal sphincter opening was associated with cricopharyngeal disorders, a lower percentage of primary esophageal peristaltic waves was associated with cricopharyngeal, pharyngeal, or primary esophageal motility disorders. In conclusion, videofluoroscopic swallowing studies was pivotal in the diagnosis of dysphagia with 155/216 (72%) dogs receiving a final diagnosis. © 2017 American College of Veterinary Radiology.
Radiopotentiation by the oral platinum agent, JM216: role of repair inhibition
International Nuclear Information System (INIS)
Amorino, George P.; Freeman, Michael L.; Carbone, David P.; Lebwohl, David E.; Choy, Hak
1999-01-01
Purpose: To test for in vitro radiopotentiation by the orally-administered platinum (IV) complex, JM216; to compare these results to cisplatin and carboplatin; and to investigate whether the mechanism of radiopotentiation involves repair inhibition of radiation-induced DNA damage. Methods and Materials: H460 human lung carcinoma cells were incubated with the drugs for 1 h at 37 deg. C, irradiated at room temperature, and returned to 37 deg. C for 20 min. Cells were then rinsed and colony forming ability was assessed. Wild-type V79 Chinese hamster cells and radiosensitive, DNA repair-deficient mutant cells (XR-V15B) were also studied along with H460 cells. Ku86 cDNA, which encodes part of a protein involved in DNA repair, was transfected into XR-V15B cells as previously described. The effect of JM216 on sublethal damage repair (SLDR) was also assessed using split-dose recovery. Results: Using equally cytotoxic doses of JM216, cisplatin, and carboplatin, the radiation dose enhancement ratios (DER) were 1.39, 1.31, and 1.20, respectively; the DER with 20 μM JM216 was 1.57. JM216 (20 μM) did not significantly change the final slope of radiation survival curves, but greatly reduced the survival curve shoulder. V79 cells also showed radioenhancement using 20 μM JM216, but no enhancement occurred using XR-V15B cells. Transfection of Ku86 cDNA into XR-V15B cells restored radiopotentiation by JM216 to wild-type V79 levels. In addition, 20 μM JM216 completely inhibited sublethal damage repair in H460 cells. Conclusion: Our results show that JM216 can potentiate the effects of radiation in human lung cancer cells, and that the mechanism of this effect is probably inhibition of DNA repair by JM216
27 CFR 40.216a - Notice for pipe tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for pipe tobacco. 40.216a Section 40.216a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...
48 CFR 1652.216-71 - Accounting and Allowable Cost.
2010-10-01
... of FEHBP Clauses 1652.216-71 Accounting and Allowable Cost. As prescribed in section 1616.7002, the...). Accounting and Allowable Cost (FEHBAR 1652.216-71) (JAN 2003) (a) Annual Accounting Statements. (1) The... addition, the Carrier must: (i) on request, document and make available accounting support for the cost to...
20 CFR 216.67 - “Child in care.”
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in care.â 216.67 Section 216.67 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT ELIGIBILITY FOR... used to establish eligibility for the tier II component of a female spouse or widow(er) annuity under...
20 CFR 802.216 - Service and form of papers.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Service and form of papers. 802.216 Section... Prereview Procedures Initial Processing § 802.216 Service and form of papers. (a) All papers filed with the...), date of signature, and certificate of service. (b) For each paper filed with the Board, the original...
12 CFR 216.2 - Model privacy form and examples.
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Model privacy form and examples. 216.2 Section... PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) § 216.2 Model privacy form and examples. (a... of this part, although use of the model privacy form is not required. (b) Examples. The examples in...
Swelling behavior of manganese-bearing AISI 216 steel
International Nuclear Information System (INIS)
Gelles, D.S.; Garner, F.A.
1984-01-01
The inclusion of 8.5 wt % manganese in AISI 216 does not appear to alter the swelling behavior from that found to be typical of austenitic alloys with comparable levels of other austentite-stabilizing elements. The swelling in AISI 216 in EBR-II is quite insensitive to irradiation temperature in the range 400-650 0 C. Microscopy reveals that this may arise from the low level of precipitation that occurs in the alloy
20 CFR 216.16 - What is regular non-railroad employment.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false What is regular non-railroad employment. 216.16 Section 216.16 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD... the United States Government: (i) Department of Transportation; (ii) Interstate Commerce Commission...
216-B-3 expansion ponds closure plan
International Nuclear Information System (INIS)
1994-10-01
This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA
216-B-3 expansion ponds closure plan
Energy Technology Data Exchange (ETDEWEB)
1994-10-01
This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.
25 CFR 216.4 - Technical examination of prospective surface exploration and mining operations.
2010-04-01
... mining sites and mining operations vary widely with respect to topography, climate, surrounding land uses... and mining operations. 216.4 Section 216.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF LANDS General Provisions § 216...
50 CFR 216.251 - Effective dates.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.251...
Crystal structure and functional characterization of SF216 from Shigella flexneri.
Kim, Ha-Neul; Seok, Seung-Hyeon; Lee, Yoo-Sup; Won, Hyung-Sik; Seo, Min-Duk
2017-11-01
Shigella flexneri is a Gram-negative anaerobic bacterium that causes highly infectious bacterial dysentery in humans. Here, we solved the crystal structure of SF216, a hypothetical protein from the S. flexneri 5a strain M90T, at 1.7 Å resolution. The crystal structure of SF216 represents a homotrimer stabilized by intersubunit interactions and ion-mediated electrostatic interactions. Each subunit consists of three β-strands and five α-helices with the β-β-β-α-α-α-α-α topology. Based on the structural information, we also demonstrate that SF216 shows weak ribonuclease activity by a fluorescence quenching assay. Furthermore, we identify potential druggable pockets (putative hot spots) on the surface of the SF216 structure by computational mapping. © 2017 Federation of European Biochemical Societies.
48 CFR 216.405-1 - Cost-plus-incentive-fee contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-incentive-fee... Contracts 216.405-1 Cost-plus-incentive-fee contracts. See PGI 216.405-1 for guidance on the use of cost-plus-incentive-fee contracts. [71 FR 39007, July 11, 2006] ...
50 CFR 216.214 - Prohibitions.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.214 Prohibitions. No...
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254... greatest extent practicable, adverse impacts on marine mammal species and stocks and their habitats. When...
Statistical evaluation of unobserved nonuniform corrosion in A216 steel
International Nuclear Information System (INIS)
Pulsipher, B.A.
1988-07-01
Tests designed to promote nonuniform corrosion have been conducted at PNL on A216 steel. In all of the tests performed to date, there have been no manifestations of significant nonuniform corrosion. Although this may suggest that nonuniform corrosion in A216 steel may not be a significant problem in the nuclear waste repository, a question arises as to whether enough tests have been conducted for a sufficient length of time to rule out nonuniform corrosion of A216 steel. In this report, a method for determining the required number of tests is examined for two of the mechanisms of nonuniform corrosion: pitting and crevice corrosion
2010-04-01
... means a company, individual, or other entity determined to be a covered employer under the Railroad... in section 216(1) of the Social Security Act. Social Security Act means the Social Security Act as amended. Tier I benefit means the benefit component calculated using Social Security Act formulas and...
12 CFR 216.16 - Protection of Fair Credit Reporting Act.
2010-01-01
... PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Relation to Other Laws; Effective Date § 216.16 Protection of Fair Credit Reporting Act. Nothing in this part shall be construed to modify, limit, or... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Protection of Fair Credit Reporting Act. 216.16...
miR-216b suppresses breast cancer growth and metastasis by targeting SDCBP
International Nuclear Information System (INIS)
Jana, Samir; Sengupta, Suman; Biswas, Subir; Chatterjee, Annesha; Roy, Himansu; Bhattacharyya, Arindam
2017-01-01
Breast cancer is the most deadly cancer among women and the second leading cause of cancer death worldwide. Treatment effectiveness is complicated with tumor invasiveness/drug resistance. To tailor treatments more effectively to individual patients, it is important to define tumor growth and metastasis at molecular levels. SDCBP is highly overexpressed and associated with a strikingly poor prognosis in breast cancer. However the post transcriptional regulation of SDCBP overexpression remains to be an unexplored area. Our study reveals that miR-216b directly regulates SDCBP expression by binding to its 3′UTR region. miR-216b is a tumor suppressive miRNA and it is underexpressed during metastatic breast cancer. Consequently, overexpression of miR-216b resulted in decreased proliferation, migration and invasion in BC cell lines by modulating the expression of SDCBP. Inhibition of miR-216b divergent the tumor suppressive role by inducing the growth proliferation, migration and invasion in vitro. There is therefore a negative correlation between the expression of miR-216b and its target gene SDCBP in the BC tissue samples as well as cell lines. Simultaneous expression of miR-216b and SDCBP rescued the growth, migration and invasion effect suggesting that tumor suppressive action of miR-216b may be directly mediated by SDCBP. In summary, the study identifies miR-216b as a regulator of SDCBP expression in breast cancer which can potentially be targeted for developing newer therapies for the effective treatment of this killer disease.
216-Z-8 French drain characterization study
International Nuclear Information System (INIS)
Marratt, M.C.; Kasper, R.B.; Van Luik, A.E.
1984-09-01
The 216-Z-8 French drain study is one of a series of studies examining historical transuranic waste facilities no longer in use at the Hanford Site. The 216-Z-8 French drain underground disposal system consisted of a large settling tank that overflowed into a French drain. The French drain consisted of two large-diameter, gravel filled, vitrified clay pipes placed on end, end-to-end, over a gravel-filled excavation. The top of the drain was sealed with concrete to prevent the upward flow of waste solution. The waste solution discharged to the 216-Z-8 waste disposal system was a neutralized, transuranic recovery process, filter cake, backflush slurry. The primary objective of this study was to determine the distribution of plutonium and americium beneath the French drain. Transuranic activity under the French drain did not exceed 5 nCi/g in the soil samples obtained from a well within 1 m of the drain structure. Conservative estimates indicated that 4 to 5 m 3 of radioactive contaminated sediments, 10 nCi/g may lie directly under the 216-Z-8 French drain. The secondary objective of the study was to evaluate the possibility of a leak in the settling tank. Results from the analysis of soil samples from wells drilled around the settling tank indicated the presence of low-level transuranic contamination (on the order of 0.001 nci/g) in the soil surrounding the tank. However, the distribution of the contamination does not support a leak as a plausible mechanism to account for the observed activity surrounding the tank. The bulk of the plutonium was confirmed to be in the sludge that remained in the tank; thus, no significant environmental impact would be expected even if there has been a leak
Guillem Fabre, “Pus dels majors” (BdT 216.2; Id., “Hon mais vey, pus truep sordeyor” (BdT 216.1
Directory of Open Access Journals (Sweden)
Linda Paterson
2013-03-01
Full Text Available The historical circumstances of Guillem Fabre’s two surviving sirventes has given rise to widely divergent views. This essay builds on Parducci’s contextualisation of BdT 216.2 during the War of the Sicilian Vespers and the so-called Aragonese crusade by the French against Pere III of Aragon in 1284-1285. It argues that Guillem is likely to be referring to events say entre nos because Narbonne was the focal point of the gathering French army and preaching of the crusade. All other textual details are compatible with this period and best explained by this context. But while Parducci places the sirventes in May 1285, it must in fact have preceded the death of Martin IV on 29 March, since his speedily-appointed successor Honorius IV could not be blamed for not having preached a crusade against the heathen before the conflict degenerated into further atrocities. Furthermore a slightly earlier timing better explains the allusion to “the best-known man in the world”, the obvious candidate at this time being Charles of Anjou. Guillem probably composed BdT 216.2 during the build-up to war in 1284, before the death of Charles in January 1285, during the period of war preparations and propaganda speeches. It is also argued here that, pace Parducci, BdT 216.1 did not necessarily precede BdT 216.2.
42 CFR 57.216 - What additional Department regulations apply to schools?
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false What additional Department regulations apply to schools? 57.216 Section 57.216 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN... schools? (a) Participating schools are advised that in addition to complying with the terms and conditions...
48 CFR 52.216-26 - Payments of Allowable Costs Before Definitization.
2010-10-01
... and placed in the production process for use on the contract; (iii) Direct labor; (iv) Direct travel; (v) Other direct in-house costs; and (vi) Properly allocable and allowable indirect costs as shown on... Costs Before Definitization. 52.216-26 Section 52.216-26 Federal Acquisition Regulations System FEDERAL...
27 CFR 40.216b - Notice for roll-your-own tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for roll-your-own tobacco. 40.216b Section 40.216b Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...
50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.
2010-10-01
...) Detailed information on the biology of marine mammals within the area, including estimated population size... Important Marine Mammal Areas. 216.191 Section 216.191 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS...
50 CFR 216.212 - Effective dates.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.212 Effective dates...
19 CFR 146.52 - Manipulation, manufacture, exhibition or destruction; Customs Form 216.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Manipulation, manufacture, exhibition or... Merchandise in a Zone § 146.52 Manipulation, manufacture, exhibition or destruction; Customs Form 216. (a... application) on Customs Form 216 for permission to manipulate, manufacture, exhibit, or destroy merchandise in...
Reconnection of SN-216 to U-D Valve Pit Design Review
International Nuclear Information System (INIS)
REED, R.W.
1999-01-01
The design for the reconnection of SN-216 to U-D valve pit was reviewed on May 24, 1999. All Review Comment Record comments were resolved and closed at this meeting. The review concluded that the reconnection of SN-216 to U-D valve pit was acceptable. The design was approved with the incorporated comments as recorded on the RCR's. No outstanding comments remain
International Nuclear Information System (INIS)
1993-12-01
The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites
Soil/sediment characterization for 216-A-29 ditch
International Nuclear Information System (INIS)
Mitchell, R.M.
1997-01-01
This document provides a detailed description of the environmental samples collected from the 216-A-29 Ditch in 1988. Tables summarizing the laboratory data for radionuclides, metals, and soil chemistry are included
Soil/sediment characterization for 216-A-29 ditch
Energy Technology Data Exchange (ETDEWEB)
Mitchell, R.M.
1997-03-01
This document provides a detailed description of the environmental samples collected from the 216-A-29 Ditch in 1988. Tables summarizing the laboratory data for radionuclides, metals, and soil chemistry are included.
50 CFR 216.257 - Letters of Authorization.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.257 Letters of Authorization. (a) A Letter of Authorization, unless suspended or revoked...
22 CFR 216.7 - Environmental impact statements.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Environmental impact statements. 216.7 Section... Environmental impact statements. (a) Applicability. An Environmental Impact Statement shall be prepared when... Environmental Impact Statement relating to paragraph (a)(2) of this section shall comply with the CEQ...
50 CFR 216.218 - Letters of Authorization.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.218 Letters of...
10 CFR 216.3 - Requests for assistance.
2010-01-01
... DOMESTIC ENERGY SUPPLIES § 216.3 Requests for assistance. (a) Persons who believe that they perform work..., performance data (capacity, life duration, etc.), standards, acceptable tolerances in dimensions and.... (10) Any known conflicts with rated orders already issued pursuant to the DPA for supplies of the...
9 CFR 93.216 - Poultry from Canada.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Poultry from Canada. 93.216 Section 93... EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF...
27 CFR 555.216 - Repair of magazines.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Repair of magazines. 555... EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.216 Repair of magazines. Before repairing the interior of magazines, all explosive materials are to be removed and the interior...
International Nuclear Information System (INIS)
Boneu, B.; Buchanan, M.R.; Caranobe, C.; Gabaig, A.M.; Dupouy, D.; Sie, P.; Hirsh, J.
1987-01-01
In previous studies, we have reported that standard heparin (SH) was cleared by two mechanisms, a saturable mechanism which predominated at low doses (less than 100 anti-factor Xa U/kg) and a non-saturable mechanism which predominated at higher doses, when the first mechanism became saturated. In this study, we examined the importance of these two mechanisms in the disappearance of a low molecular weight heparin fraction (LMWH) (CY 216), by comparing the pharmacokinetics and the pharmacodynamics of a wide range of doses of SH and CY 216 (1.5 to 500 anti-factor Xa U/kg). Pharmacokinetics was measured as the disappearance of 125 I-radiolabelled SH or CY 216. Pharmacodynamics was measured as the disappearance of the anti-factor Xa activity of SH and CY 216. We found that the saturable mechanism contributed little to the disappearance of CY 216 and that it was cleared predominantly by the non-saturable mechanism at all doses tested. Thus, at low doses (less than 100 anti-factor Xa U/kg), SH was cleared more rapidly than CY 216, whereas at higher doses, CY 216 was cleared more rapidly than SH. We conclude that the mechanism of disappearance of LMWH's differ significantly from those of SH, and that this difference may explain the apparent prolonged anticoagulant activity of LMWH's within the therapeutic range doses
50 CFR 216.272 - Permissible methods of taking.
2010-10-01
...) (iii) Pinnipeds: (A) Northern elephant seal (Mirounga angustirostris)—4795 (an average of 959 annually... of the species listed in § 216.272(c)(1)(ii)(D) through (G) over the course of the 5-year regulations. ...
24 CFR 5.216 - Disclosure and verification of Social Security and Employer Identification Numbers.
2010-04-01
... Social Security and Employer Identification Numbers. 5.216 Section 5.216 Housing and Urban Development...; WAIVERS Disclosure and Verification of Social Security Numbers and Employer Identification Numbers; Procedures for Obtaining Income Information Disclosure and Verification of Social Security Numbers and...
Sampling and Analysis Plan for the 216-A-29 Ditch
International Nuclear Information System (INIS)
Petersen, S.W.
1998-06-01
This sampling and analysis plan defines procedures to be used for collecting and handling samples to be obtained from the 216-A-29 Ditch, and identifies requirements for field and laboratory measurements. The sampling strategy describes here is derived from a Data Quality Objectives workshop conducted in January 1997 to support sampling to assure worker safety during construction and to assess the validity of a 1988 ditch sampling campaign and the effectiveness of subsequent stabilization. The purpose of the proposed sampling and analysis activities is to characterize soil contamination in the vicinity of a proposed road over the 216-A-29 Ditch
22 CFR 216.9 - Bilateral and multilateral studies and concise reviews of environmental issues.
2010-04-01
... reviews of environmental issues. 216.9 Section 216.9 Foreign Relations AGENCY FOR INTERNATIONAL... environmental issues. Notwithstanding anything to the contrary in these procedures, the Administrator may... United States is a member or participant; or (b) Concise reviews of the environmental issues involved...
Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area
Energy Technology Data Exchange (ETDEWEB)
Lindberg, J.W.; Evelo, S.D.; Alexander, D.J.
1993-11-01
This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination in the southern 200 West Area.
Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area
International Nuclear Information System (INIS)
Lindberg, J.W.; Evelo, S.D.; Alexander, D.J.
1993-11-01
This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination in the southern 200 West Area
2010-10-01
...-basic steel, aluminum, brass, bronze, or copper mill products. 252.216-7000 Section 252.216-7000 Federal... adjustment—basic steel, aluminum, brass, bronze, or copper mill products. As prescribed in 216.203-4-70(a... Mill Products (JUL 1997) (a) Definitions. As used in this clause— Established price means a price which...
22 CFR 216.2 - Applicability of procedures.
2010-04-01
... § 216.2(c)(2) for which an Initial Environmental Examination, Environmental Assessment and Environmental... have an effect on the physicial and natural environment for which financing is provided by A.I.D.; (iii) Research activities which may have an affect on the physicial and natural environment but will not have a...
2010-12-23
..., Boeing Commercial Airplane Group. FOR FURTHER INFORMATION CONTACT: RTCA Secretariat, 1828 L Street, NW..., 2010 (RTCA Paper No. 250-10/SC216-031). Report on the PMC/ICC action on SC 216 TOR. Publication...
Interim-status groundwater monitoring plan for the 216-B-63 trench. Revision 1
Energy Technology Data Exchange (ETDEWEB)
Sweeney, M.D.
1995-06-13
This document outlines the groundwater monitoring plan for interim-status detection-level monitoring of the 216-B-63 Trench. This is a revision of the initial groundwater monitoring plan prepared for Westinghouse Hanford Company (WHC) by Bjornstad and Dudziak (1989). The 216-B-63 Trench, located at the Hanford Site in south-central Washington State, is an open, unlined, earthern trench approximately 1.2 m (4 ft) wide at the bottom, 427 m (1400 ft) long, and 3 m (10 ft) deep that received wastewater containing hazardous waste and radioactive materials from B Plant, located in the 200 East Area. Liquid effluent discharge to the 216-B-63 Trench began in March 1970 and ceased in February 1992. The trench is now managed by Waste Tank Operations.
Interim-status groundwater monitoring plan for the 216-B-63 trench. Revision 1
International Nuclear Information System (INIS)
Sweeney, M.D.
1995-01-01
This document outlines the groundwater monitoring plan for interim-status detection-level monitoring of the 216-B-63 Trench. This is a revision of the initial groundwater monitoring plan prepared for Westinghouse Hanford Company (WHC) by Bjornstad and Dudziak (1989). The 216-B-63 Trench, located at the Hanford Site in south-central Washington State, is an open, unlined, earthern trench approximately 1.2 m (4 ft) wide at the bottom, 427 m (1400 ft) long, and 3 m (10 ft) deep that received wastewater containing hazardous waste and radioactive materials from B Plant, located in the 200 East Area. Liquid effluent discharge to the 216-B-63 Trench began in March 1970 and ceased in February 1992. The trench is now managed by Waste Tank Operations
50 CFR 216.252 - Permissible methods of taking.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.252 Permissible methods of taking. (a) Under Letters of Authorization issued pursuant to...
48 CFR 3052.216-72 - Performance evaluation plan.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Performance evaluation... CONTRACT CLAUSES Text of Provisions and Clauses 3052.216-72 Performance evaluation plan. As prescribed in... Evaluation Plan (DEC 2003) (a) A Performance Evaluation Plan shall be unilaterally established by the...
48 CFR 2452.216-73 - Performance evaluation plan.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Performance evaluation plan... 2452.216-73 Performance evaluation plan. As prescribed in 2416.406(e)(3), insert the following clause in all award fee contracts: Performance Evaluation Plan (AUG 1987) (a) The Government shall...
48 CFR 1252.216-72 - Performance evaluation plan.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance evaluation....216-72 Performance evaluation plan. As prescribed in (TAR) 48 CFR 1216.406(b), insert the following clause: Performance Evaluation Plan (OCT 1994) (a) A Performance Evaluation Plan shall be unilaterally...
50 CFR 216.213 - Permissible methods of taking.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.213 Permissible...
50 CFR 216.215 - Definitions, terms, and criteria
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.215 Definitions...
2010-10-01
... rehabilitated marine mammal for any activity authorized under subpart D in lieu of animals taken from the wild... disposition under special exception permits for rehabilitated marine mammals. 216.27 Section 216.27 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...
Results of the groundwater quality assessment program at the 216-A-29 ditch RCRA facility
International Nuclear Information System (INIS)
Votava, J.M.
1995-01-01
This report presents the findings of the groundwater quality assessment program for the 216-A-29 Ditch. The information presented in this report Ditch have affected the quality of the groundwater in the unconfined aquifer beneath the facility. The results indicate that the 216-A-29 Ditch is the source of elevated specific conductance in well 299-E25-35 and that the source is nonhazardous. This report describes the current monitoring status of the 216-A-29 Ditch, groundwater chemical data interpretation, and recommends the reinstatement of an indicator-evaluation monitoring program in accordance with 40 CFR 265.93(d)(6)
22 CFR 1203.735-216 - Miscellaneous statutory provisions.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Miscellaneous statutory provisions. 1203.735-216..., United States Code, relating to bribery, graft, and conflicts of interest, as appropriate to the... employee acting as the agent of a foreign principal registered under the Foreign Agents Registration Act...
48 CFR 3452.216-70 - Additional cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Additional cost principles... Clauses 3452.216-70 Additional cost principles. Insert the following clause in solicitations and contracts as prescribed in 3416.307(b): Additional Cost Principles (AUG 1987) (a) Bid and Proposal Costs. Bid...
50 CFR 216.171 - Effective dates and definitions.
2010-10-01
... concern listed in next bullet) found dead or live on shore within a two day period and occurring on same... distress. (2) Shutdown (this definition specifically applies only to the word as used in § 216.174(a)(1... live, in the water animal involved in a USE. ...
13 CFR 134.216 - Alternative dispute resolution procedures.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Alternative dispute resolution....216 Alternative dispute resolution procedures. At any time during the pendency of a case, the parties may submit a joint motion requesting that the Judge permit the use of alternative dispute resolution...
12 CFR 216.13 - Exception to opt out requirements for service providers and joint marketing.
2010-01-01
... this section may include marketing of your own products or services or marketing of financial products... providers and joint marketing. 216.13 Section 216.13 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Exceptions...
Nuclear structure of 216 Ra at high spin
Indian Academy of Sciences (India)
Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to ...
The Brimac HA 216 Adsorptive Media was tested for uranium (U) removal from a drinking water source (well water) at Grappone Toyota located in Bow, New Hampshire. The HA 216 media is a hydroxyapatite-based material. A pilot unit, consisting of a TIGG Corporation Cansorb® C-5 ste...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Limits on emissions from mobile earth stations for protection of aeronautical radionavigation-satellite service. 25.216 Section 25.216 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...
2012-01-17
... advise the public of the eighteenth meeting of RTCA Special Committee 216: Aeronautical Systems Security... Agenda Overview and Approval Split Plenary Session (9:15 a.m.--12 p.m.) SC 216 Review of the Summary of....--12 p.m.) WG-72 Introduction, Report about publications and relations EUROCAE Document Discussions, e...
50 CFR 216.256 - Applications for Letters of Authorization.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.256 Applications for Letters of Authorization. To incidentally take...
Laparoscopic cholecystectomy for acute cholecystitis: clinical analysis of 216 cases
Directory of Open Access Journals (Sweden)
DAI Juntao
2014-07-01
Full Text Available ObjectiveTo investigate the clinical experience of laparoscopic cholecystectomy (LC for acute cholecystitis. MethodsA retrospective analysis was performed on the clinical records of 216 patients with acute cholecystitis who underwent LC in Qingpu Branch of Zhongshan Hospital, Fudan University from January 2010 to January 2013. LC was performed under intubation general anaesthesia, with three holes conventionally and four holes if necessary. After operation, the drainage tube was placed for 1-3 d, and antibiotics were administered for 3-5 d. The time of operation, length of postoperative hospital stay, and incidence of postoperative complications were determined. All patients were followed up for at least 0.5 year after operation. ResultsLC was successfully performed in 188 (87.0% of all patients; 28 (13.0% of all patients were converted to open surgery. The mean time of operation was 62.00±11.27 min; the mean length of hospital stay was 4.60±2.16 d; the incidence of postoperative complications was 2.3%(5/216. All patients were cured and discharged. During follow-up, no patients developed other complications and all recovered well. ConclusionLC is safe and feasible in the treatment of acute cholecystitis. Correct manipulation of the Calot's triangle and proper abdominal drainage are the key to successful operation.
47 CFR 15.242 - Operation in the bands 174-216 MHz and 470-668 MHz.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Operation in the bands 174-216 MHz and 470-668... bands 174-216 MHz and 470-668 MHz. (a) The marketing and operation of intentional radiators under the... services, facilities, and beds for use beyond 24 hours in rendering medical treatment and institutions and...
50 CFR 216.258 - Renewal of Letters of Authorization.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.258 Renewal of Letters of Authorization. (a) A Letter of Authorization...
50 CFR 216.259 - Modifications to Letters of Authorization.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.259 Modifications to Letters of Authorization. (a) Except as provided in...
Groundwater Monitoring Plan for the 216-S-10 Pond and Ditch, Interim Change Notice 1
International Nuclear Information System (INIS)
Williams, Bruce A.
2003-01-01
During 2003, the upgradient well 299-W26-7 went dry and one new groundwater monitoring well was installed downgradient (well 299-W26-14) of the 216-S-10 pond and ditch. This ICN updates the groundwater monitoring wells for the 216-S-10 pond and ditch and adds a revised well location map to the plan
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Prohibitions under the General Authorization for Level B harassment for scientific research. 216.16 Section 216.16 Wildlife and Fisheries... Prohibitions under the General Authorization for Level B harassment for scientific research. It shall be...
48 CFR 216.306 - Cost-plus-fixed-fee contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Cost-Reimbursement Contracts 216.306 Cost-plus-fixed-fee contracts. (c) Limitations. (i) Except as provided in...
50 CFR 216.165 - Requirements for monitoring and reporting.
2010-10-01
...) by Detonation of Conventional Explosives in the Offshore Waters of the U.S. Atlantic Coast § 216.165... Response Program. Necropsies will be performed and tissue samples taken from any dead animals. After completion of the necropsy, animals not retained for shoreside examination will be tagged and returned to the...
48 CFR 52.216-11 - Cost Contract-No Fee.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Contract-No Fee. 52....216-11 Cost Contract—No Fee. As prescribed in 16.307(e), insert the following clause in solicitations and contracts when a cost-reimbursement contract is contemplated that provides no fee and is not a...
Directory of Open Access Journals (Sweden)
Khaidem Aruna Devi
2016-10-01
Full Text Available An endophytic bacterium, AL2-16, was isolated from Achyranthes aspera L. It was characterized and identified as Serratia sp. AL2-16 and was experimented for the presence of plant growth-promoting properties. AL2-16 produced siderophore in iron-deficient conditions. The quantitative estimation of siderophore production unit of AL2-16 was maximum after 48 hours of incubation (83.488% in the presence of 1 μM of ferric chloride. The fructose followed by glucose and sucrose were proved to be the best carbon sources resulting in appreciable amount of siderophore production, i.e. 77.223%, 73.584%, and 65.363% respectively. AL2-16 also has the ability to produce indole acetic acid in medium supplemented with l-tryptophan. The highest amount of indole acetic acid, in the presence of 1.0% l-tryptophan, was 123.2 μg/mL after 144 hours. This isolate solubilized inorganic phosphate and also gave positive result for ammonia production. Colonization and pot trial experiments were conducted on A. aspera L. plant. The population of AL2-16 increased from 16.2 × 106 to 11.2 × 108 colony forming unit/g between 3rd and 5th days after inoculation. It significantly (p ≤ 0.05 increased shoot length by 95.52%, fresh shoot weight by 602.38%, fresh root weight by 438%, and area of leaves by 127.2% when inoculated with AL2-16, as compared with uninoculated control.
50 CFR 216.211 - Specified activity and specified geographical region.
2010-10-01
... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.211 Specified activity and specified geographical region. (a) Regulations in this...
50 CFR 216.250 - Specified activity and specified geographical region.
2010-10-01
... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.250 Specified activity and specified geographical region. (a...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation Program. 216.46 Section 216.46 Wildlife and Fisheries....46 U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation...
Adsorption gas chromatography with 150-ms {sup 216}Po
Energy Technology Data Exchange (ETDEWEB)
Vogt, A [Bern Univ. (Switzerland); Gaeggeler, H W; Tuerler, A [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1997-09-01
A gas chromatography apparatus was developed, which allows experiments with volatile radionuclides having shorter half-lives than one second. This apparatus was tested with the 150-ms isotope {sup 216}Po. Experimental data were compared with a Monte Carlo model to determine the adsorption enthalpy {Delta}H{sub a}. (author) 2 figs., 2 refs.
Borehole Data Package for 216-U-12 Crib Well 299-W22-79
International Nuclear Information System (INIS)
DG Horton; BA Williams
1999-01-01
One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-U-12 crib in September 1998 in support of Tri-Parly Agreement (Ecology 1996) milestone M-24-36. The new well is 299-W22-79 and is a downgradient well in the groundwater monitoring network. There are a total of six wells in the groundwater monitoring network for the 216-U-12 crib and their locations are shown on Figure 1. The groundwater assessment monitoring plan for the 216-U-12 crib (Chou and Williams 1993) describes the hydrogeology of the 200 West Area and the 216-U-12 crib area. An Interim Change Notice to the assessment plan provides justification for the well (Chou and Williams 1997). The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160, and WAC-173-303, and in Chou and Williams (1997). This document compiles information on the drilling and construction, well development and permanent pump installation applicable to well 299-W22-79. Appendix A contains the geologist's log, the Well Construction Summary Report, and Well Summary Sheet (as-built diagram). Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington. English units are used in this report because they are used by drillers to measure and report depths and well construction details. The conversion is made by multiplying feet by 0.3048 to obtain meters; or multiplying inches by 2.54 to obtain centimeters
International Nuclear Information System (INIS)
Eccleston, C.H.
1994-05-01
The US Department of Energy (DOE) is considering the possibility of replacing the existing Hanford Site 200 Are steam system through a privatization effort. Such an action would be subject to requirements of the National Environmental Policy Act (NEPA) of 1969. Section 216 of the Doe NEPA Implementation Procedures (216 Process) provides a specific mechanism for integrating the DOE procurement process with NEPA compliance requirements
48 CFR 1852.216-87 - Submission of vouchers for payment.
2010-10-01
... and Clauses 1852.216-87 Submission of vouchers for payment. As prescribed in 1816.307-70(e), insert the following clause: Submission for Vouchers for Payment (MAR 1998) (a) The designated billing office for cost vouchers for purposes of the Prompt Payment clause of this contract is indicated below...
48 CFR 216.405-2 - Cost-plus-award-fee contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-award-fee... Contracts 216.405-2 Cost-plus-award-fee contracts. (b) Application. The cost-plus-award-fee (CPAF) contract... avoid— (1) Establishing cost-plus-fixed-fee contracts when the criteria for cost-plus-fixed-fee...
41 CFR 302-3.216 - When must I begin my first tour renewal travel from Alaska or Hawaii?
2010-07-01
... first tour renewal travel from Alaska or Hawaii? 302-3.216 Section 302-3.216 Public Contracts and... must I begin my first tour renewal travel from Alaska or Hawaii? You must begin your first tour renewal travel within 5 years of your first consecutive tours in either Alaska or Hawaii. ...
20 CFR 216.3 - Other regulations related to this part.
2010-04-01
... eligibility. Where eligibility for an annuity is based upon a family relationship to an employee (for example, a widow's annuity), the definition of such family relationship may be found in part 222 of this... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 216.3...
48 CFR 1852.216-74 - Estimated cost and fixed fee.
2010-10-01
... and Clauses 1852.216-74 Estimated cost and fixed fee. As prescribed in 1816.307-70(b), insert the following clause: Estimated Cost and Fixed Fee (DEC 1991) The estimated cost of this contract is ______ exclusive of the fixed fee of ______. The total estimated cost and fixed fee is ______. (End of clause) [62...
48 CFR 52.216-12 - Cost-Sharing Contract-No Fee.
2010-10-01
....216-12 Cost-Sharing Contract—No Fee. As prescribed in 16.307(f), insert the following clause in... nonprofit organization. Cost-Sharing Contract—No Fee (APR 1984) (a) The Government shall not pay to the... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost-Sharing Contract-No...
48 CFR 1852.216-85 - Estimated cost and award fee.
2010-10-01
... and Clauses 1852.216-85 Estimated cost and award fee. As prescribed in 1816.406-70(e), insert the following clause: Estimated Cost and Award Fee (SEP 1993) The estimated cost of this contract is $___. The... cost, base fee, and maximum award fee are $___. (End of clause) Alternate I (SEP 1993). As prescribed...
50 CFR 216.219 - Renewal and modifications of Letters of Authorization.
2010-10-01
... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.219 Renewal and modifications of Letters of Authorization. (a) A Letter of...
18 CFR 367.2161 - Account 216.1, Unappropriated undistributed subsidiary earnings.
2010-04-01
..., either debit or credit, of undistributed retained earnings of subsidiary companies since their... account, this account must be debited and account 216, Unappropriated retained earnings (§ 367.2160..., Unappropriated undistributed subsidiary earnings. 367.2161 Section 367.2161 Conservation of Power and Water...
International Nuclear Information System (INIS)
Smith, D.L.; Hayward, W.M.
1991-09-01
The 216-A-29 ditch is located in the central portion of the Hanford Site with Operable Unit 200-PO-5. The ditch is classified under the Resource Conservation and Recovery Act of 1976 as a Treatment, Storage, and Disposal (TSD) Facility and as such, is to be removed from service in support of the Hanford Federal Facility Agreement and Consent Order Tri-Party Agreement (Ecology et al. 1989) Milestone M-17-10, which states ''cease all liquid discharges to hazardous land disposal units unless such units have been clean closed in accordance with the Resource Conservation and Recovery Act of 1976''. The 216-A-29 ditch is one stream feeding the 216-B-3 Pond system, and its removal from service was necessary to support the closure strategy for the 216-B-3 Pond system. Interim stabilization of the 216-A-29 ditch is the first step required to comply with the Tri-Party Agreement (Ecology et al. 1989) and the eventual decommissioning of the entire B Pond system. Interim stabilization was required to maintain the 216-A-29 ditch in a stable configuration until closure actions have been determined and initiated. 4 refs., 3 figs
48 CFR 1852.216-84 - Estimated cost and incentive fee.
2010-10-01
... Provisions and Clauses 1852.216-84 Estimated cost and incentive fee. As prescribed in 1816.406-70(d), insert the following clause: Estimated Cost and Incentive Fee (OCT 1996) The target cost of this contract is $___. The target fee of this contract is $___. The total target cost and target fee as contemplated by the...
40 CFR 81.216 - Northeast Indiana Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Indiana Intrastate Air... Air Quality Control Regions § 81.216 Northeast Indiana Intrastate Air Quality Control Region. The Northeast Indiana Intrastate Air Quality Control Region (Indiana) consists of the territorial area...
9 CFR 381.216 - Procedure for judicial seizure, condemnation, and disposition.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Procedure for judicial seizure... Detention; Seizure and Condemnation; Criminal Offenses § 381.216 Procedure for judicial seizure, condemnation, and disposition. Any poultry or other article subject to seizure and condemnation under this...
12 CFR 216.11 - Limits on redisclosure and reuse of information.
2010-01-01
... RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Limits on Disclosures § 216.11... disclose that information to a third party for marketing purposes or use that information for your own marketing purposes. (b)(1) Information you receive outside of an exception. If you receive nonpublic...
Interim-status groundwater monitoring plan for the 216-B-63 trench
Energy Technology Data Exchange (ETDEWEB)
Sweeney, M.D.
1995-02-09
This document outlines the groundwater monitoring plan, under RCRA regulations in 40 CFR 265 Subpart F and WAC173-300-400, for the 216-B-63 Trench. This interim status facility is being sampled under detection monitoring criteria and this plan provides current program conditions and requirements.
The 1943 K emission spectrum of H216O between 6600 and 7050 cm-1
Czinki, Eszter; Furtenbacher, Tibor; Császár, Attila G.; Eckhardt, André K.; Mellau, Georg Ch.
2018-02-01
An emission spectrum of H216O has been recorded, with Doppler-limited resolution, at 1943 K using Hot Gas Molecular Emission (HOTGAME) spectroscopy. The wavenumber range covered is 6600 to 7050 cm-1. This work reports the analysis and subsequent assignment of close to 3700 H216O transitions out of a total of more than 6700 measured peaks. The analysis is based on the Measured Active Rotational-Vibrational Energy Levels (MARVEL) energy levels of H216O determined in 2013 and emission line intensities obtained from accurate variational nuclear-motion computations. The analysis of the spectrum yields about 1300 transitions not measured previously and 23 experimentally previously unidentified rovibrational energy levels. The accuracy of the line positions and intensities used in the analysis was improved with the spectrum deconvolution software SyMath via creating a peak list corresponding to the dense emission spectrum. The extensive list of labeled transitions and the new experimental energy levels obtained are deposited in the Supplementary Material of this article as well as in the ReSpecTh (http://www.respecth.hu) information system.
High-spin states in 214Rn, 216Ra and a study of even-even N=128 systematics
Lönnroth, T.; Horn, D.; Baktash, C.; Lister, C. J.; Young, G. R.
1983-01-01
High-spin states in 214Rn and 216Ra have been studied by means of the reaction 208Pb(13C, α 3n γ)214Rn and 208Pb(13C, 5n γ)216Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions, and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, Jπ assignments, and isomeric lifetimes. Excited states with spins up to 23ℏ in 214Rn and ~30ℏ in 216Ra were observed. Isomers were found in 214Rn at 1625 keV (T12=9 ns, Jπ=8+), 1787 keV (22 ns, 10+), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216Ra at 1708 keV (8 ns, 8+) and 5868 keV (10 ns, ~24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N=128 even-even nuclei is discussed. NUCLEAR STRUCTURE 208Pb(13C, α 3n γ)214Rn, 208Pb(13C, 5n γ) 216Ra, Elab=75-95 MeV. Measured α-γ coin, γ-γ(t) coin, I(θ), pulsed-beam-γ timing. Deduced level schemes, Jπ, T12, B(EL), multipolarities. Shell model calculations, Ge(Li) and Si detectors, enriched target.
Directory of Open Access Journals (Sweden)
Binoy Appukuttan
Full Text Available Increased cellular production of vascular endothelial growth factor (VEGF is responsible for the development and progression of multiple cancers and other neovascular conditions, and therapies targeting post-translational VEGF products are used in the treatment of these diseases. Development of methods to control and modify the transcription of the VEGF gene is an alternative approach that may have therapeutic potential. We have previously shown that isoforms of the transcriptional enhancer factor 1-related (TEAD4 protein can enhance the production of VEGF. In this study we describe a new TEAD4 isoform, TEAD4(216, which represses VEGF promoter activity. The TEAD4(216 isoform inhibits human VEGF promoter activity and does not require the presence of the hypoxia responsive element (HRE, which is the sequence critical to hypoxia inducible factor (HIF-mediated effects. The TEAD4(216 protein is localized to the cytoplasm, whereas the enhancer isoforms are found within the nucleus. The TEAD4(216 isoform can competitively repress the stimulatory activity of the TEAD4(434 and TEAD4(148 enhancers. Synthesis of the native VEGF(165 protein and cellular proliferation is suppressed by the TEAD4(216 isoform. Mutational analysis indicates that nuclear or cytoplasmic localization of any isoform determines whether it acts as an enhancer or repressor, respectively. The TEAD4(216 isoform appears to inhibit VEGF production independently of the HRE required activity by HIF, suggesting that this alternatively spliced isoform of TEAD4 may provide a novel approach to treat VEGF-dependent diseases.
23 CFR 450.216 - Development and content of the statewide transportation improvement program (STIP).
2010-04-01
... Programming § 450.216 Development and content of the statewide transportation improvement program (STIP). (a... Equity Bonus funds; (5) Emergency relief projects (except those involving substantial functional...
High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics
International Nuclear Information System (INIS)
Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.
1983-01-01
High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C, α 3n #betta#) 214 Rn and 208 Pb( 13 C, 5n #betta#) 216 Ra at beam energies in the range 75--95 MeV. In-beam spectroscopy techniques, including #betta#-decay excitation functions, α-#betta# coincidences, #betta#-#betta# coincidences, #betta#-ray angular distributions, and pulsed-beam-#betta# timing, were utilized to establish level energies, #betta#-ray multipolarities, J/sup π/ assignments, and isomeric lifetimes. Excited states with spins up to 23h in 214 Rn and roughly-equal30h in 216 Ra were observed. Isomers were found in 214 Rn at 1625 keV (T/sub 1/2/ = 9 ns, J/sup π/ = 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216 Ra at 1708 keV (8 ns, 8 + ) and 5868 keV (10 ns, approx.24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N = 128 even-even nuclei is discussed
High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics
International Nuclear Information System (INIS)
Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.
1981-09-01
High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C,α3nγ) 214 Rn and 208 Pb( 13 C,5nγ) 216 Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, JHπ assignments and isomeric lifetimes. Excited states with spins up to 23 h/2π in 214 Rn and 30 h/2π in 216 Ra were established. Isomers are found in 214 Rn at 1625 keV (9 ns, 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16 + ), 4509 keV (230 ns, 20 + ) and 4735 keV (8.0 ns, 22 + ) and in 216 Ra at 1710 keV (8 ns, 8 + ) and 5868 keV (10 ns, 24 - ). B(EL) values are derived and compared to previously known lead-region electric transition rates. Shell-model calculations are performed on the basis of which configuration assignment is made. The absence of α-decay branching in the isomers is explained. The systematical behaviour of N = 128 even-even nuclei is discussed. Effective moments of inertia are derived. (author)
Field characterization plan for the 216-U-8 vitrified clay pipeline
International Nuclear Information System (INIS)
Rowley, C.A.
1994-01-01
The 216-U-8 Crib was constructed in 1952 and received waste from 1952 to 1960 as described in Appendix A. This description of work details the field activities associated with the characterization of the vitrified clay pipe (VCP) delivery line to the 216-U-8 Crib and subsurface soil sampling along the pipe route in the 200 West Area of Hanford U Plant. It will serves as a field guide for those performing the work. Soil sampling locations will be determined by a combination of radiological surface surveys and internal camera surveys of the VCP line. Depending on the condition of the pipeline and field conditions, the objectives are as follows: examine the internal condition of the VCP with a survey camera to the extent allowed by field conditions; determine precise location and depth of the VCP; document VCP integrity; document gamma radiation profile through the VCP; and correlate any relationships between surface contamination zones at grade above the VCP to identify breaches in the pipe integrity
216-A-29 Ditch supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)
International Nuclear Information System (INIS)
Ingle, S.J.
1996-05-01
This document is a unit-specific contingency plan for the 216-A-29 Ditch and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-A-29 Ditch is a surface impoundment that received nonregulated process and cooling water and other dangerous wastes primarily from operations of the Plutonium/Uranium Extraction Plant. Active between 1955 and 1991, the ditch has been physically isolated and will be closed. Because it is no longer receiving discharges, waste management activities are no longer required at the unit. The ditch does not present a significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 216-A-29 Ditch
216-U-12 Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)
International Nuclear Information System (INIS)
Ingle, S.J.
1996-05-01
This document is a unit-specific contingency plan for the 216-U-12 Crib and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-U-12 Crib is a landfill that received waste from the 291-U-1 Stack, 244-WR Vault, 244-U via tank C-5, and the UO 3 Plant. The crib pipeline was cut and permanently capped in 1988, and the crib has been backfilled. The unit will be closed under final facility standards. Waste management activities are no longer required at the unit. The crib does not present a significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 216-U-12 Crib
216-A-10 Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)
International Nuclear Information System (INIS)
Ingle, S.J.
1996-05-01
This document is a unit-specific contingency plan for the 216-A-10 Crib. The Crib is a landfill that received process condensate from the 202-A building Plutonium/Uranium Extraction Plant from 1956 to 1987. The crib has not received waste since March 1987 and will be closed under final facility standards. Waste management activities are no longer required at the crib, and it does not present significant hazard to adjacent units, personnel or the environment. It is unlikely that any incidents presenting hazards to the public health or the environment would occur at the 216-A-10 Crib
12 CFR 216.15 - Other exceptions to notice and opt out requirements.
2010-01-01
... insurance to the consumer. (2) A consumer may revoke consent by subsequently exercising the right to opt out... RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Exceptions § 216.15 Other... consent or at the direction of the consumer, provided that the consumer has not revoked the consent or...
Borehole data package for the 216-S-10 pond and ditch well 299-W26-13
International Nuclear Information System (INIS)
Horton, D.G.; Williams, B.A.; Cearlock, C.S.
2000-01-01
One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-S-10 pond and ditch during November and December 1999 in fulfillment of Tri-Party Agreement (Ecology 1996) milestone M-24-42. The well is 299-W26-13 and is located at the northeast comer to the 216-S-10 pond, southwest of 200 West Area. The well is a new downgradient well in the monitoring network. A figure shows the locations of all wells in the 216-S-10 pond and ditch monitoring network. The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160 and WAC 173-303, the groundwater monitoring plan for the 216-S-10 pond and ditch (Airhart et al. 1990), and the description of work for well drilling and installation. During drilling and construction of well 299-W26-13, sampling and analysis activities were done to support remedial action, closure decisions at treatment, storage and disposal facilities, and to confirm preliminary site conceptual models developed in the 200-CS-1 Work Plan (DOE/RL 1999). This document compiles information on the drilling and construction, well development, pump installation, and sediment and groundwater testing applicable to well 299-W26-13. Appendix A contains the Well Summary Sheet (as-built diagram), the Well Construction Summary Report, and the geologist's log. Appendix B contains results of field and laboratory determinations of physical and chemical properties of sediment samples. Appendix C contains borehole geophysical logs. Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington
Variable stars in the Pegasus dwarf galaxy (DDO 216)
Energy Technology Data Exchange (ETDEWEB)
Hoessel, J.G.; Abbott, M.J.; Saha, A.; Mossman, A.E.; Danielson, G.E. (Washburn Observatory, Madison, WI (USA) Space Telescope Science Institute, Baltimore, MD (USA) Palomar Observatory, Pasadena, CA (USA))
1990-10-01
Observations obtained over a period of five years of the resolved stars in the Pegasus dwarf irregular galaxy (DDO 216) have been searched for variable stars. Thirty-one variables were found, and periods established for 12. Two of these variable stars are clearly eclipsing variables, seven are very likely Cepheid variables, and the remaining three are probable Cepheids. The period-luminosity relation for the Cepheids indicates a distance modulus for Pegasus of m - M = 26.22 + or - 0.20. This places Pegasus very near the zero-velocity surface of the Local Group. 25 refs.
Méndez-Hernández, Lucía E; Robledo-Rivera, Angelica Y; Macías-Silva, Marina; Calera, Mónica R; Sánchez-Olea, Roberto
2017-11-01
Gpn1 associates with Gpn3, and both are required for RNA polymerase II nuclear targeting. Global studies have identified by mass spectrometry that human Gpn3 is ubiquitinated on lysines 189 and 216. Our goals here were to determine the type, physiological importance, and regulation of Gpn3 ubiquitination. After inhibiting the proteasome with MG132, Gpn3-Flag was polyubiquitinated on K216, but not K189, in HEK293T cells. Gpn3-Flag exhibited nucleo-cytoplasmic shuttling, but polyubiquitination and proteasomal degradation of Gpn3-Flag occurred only in the cell nucleus. Polyubiquitination-deficient Gpn3-Flag K216R displayed a longer half-life than Gpn3-Flag in two cell lines. Interestingly, Gpn1-EYFP inhibited Gpn3-Flag polyubiquitination in a dose-dependent manner. In conclusion, Gpn1-inhibitable, nuclear polyubiquitination on lysine 216 regulates the half-life of Gpn3 by tagging it for proteasomal degradation. © 2017 Federation of European Biochemical Societies.
Yeast Interacting Proteins Database: YNL216W, YLR453C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YNL216W RAP1 DNA-binding protein involved in either activation or repression of transcription, depending...NA-binding protein involved in either activation or repression of transcription, depending on binding site c
216-A-36B Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)
International Nuclear Information System (INIS)
Ingle, S.J.
1996-05-01
This document is a unit-specific contingency plan for the 216-A-36B Crib and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-A-36B Crib is a landfill that received ammonia scrubber waste from the 202-A Building (Plutonium/Uranium Extraction Plant) between 1966 and 1972. In 1982, the unit was reactivated to receive additional waste from Plutonium/Uranium Extraction operations. Discharges ceased in 1987, and the crib will be closed under final facility standards. Because the crib is not receiving discharges, waste management activities are no longer required. The crib does not present a significant hazard to adjacent units, personnel, or the environment. There is little likelihood that any incidents presenting hazards to public health or the environment would occur at the 216-A-36B Crib
48 CFR 2452.216-70 - Estimated cost, base fee and award fee.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost, base fee... Provisions and Clauses 2452.216-70 Estimated cost, base fee and award fee. As prescribed in 2416.406(e)(1), insert the following clause in all cost-plus-award-fee contracts: Estimated Cost, Base Fee and Award Fee...
50 CFR 216.95 - Official mark for “Dolphin-safe” tuna products.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Official mark for âDolphin-safeâ tuna... AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.95 Official mark for “Dolphin-safe... Department of Commerce that may be used to label tuna products that meet the “dolphin-safe” standards set...
12 CFR 216.12 - Limits on sharing account number information for marketing purposes.
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Limits on sharing account number information... GOVERNORS OF THE FEDERAL RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Limits on Disclosures § 216.12 Limits on sharing account number information for marketing purposes. (a) General...
25 CFR 900.216 - What other statutes and regulations apply to contract disputes?
2010-04-01
... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Post-Award Contract Disputes § 900.216 What other statutes and regulations apply to... 25 Indians 2 2010-04-01 2010-04-01 false What other statutes and regulations apply to contract...
Groundwater impact assessment for the 216-U-17 Crib, 200 West Area
International Nuclear Information System (INIS)
Reidel, S.P.; Johnson, V.G.; Kline, N.W.
1993-06-01
As required by the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement milestone M-17-00A), this report assesses the impact to groundwater from discharge of process condensate to the ground at the 216-U-17 Crib. The assessment considers impacts associated with moisture movement through soil beneath the crib and the potential transport of contaminants to the groundwater
29 CFR 1910.216 - Mills and calenders in the rubber and plastics industries.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Mills and calenders in the rubber and plastics industries... Guarding § 1910.216 Mills and calenders in the rubber and plastics industries. (a) General requirements— (1... installed in accordance with this section and Subpart S of this part. (4) Mill roll heights. All new mill...
2010-09-14
..., (RTCA Paper No. 137-10/SC216-029). Report on the PMC/ICC action on TOR: Publication Progress and Update... Advisory Committee. [FR Doc. 2010-22879 Filed 9-13-10; 8:45 am] BILLING CODE 4910-13-P ...
International Nuclear Information System (INIS)
Ingle, S.J.
1996-05-01
The 216-S-10 Pond and Ditch were used as disposal sites for the Chemical Engineering Laboratory between 1980 and 1983. The 216-S-10 Ditch last received a discharge October 1991. Both the pond and the ditch have been physically isolated, and the pond has been backfilled and decommissioned; both will be closed under final facility standards. Waste management activities are no longer required at the unit. The unit does not present and significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 215-S-10 Pond and Ditch
DEFF Research Database (Denmark)
Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia
The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of five flavouring substances from subgroup 3.3 of FGE.19. In the Flavouring Group Evaluation 216 (FGE.216) additional genotoxicity...... of animals treated with 2-phenylcrotonaldehyde. Moreover, since the substance was genotoxic only without metabolic activation, it appears necessary to prove the absence of genotoxic effect locally in the gastro intestinal system using the Comet assay....
Stratigraphy of the late Cenozoic sediments beneath the 216-A Crib Facilities
International Nuclear Information System (INIS)
Fecht, K.R.; Last, G.V.; Marratt, M.C.
1979-02-01
The stratigraphy of the late Cenozoic sediments beneath the 216-A Crib Facilities is presented as lithofacies cross sections and is based on textural variations of the sedimentary sequence lying above the basalt bedrock. The primary source of data in this study is geologic information obtained from well drilling operations and geophysical logging. Stratigraphic interpretations are based primarily on textural analysis and visual examination of sediment samples and supplemented by drillers logs and geophysical logs
216-S-1 and S-2 mixed-fission-product crib-characterization study
Energy Technology Data Exchange (ETDEWEB)
Van Luik, A. E.; Smith, R. M.
1982-03-01
The 216-S-1 and 2 crib is an underground structure that was used for the disposal of radioactively contaminated liquid waste at the Hanford Site. The crib received acidic, intermediate level, mixed fission-product waste solutions from 1952 to 1956. The 1980 status of radioactive contaminants in the sediment beneath the crib was investigated. The results indicate that the radionuclide distributions are stable, with no evidence of significant translocations found since the late 1960's.
216-S-1 and S-2 mixed-fission-product crib-characterization study
International Nuclear Information System (INIS)
Van Luik, A.E.; Smith, R.M.
1982-03-01
The 216-S-1 and 2 crib is an underground structure that was used for the disposal of radioactively contaminated liquid waste at the Hanford Site. The crib received acidic, intermediate level, mixed fission-product waste solutions from 1952 to 1956. The 1980 status of radioactive contaminants in the sediment beneath the crib was investigated. The results indicate that the radionuclide distributions are stable, with no evidence of significant translocations found since the late 1960's
2010-10-01
... Intentional Radiators Radiated Emission Limits, Additional Provisions § 15.216 Disclosure requirements for... following disclosure requirements: (1) Such persons must display the consumer disclosure text, as specified... point of sale or lease of each such low power auxiliary station. The text must be displayed in a clear...
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
Prognostic analysis of 216 cases with penetrating ocular injury
Directory of Open Access Journals (Sweden)
Yong Guo
2013-08-01
Full Text Available AIM: To analyze the factors of penetrating ocular injury, and to investigate the prognostic factors and treatment strategies. METHODS: A retrospective analysis of 216 ocular trauma patients(221 eyes, in our hospital from November 2009 to November 2011, was completed. RESULTS: The eyeball atrophy inevitably occurred in 13 eye wounds more than 30mm. Retinal prolapse of the eyes, 78%(35/45completed vitrectomy, 33%(15/45were eyeball atrophy. The 51%(20/39of subchoroidal hemorrhage eyes were eyeball atrophy. Retinal prolapse and subchoroidal hemorrhage increased the risk of ocular atrophy(PPCONCLUSION: Serious ocular trauma prognosis related to many factors. The retina prolapse and the subchoroidal hemorrhage were important prognosis testify. A scleral buckling condensation surgery and vitrectomy have a therapeutic effect, and can improve visual function.
Groundwater impact assessment report for the 216-U-14 Ditch
Energy Technology Data Exchange (ETDEWEB)
Singleton, K.M.; Lindsey, K.A.
1994-01-01
Groundwater impact assessments are conducted at liquid effluent receiving sites on the Hanford Site to determine hydrologic and contaminant impacts caused by discharging wastewater to the soil column. The assessments conducted are pursuant to the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-17-00A and M-17-00B, as agreed by the US Department of Energy (DOE), Washington State Department of Ecology (Ecology), and the US Environmental Protection Agency (EPA) (Ecology et al. 1992). This report assesses impacts on the groundwater and vadose zone from wastewater discharged to the 216-U-14 Ditch. Contemporary effluent waste streams of interest are 242-S Evaporator Steam Condensate and UO{sub 3}/U Plant wastewater.
2010-10-01
...-Hour Proposal Requirements-Non-Commercial Item Acquisition without Adequate Price Competition. 52.216... Price Competition. As prescribed in 16.601(e)(2), insert the following provision: Time-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition Without Adequate Price Competition (FEB...
Christner, Emanuel; Dyroff, Christoph; Sanati, Shahrokh; Brenninkmeijer, Carl; Zahn, Andreas
2013-04-01
Atmospheric water in form of water vapor and clouds is an enormously crucial trace species. It is responsible for ~70 % of the natural greenhouse effect (Schmidt et al., JGR, 2010), carries huge amounts of latent heat, and is the major source of OH in the troposphere. The isotopic composition of water vapor is an elegant tracer for a better understanding and quantification of the extremely complex and variable hydrological cycle in Earth's atmosphere (evaporation, cloud condensation, rainout, re-evaporation, snow), which in turn is a prerequisite to improve climate modeling and predictions. In this context, water-isotopologues (here the isotope ratio HDO/H216O) can be used to study the atmospheric transport of water and in-cloud processes. As H216O and HDO differ in vapor pressure and molecular diffusion, fractionation occurs during condensation and rainout events. For that reason the ratio HDO/H216O preserves information about the transport and condensation history of an air mass. The tunable diode-laser absorption spectrometer ISOWAT was developed for airborne measurements of the water-isotopologue concentrations of H216O and HDO, probing fundamental rovibrational water-absorption lines at around 2.66 μm. Since April 2010 the spectrometer is regularly operated aboard the CARIBIC passenger aircraft (Civil Aircraft for the Regular Investigation of the atmosphere Based on an Instrument Container - Lufthansa, Airbus 340-600), which measures ~100 trace gases and aerosol components in the UTLS (9-12 km altitude) on four long-distance flights per month. During several flights across the equator (Africa) or close to the equator (Venezuela and Malaysia) an increase of HDO/H216O from the subtropics towards the tropics was measured (by more than 100 permil) at an altitude of ~12 km. This isotopic gradient can partly be attributed to differences in humidity. In addition there is a humidity independent latitudinal gradient (by more than 50 permil), revealing the strong
2010-10-01
...-Materials/Labor-Hour Proposal Requirements-Non-Commercial Item Acquisition With Adequate Price Competition... Requirements—Non-Commercial Item Acquisition With Adequate Price Competition. As prescribed in 216.601(e...-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition With Adequate Price...
2010-10-01
...-Hour Proposal Requirements-Non-Commercial Item Acquisition With Adequate Price Competition. 52.216-29... Proposal Requirements—Non-Commercial Item Acquisition With Adequate Price Competition (FEB 2007) (a) The... Time-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition With Adequate Price...
Stratigraphy of the late Cenozoic sediments beneath the 216-B and C crib facilities
International Nuclear Information System (INIS)
Fecht, K.R.; Last, G.V.; Marratt, M.C.
1979-02-01
The stratigraphy of the late Cenozoic sediments beneath the 216-B and C Crib Facilities is presented as lithofacies cross sections and is based on textural variations of the sedimentary sequence lying above the basalt bedrock. The primary source of data in this study is geologic information obtained from well drilling operations and geophysical logging. Stratigraphic interpretations are based primarily on textural analysis and visual examination of sediment samples and supplemented by drillers logs and geophysical logs
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Law enforcement activities and 7(k... ACT Exemptions and Exclusions § 551.216 Law enforcement activities and 7(k) coverage for FLSA pay and... section 7(k) of the Act apply to certain categories of law enforcement employees based on appropriate...
40 CFR 265 interim status indicator-evaluation ground-water monitoring plan for the 216-B-63 trench
International Nuclear Information System (INIS)
Bjornstad, B.N.; Dudziak, S.
1989-03-01
This document outlines a ground-water monitoring plan for the 216-B-63 trench located in the northeast corner of the 200-East Area on the Hanford Site in southeastern Washington State. It has been determined that hazardous materials (corrosives) were disposed of to the trench during past operations. Installation of an interim-status ground-water monitoring system is required to determine whether hazardous chemicals are leaching to the ground water from beneath the trench. This document summarizes the existing data that are available from near the 216-B-63 trench and presents a plan to determine the extent of ground-water contamination, if any, derived from the trench. The plan calls for the installation of four new monitoring wells located near the west end of the trench. These wells will be used to monitor ground-water levels and water quality immediately adjacent to the trench. Two existing RCRA monitoring wells, which are located near the trench and hydraulically upgradient of it, will be used as background wells. 46 refs., 15 figs., 12 tabs
International Nuclear Information System (INIS)
1981-01-01
This Decree issued by the Minister of Health approves an amended list of insanitary industries which are subject to certain obligations under Section 216 of the Health Code of 1934. The amendments concern certain nuclear plants and laboratories. The 1981 Decree modifies a previous Decree of 1976. (NEA) [fr
40 CFR 80.216 - What standards apply to gasoline produced or imported for use in the GPA?
2010-07-01
... Geographic Phase-in Program § 80.216 What standards apply to gasoline produced or imported for use in the GPA? (a) The refinery or importer annual average sulfur standard for gasoline produced or imported for use...), shall be 150.00 ppm. (b) The per-gallon cap standard for gasoline produced or imported for use in the...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe requirements for tuna... MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.92 Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels. (a) U.S...
International Nuclear Information System (INIS)
Buelt, J.L.; Conbere, W.; Freshley, M.D.; Hicks, R.J.; Kuhn, W.L.; Lamar, D.A.; Serne, R.J.; Smoot, J.L.
1988-03-01
Impact from past and potential future discharges of ammoniated water to the 216-A-36B crib have on groundwater and river concentrations of hazardous chemical constitutents are studied. Until August 1987, the 216-A-36B crib, located in the 200-East Area of the Hanford Site, accepted ammoniated water discharges. Although this study addresses known hazardous chemical constituents associated with such discharges, the primary concern is the discharge of NH 4 OH because of its microbiological conversion to NO 2 /sup /minus// and NO 3 /sup /minus//. As a result of fuel decladding operations, material balance calculations indicate that NH 4 OH has been discharged to the 216-A-36B crib in amounts that exceed reportable quantities under the Comprehensive Environmental Response, Compensation and Liability Act of 1980. Although flow to the crib is relatively constant, the estimated NH 4 OH discharge varies from negligible to a maximum of 10,000 g-molesh. Because these discharges are intermittent, the concentration delivered to the groundwater is a function of soil sorption, microbiological conversion rates of NH 4 + to NO 2 /sup /minus// and NO 3 /sup /minus//, and groundwater dispersion. This report provides results based on the assumptions of maximum, nominal, and discountinued NH 4 OH discharges to the crib. Consequently, the results show maximum and realistic estimates of NH 4 + , NO 2 /sup /minus// and NO 3 /sup /minus// concentrations in the groundwater
Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area
International Nuclear Information System (INIS)
Johnson, V.G.
1993-10-01
As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells
Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area
Energy Technology Data Exchange (ETDEWEB)
Johnson, V.G.
1993-10-01
As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells.
2010-01-01
... Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.216 How does OPM...
Fokkema, E; Groen, HJM; Uges, DRA; Weil, C; Smith, IE
1999-01-01
Purpose: This multicenter phase II trial wets performed to determine tumor efficacy and tolerance of the oral platinum drug JM216 in patients with small-cell lung cancer (SCLC). Patients and Methods: patients with SCLC limited disease unfit for intensive chemotherapy or those with extensive disease
Directory of Open Access Journals (Sweden)
Flørenes Vivi
2010-05-01
Full Text Available Abstract Background CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. Methods Expression of CDC25A, CDC25B, CDC25C and phosphorylated (phospho-CDC25C (Ser216 were examined in 300 vulvar carcinomas using immunohistochemistry. Western blot analysis was utilized to demonstrate CDC25s expression in vulvar cancer cell lines. Kinase and phosphatase assays were performed to exclude cross reactivity among CDC25s isoform antibodies. Results High nuclear CDC25A and CDC25B expression were observed in 51% and 16% of the vulvar carcinomas, respectively, whereas high cytoplasmic CDC25C expression was seen in 63% of the cases. In cytoplasm, nucleus and cytoplasm/nucleus high phospho-CDC25C (Ser216 expression was identified in 50%, 70% and 77% of the carcinomas, respectively. High expression of CDC25s correlated significantly with malignant features, including poor differentiation and infiltration of vessel for CDC25B, high FIGO stage, presence of lymph node metastases, large tumor diameter, poor differentiation for CDC25C and high FIGO stage, large tumor diameter, deep invasion and poor differentiation for phospho-CDC25C (Ser216. In univariate analysis, high expression of phospho-CDC25C (Ser216 was correlated with poor disease-specific survival (p = 0.04. However, such an association was annulled in multivariate analysis. Conclusions Our results suggest that CDC25C and phospho-CDC25C (Ser216 play a crucial role and CDC25B a minor role in the pathogenesis and/or progression of vulvar carcinomas. CDC25B, CDC25C and phospho-CDC25C (Ser216 were associated with
International Nuclear Information System (INIS)
Wang, Zhihui; Trope, Claes G; Flørenes, Vivi Ann; Suo, Zhenhe; Nesland, Jahn M; Holm, Ruth
2010-01-01
CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. Expression of CDC25A, CDC25B, CDC25C and phosphorylated (phospho)-CDC25C (Ser216) were examined in 300 vulvar carcinomas using immunohistochemistry. Western blot analysis was utilized to demonstrate CDC25s expression in vulvar cancer cell lines. Kinase and phosphatase assays were performed to exclude cross reactivity among CDC25s isoform antibodies. High nuclear CDC25A and CDC25B expression were observed in 51% and 16% of the vulvar carcinomas, respectively, whereas high cytoplasmic CDC25C expression was seen in 63% of the cases. In cytoplasm, nucleus and cytoplasm/nucleus high phospho-CDC25C (Ser216) expression was identified in 50%, 70% and 77% of the carcinomas, respectively. High expression of CDC25s correlated significantly with malignant features, including poor differentiation and infiltration of vessel for CDC25B, high FIGO stage, presence of lymph node metastases, large tumor diameter, poor differentiation for CDC25C and high FIGO stage, large tumor diameter, deep invasion and poor differentiation for phospho-CDC25C (Ser216). In univariate analysis, high expression of phospho-CDC25C (Ser216) was correlated with poor disease-specific survival (p = 0.04). However, such an association was annulled in multivariate analysis. Our results suggest that CDC25C and phospho-CDC25C (Ser216) play a crucial role and CDC25B a minor role in the pathogenesis and/or progression of vulvar carcinomas. CDC25B, CDC25C and phospho-CDC25C (Ser216) were associated with malignant features and aggressive cancer phenotypes. However, the
Ground water impact assessment report for the 216-B-3 Pond system
International Nuclear Information System (INIS)
Johnson, V.G.; Law, A.G.; Reidel, S.P.; Evelo, S.D.; Barnett, D.B.; Sweeney, M.D.
1995-01-01
Ground water impact assessments were required for a number of liquid effluent receiving sites according to the Hanford Federal Facility Agreement and Consent Order Milestones M-17-00A and M-17-00B, as agreed upon by the US Department of Energy. This report is one of the last three assessments required and addresses the impact of continued discharge of uncontaminated wastewater to the 216-B-3C expansion lobe of the B Pond system in the 200 East Area until June 1997. Evaluation of past and projected effluent volumes and composition, geohydrology of the receiving site, and contaminant plume distribution patterns, combined with ground water modeling, were used to assess both changes in ground water flow regime and contaminant-related impacts
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
Actinide occurrences in sediments following ground disposal of acid wastes at 216-Z-9
International Nuclear Information System (INIS)
Ames, L.L.
1976-01-01
Liquid acid wastes from a Pu recovery facility at Hanford were released to the ground via structures collectively termed trenches from 1955 through 1962. Data are presented from a study of the microdistribution of Am and Pu in samples from the 216-Z-9 trench. Solution sediment relationships and associated actinide removal mechanisms under acid conditions were studied. Core wells were drilled into the sediments in which this covered trench is located and in the immediate vicinity to obtain samples for quantitative mineralogical analysis and comparison of sediments from various depths of contaminated and noncontaminated areas. Analytical techniques are described and results are reported
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Description of work for 216-U-Pond cone penetrometer demonstration
International Nuclear Information System (INIS)
Kelty, G.G.
1993-01-01
This description of work details the Proposed field activities associated with Cone Penetrometer (CPT) work at the 216-U-10 Pond (U-10 Pond) in the 200 West Area and will serve as a field guide for those performing the work. The U-10 Pond was constructed in 1944 to receive low-level liquid effluent from the various chemical reprocessing facilities within the 200 West Area. The U-10 Pond covered 30 acres and received approximately 4.3 x 10 10 gal of contaminated liquid. Sampling conducted in 1980 indicated that the most significant radionuclides were 90 Sr, 137 Cs, plutonium, and uranium (DOE-RL 1993). The pond was deactivated and stabilized in 1985 with clean fill dirt. The thickness of the stabilization cover is variable across the former pond and ranges between 2 ft near the pond margins and delta area to 8 feet in the deepest section of the pond. The purpose of this work is to establish the extent of contamination beneath the U-10 pond
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
2010-01-01
... Witnesses in Judicial or Administrative Proceedings § 1.216 Appearance as a witness or production of... employee of USDA served with a valid summons, subpoena, or other compulsory process demanding his or her... States in a judicial or administrative proceeding in which the United States is a party, shall promptly...
Energy Technology Data Exchange (ETDEWEB)
Kasper, R.B.; Kay, M.A.; Bruns, L.E.; Stokes, J.A.; Steinman, D.K.; Adams, J.
1980-11-01
A prototype urainium borehole logging system, developed for uranium exploration, was modified for Pu assay and testing at the site. It uses the delayed fission neutron (DFN) method. It was tested in a retired Pu facility, the 216-Z-1A Crib. General agreement between laboratory determined Pu concentrations in sediment samples and neutron flux measurements was found for the relative distribution with depth.
Multi-Frequency Monitoring of the Flat Spectrum Radio Quasar PKS 1222+216 in 2008–2015
Directory of Open Access Journals (Sweden)
Ivan Troitskiy
2016-11-01
Full Text Available We analyze the broadband activity of the flat spectrum radio quasar PKS 1222+216 from 2008 to 2015 using multi-frequency monitoring which involves γ-ray data from the Fermi Large Area Telescope, total intensity and linear polarization observations from different optical telescopes in R band, and imaging of the inner jet structure with the Very Long Baseline Array (VLBA at 43 GHz. During the observations, the source showed several dramatic flares at γ rays and optical bands, with the rising branch of a γ-ray flare accompanied by a rapid rotation of the polarization position angle (EVPA, a fast increase of the degree of polarization in the optical band, brightening of the VLBI core, and appearance of a new superluminal component in the parsec-scale jet. The rapid variability of the optical linear polarization may be explained by a strong turbulence in the jet plasma. We find a correlation between the γ rays, optical R band, and 43 GHz variability on a long-term scale (months and years, and a good general alignment between EVPAs in R band and at 43 GHz, while the correlation between short-term variations (days and weeks is weaker. Synchronous activity across the bands supports the idea that the emission regions responsible for the γ-ray and optical flares are co-spatial and located in the vicinity of the mm-wave core of the parsec-scale jet. However, these connections do not completely explain the challenging behaviour of PKS 1222+216, since there are some γ-ray flares which are not accompanied by jet events, and vice versa. We need a continuation of multi-frequency monitoring along with high resolution imaging of the parsec-scale jet to understand in detail the origin of high energy emission in blazars.
Regulation of UGT2B Expression and Activity by miR-216b-5p in Liver Cancer Cell Lines
Dluzen, Douglas F.; Sutliff, Aimee K.; Chen, Gang; Watson, Christy J. W.; Ishmael, Faoud T.; Lazarus, Philip
2016-01-01
The UDP-glucuronosyltransferase (UGT) 2B enzymes are important in the detoxification of a variety of endogenous and exogenous compounds, including many hormones, drugs, and carcinogens. Identifying novel mechanisms governing their expression is important in understanding patient-specific response to drugs and cancer risk factors. In silico prediction algorithm programs were used to screen for microRNAs (miRNAs) as potential regulators of UGT2B enzymes, with miR-216b-5p identified as a potenti...
Groundwater monitoring plan for the Hanford Site 216-B-3 pond RCRA facility
International Nuclear Information System (INIS)
Barnett, D.B.; Chou, C.J.
1998-06-01
The 216-B-3 pond system was a series of ponds for disposal of liquid effluent from past Hanford production facilities. In operation since 1945, the B Pond system has been a RCRA facility since 1986, with Resource Conservation and Recovery Act (RCRA) interim-status groundwater monitoring in place since 1988. In 1994, discharges were diverted from the main pond, where the greatest potential for contamination was thought to reside, to the 3C expansion pond. In 1997, all discharges to the pond system were discontinued. In 1990, the B Pond system was elevated from detection groundwater monitoring to an assessment-level status because total organic halogens and total organic carbon were found to exceed critical means in two wells. Subsequent groundwater quality assessment failed to find any specific hazardous waste contaminant that could have accounted for the exceedances, which were largely isolated in occurrence. Thus, it was recommended that the facility be returned to detection-level monitoring
Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279
Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS
2018-01-01
Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Study of two photon production process in proton-proton collisions at 216 MeV
International Nuclear Information System (INIS)
Khrykin, A.S.
2002-01-01
The energy spectrum for high energy γ-rays (Eγ ≥ 10 MeV) from the process pp → γγX emitted at 90 deg. in the laboratory frame has been measured at 216 MeV. The resulting photon energy spectrum extracted from γ - γ coincidence events consists of a narrow peak (5.3σ) at a photon energy of about 24 MeV and a relatively broad peak (3.5σ) in the energy range of (50 - 70) MeV. This behavior of the photon energy spectrum is interpreted as a signature of the exotic dibaryon resonance d 1 * with a mass of about 1956 MeV which is assumed to be formed in the radiative process pp → γd 1 * followed by its electromagnetic decay via the d 1 * → ppγ mode. The experimental spectrum is compared with those obtained by means of Monte Carlo simulations
H i Absorption in the Steep-Spectrum Superluminal Quasar 3C 216.
Pihlström; Vermeulen; Taylor; Conway
1999-11-01
The search for H i absorption in strong compact steep-spectrum sources is a natural way to probe the neutral gas contents in young radio sources. In turn, this may provide information about the evolution of powerful radio sources. The recently improved capabilities of the Westerbork Synthesis Radio Telescope have made it possible to detect a 0.31% (19 mJy) deep neutral atomic hydrogen absorption line associated with the steep-spectrum superluminal quasar 3C 216. The redshift (z=0.67) of the source shifts the frequency of the 21 cm line down to the ultra-high-frequency (UHF) band (850 MHz). The exact location of the H i-absorbing gas remains to be determined by spectral line VLBI observations at 850 MHz. We cannot exclude that the gas might be extended on galactic scales, but we think it is more likely to be located in the central kiloparsec. Constraints from the lack of X-ray absorption probably rule out obscuration of the core region, and we argue that the most plausible site for the H i absorption is in the jet-cloud interaction observed in this source.
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
Controlling liquid pool depth in VAR of a 21.6 cm diameter ingot of Alloy 718
Lopez, Felipe; Beaman, Joseph; Williamson, Rodney; Taleff, Eric; Watt, Trevor
It is believed that the final microstructure in vacuum arc remelted (VAR) ingots is strongly influenced by the molten metal pool profile. Thus, if the pool profile was properly controlled during the melt then defect-free microstructures would be obtained. The recent development of a reduced-order model of VAR solidification allowed the design of a pool depth controller to accomplish this task. The controller used a linear quadratic regulator and a Kalman filter to stabilize the melt pool solidification front under the effect of uncertain process dynamics and noisy measurements. Basic Axisymmetric Remelting (BAR), a high-fidelity VAR ingot model, was used in real time to provide pool depth measurements that were incorporated in the control loop. The controller was tested at Los Alamos National Laboratory in a 21.6 diameter Alloy 718 ingot. Details of the controller design will be presented, along with comparisons to experimentally-measured pool depths.
International Nuclear Information System (INIS)
1994-09-01
This document coordinates a Resource Conservation and Recovery Act (RCRA) past-practice work plan for the 200-BP-11 Operable Unit and a RCRA closure/postclosure plan for the 216-B-3 Main Pond and 216-B-3-3 Ditch [treatment, storage, and/or disposal (TSD) unit]. Both RCRA TSD and past-practice waste management units are contained within the 200-BP-11 Operable Unit. The 200-BP-11 Operable Unit is a source operable unit located on the east side of the B Plant Source Aggregate Area in the 200 East Area of the Hanford Site. The operable unit lies just east of the 200 East Area perimeter fence and encompass approximately 476 hectares (1,175 acres). Source operable units include waste management units that are potential sources of radioactive and/or hazardous substance contamination. Source waste management units are categorized in the Hanford Federal Facility Agreement and Consent Order as either RCRA TSD, RCRA past-practice, or Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) past-practice. As listed below and in the Tri-Party Agreement, the 200-BP-11 Operable Unit contains five RCRA past-practice and five RCRA TSD waste management units. Additionally, for RCRA TSD permitting purposes, the RCRA TSD waste management units are subdivided into two RCRA TSD units
Rothwangl, S.
2009-08-01
This article explains how the Metonic cycle is at the base of the period of 216 years Pythagoras believed in being reborn after that period. It shows how this period calendrically is related to other mythological worldviews such as the Phoenix myth, the Hebrean Hazon Gabriel, and the Christian dogma of resurrection on the third day.
Evaluation report on CCTF Core-II reflood test C2-16 (Run 76)
International Nuclear Information System (INIS)
Iguchi, Tadashi; Akimoto, Hajime; Okubo, Tsutomu; Hojo, Tsuneyuki; Murao, Yoshio; Sugimoto, Jun.
1987-03-01
This report presents the result of the upper plenum injection (UPI) test C2-16 (Run 76), which was conducted on October 23, 1984, with the Cylindrical Core Test Facility (CCTF) at Japan Atomic Energy Research Institute (JAERI). The CCTF is a 1/21.4 scale model of a 1,100 MWe PWR with four loop active components to provide information on the system and core thermo-hydrodynamics during reflood. The objectives of the test are to investigate the reflood phenomena with single failure UPI condition and to investigate the effect of the asymmetry of UPI on the reflood phenomena. The test was performed with an asymmetric UPI condition at the injection rate simulating single failure of LPCI pumps. It was observed that, (1) a UPI test simulating no LPCI pump failure gave the slightly lower peak clad temperature than a UPI test simulating single LPCI pump failure, indicating that single LPCI pump failure assumption is conserrative for UPI condition, and (2) an asymmetric UPI lead to a higher core water accumulation and then a higher heat transfer coefficient, resultantly a lower peak clad temperature than a symmetric UPI, indicating that asymmetric UPI does not lead to a poorer core cooling than symmetric UPI. (author)
Influence of intermartensitic transitions on transport properties of Ni$_{2.16}Mn_{0.84}$Ga alloy
Khovailo, V V; Wedel, C; Takagi, T; Abe, T; Sugiyama, K
2004-01-01
Magnetic, transport, and x-ray diffraction measurements of ferromagnetic shape memory alloy Ni$_{2.16}$Mn$_{0.84}$Ga revealed that this alloy undergoes an intermartensitic transition upon cooling, whereas no such a transition is observed upon subsequent heating. The difference in the modulation of the martensite forming upon cooling from the high-temperature austenitic state [5-layered (5M) martensite], and the martensite forming upon the intermartensitic transition [7-layered (7M) martensite] strongly affects the magnetic and transport properties of the alloy and results in a large thermal hysteresis of the resistivity $\\rho$ and magnetization $M$. The intermartensitic transition has an especially marked influence on the transport properties, as is evident from a large difference in the resistivity of the 5M and 7M martensite, $(\\rho_{\\mathrm{5M}} - \\rho_{\\mathrm{7M}})/\\rho _{\\mathrm{5M}} \\approx 15%$, which is larger than the jump of resistivity at the martensitic transition from the cubic austenitic phase ...
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
Numerical study on effect of boundary layer trips on aerodynamic performance of E216 airfoil
Directory of Open Access Journals (Sweden)
B.K. Sreejith
2018-02-01
Full Text Available Simulation is carried out to find the performance of airfoil E216 using Transition γ-Reθ model at Reynolds number of 100,000. Flow behaviour and effect of angle of attack (AOA on laminar separation bubble (LSB formation are examined. The results are validated with wind tunnel experimental results. LSB formation is clearly spotted in the velocity vector plot and coefficient of pressure distribution over airfoil. LSB moved upstream towards the leading edge with increase in AOA. Effect of boundary layer trip on LSB formation over the airfoil and performance of airfoil are studied. Two different trip locations, 17% of chord and 10% of chord from leading edge, and different trip heights (0.3 mm, 0.5 mm, 0.7 mm, 1 mm are investigated in this study. Results showed that boundary layer trip could eliminate LSB partially or completely and improve aerodynamic performance of the airfoil. Maximum improvement in drag by 15.48% and lift to drag ratio by 21.62% are obtained at angle of attack of 60. In all the cases, improvement in performance is observed only up to trip height of 0.5 mm.
Energy Technology Data Exchange (ETDEWEB)
Lindenmeier, Clark W.; Serne, R JEFFREY.; Bjornstad, Bruce N.; Last, George V.; Lanigan, David C.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.
2002-12-01
This report summarizes data collected from samples in borehole C3103. Borehole C3103 was completed to further characterize the nature and extent of vadose zone contaminants supplied by intentional liquid discharges into the crib 216-B7A/7B between 1954 and 1967. These cribs received dilute waste streams from the bismuth phosphate fuel reprocessing program in the 1950's and decontamination waste in the 1960's. Elevated concentrations of several constituents were primarily measured at different depth intervals. The primary radionuclides present in this borehole are cesium-137 and uranium near the top of the borehole. Chemical characteristics attributed to wastewater-soil interaction at different locations within this zone are elevated pH, sodium, fluoride, carbonate nitrate, and sulphate
Results of RCRA groundwater quality assessment at the 216-B-3 Pond Facility
International Nuclear Information System (INIS)
Barnett, D.B.; Teel, S.S.
1997-06-01
This document describes a groundwater quality assessment of the 216-B-3 pond system, a Resources Conservation and Recovery act of 1976 (RCRA) waste facility. In 1990, sampling and chemical analysis of groundwater underlying the facility indicated that the contamination indicator parameters, total organic halogens (TOX), and total organic carbon (TOC) had exceeded established limits in two wells. This discovery placed the facility into RCRA groundwater assessment status and subsequently led to a more detailed hydrochemical analysis of groundwater underlying the facility. Comprehensive chemical analyses of groundwater samples from 1994 through 1996 revealed one compound, tris (2-chloroethyl) phosphate (TRIS2CH), that may have contributed to elevated TOX concentrations. No compound was identified as a contributor to TOC. Detailed evaluations of TOX, TOC, and TRIS2CH and comparison of occurrences of these parameters led to conclusions that (1) with few exceptions, these constituents occur at low concentrations below or near limits of quantitation; (2) it is problematic whether the low concentrations of TRIS2CH represent a contaminant originating from the facility or if it is a product of well construction; and (3) given the low and diminishing concentration of TOX, TOC, and TRIS2CH, no further investigation into the occurrent of these constituents is justified. Continued groundwater monitoring should include an immediate recalculation of background critical means of upgradient/downgradient comparisons and a return to seminannual groundwater monitoring under a RCRA indicator parameter evaluation program
Energy Technology Data Exchange (ETDEWEB)
Khanna, A. [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Dutta, P.S., E-mail: duttap@rpi.edu [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)
2015-05-15
Red phosphors with narrow emission around 615 nm (with FWHM~5–10 nm) having chemical compositions of A{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} (A=Mg, Sr) have been found to exhibit the highest luminescence amongst the molybdate–tungstate family when excited by sources in the 380–420 nm wavelength range. Thus they are most suitable for enhancing color rendering index and lowering color temperature in phosphor converted white LEDs (pc-WLEDs) with near-UV/blue LED excitation sources. The excitation band edge in the near UV/blue wavelength in the reported phosphor has been attributed to the coordination environment of the transition metal ion (Mo{sup 6+}, W{sup 6+}) and host crystal structure. Furthermore the quantum efficiency of the phosphors has been enhanced by adjusting activator concentration, suitable compositional alloying using substitutional alkaline earth metal cations and charge compensation mechanisms. - Graphical abstract: The charge transfer excitation of orthorhombic Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} is significantly higher than tetragonal CaMoO{sub 4}: Eu{sup 3+} phosphors making Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} prime candidates for fabrication of warm white phosphor-converted LEDs. - Highlights: • LED excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} phosphors were synthesized. • These phosphors are 10 times more intense than CaMoO{sub 4}: Eu{sup 3+} red phosphors. • Their intensity and efficiency were enhanced by materials optimization techniques. • Such techniques include compositional alloying, charge compensation, etc.
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
Claudia Marcelloni
2006-01-01
The Big-Wheel TGC-1 being moved against the Barrel Muon Spectrometer. The 216 trigger chambers are supported by a thin structure of 22 m diameter and 0.4 m thickness, weighting 44 tons and supported on two rails.
International Nuclear Information System (INIS)
Liu, G D; Dai, X F; Luo, H Z; Liu, H Y; Meng, F B; Li, Y; Yu, X; Chen, J L; Wu, G H
2011-01-01
The effect of the internal stress on the two-way shape memory in Co 49 Ni 21.6 Ga 29.4 single crystals has been investigated. We found that the internal stress generated natively by the solidifying process works as a tensile force along the growth direction. Applying different compressive pre-stresses along the [0 0 1] direction, the shape-memory strain can be continuously changed from +1.0% to -2.3%. In the [1 1 0] direction, the strain monotonically increases from -2.0% to -4.0% due to a strong detwinning produced by the consistent effect of the external and internal stresses.
Directory of Open Access Journals (Sweden)
Luciana Britto
2010-01-01
Full Text Available The outcome of Hodgkin's lymphoma (HL has markedly improved over the last few decades, placing HL among the human cancers with highest cure rates. However, data about treatment outcomes in developing countries are scarce. From 1996 to 2005, 370 consecutive patients with HL treated in three public institutions in Rio de Janeiro were identified. A total of 216 patients who presented with advanced stage (IIB-IV HL were selected for the present analysis. Patients with advanced disease were treated with ABVD, complemented or not by radiation therapy. The median follow-up time of survivors was 6.3 years (1-11.8. Fifteen patients died during first-line treatment. The complete remission rate was 80%. The 5-year progression-free survival (PFS and the 5-year overall survival (OS probabilities were 69% and 83%, respectively. The 5-year PFS in low-risk and high-risk patients were 81% and 62% (p=0.003, respectively. The 5-year OS in low-risk and high-risk International Prognostic Score patients were 89% and 78% (p=0.02, respectively. The present study provides a representative estimate of current treatment results for advanced HL in public institutions in an urban area in Brazil. It is clear that full treatment can be given to most patients, although those with very low socio-economic status might require special attention and support. Since Brazil is a large country, with substantial interregional heterogeneity, a nationwide registry of HL patients is currently being implemented.Os resultados do tratamento do linfoma de Hodgkin (LH melhoraram substancialmente ao longo das últimas décadas e tornaram o LH uma das neoplasias humanas com maior chance de cura. Entretanto, os dados sobre tratamento em países em desenvolvimento são escassos. Entre 1996 e 2005, 370 pacientes consecutivos com LH tratados em três instituições públicas no Rio de Janeiro foram identificados. Destes, 216 em estádio avançado (IIB-IV foram selecionados para esta análise. Os
Ohta, T; Ishikura, S; Shintani, S; Usami, N; Hara, A
2000-01-01
Human dihydrodiol dehydrogenase with 3alpha-hydroxysteroid dehydrogenase activity exists in four forms (AKR1C1-1C4) that belong to the aldo-keto reductase (AKR) family. Recent crystallographic studies on the other proteins in this family have indicated a role for a tyrosine residue (corresponding to position 216 in these isoenzymes) in stacking the nicotinamide ring of the coenzyme. This tyrosine residue is conserved in most AKR family members including AKR1C1-1C3, but is replaced with histidine in AKR1C4 and phenylalanine in some AKR members. In the present study we prepared mutant enzymes of AKR1C4 in which His-216 was replaced with tyrosine or phenylalanine. The two mutations decreased 3-fold the K(m) for NADP(+) and differently influenced the K(m) and k(cat) for substrates depending on their structures. The kinetic constants for bile acids with a 12alpha-hydroxy group were decreased 1.5-7-fold and those for the other substrates were increased 1.3-9-fold. The mutation also yielded different changes in sensitivity to competitive inhibitors such as hexoestrol analogues, 17beta-oestradiol, phenolphthalein and flufenamic acid and 3,5,3', 5'-tetraiodothyropropionic acid analogues. Furthermore, the mutation decreased the stimulatory effects of the enzyme activity by sulphobromophthalein, clofibric acid and thyroxine, which increased the K(m) for the coenzyme and substrate of the mutant enzymes more highly than those of the wild-type enzyme. These results indicate the importance of this histidine residue in creating the cavity of the substrate-binding site of AKR1C4 through the orientation of the nicotinamide ring of the coenzyme, as well as its involvement in the conformational change by binding non-essential activators. PMID:11104674
Directory of Open Access Journals (Sweden)
Marcelo Alvares de Oliveira
2013-03-01
Full Text Available O presente trabalho teve por objetivo avaliar os parâmetros físico-químicos e os processos para a produção de brotos de soja a partir de sementes da cultivar BRS 216, bem como sua composição química e aceitabilidade. Foram avaliados o comprimento e o peso dos brotos viáveis, a composição centesimal e os teores de isoflavonas e de inibidor de tripsina. O desenho experimental foi ao acaso com três repetições e os tratamentos foram avaliados num esquema fatorial 3 × 3: três frequências de irrigação (a cada quatro, oito e 12 horas e três períodos de crescimento (cinco, seis e sete dias. O teste de aceitabilidade dos brotos de soja foi realizado utilizando-se a escala hedônica estruturada de nove pontos, avaliando-se cor, aparência, odor, textura, sabor e avaliação global, além da intenção de compra. A frequência de irrigação com intervalos de quatro horas e o período de sete dias de crescimento foram ideais para produção dos brotos de soja, favorecendo maior produtividade, teores mais elevados de proteínas e menores teores de inibidor de tripsina. O índice de aceitabilidade dos brotos de soja foi superior a 70 em todas as características avaliadas, com exceção do odor.The aim of the present study was to evaluate the physical and chemical parameters and process for the production of soybean sprouts from the BRS 216 cultivar, as well as determining their chemical composition and acceptability. The length and weight of viable sprouts, proximate composition, and the isoflavone and trypsin inhibitor contents were evaluated. The experimental design was completely randomized with three replications, and the treatments were evaluated using a 3 × 3 factorial design: three irrigation frequencies (four, eight and 12 hours and three growth periods (five, six and seven days. The soybean sprout acceptability was determined using a nine point structured hedonic scale, evaluating colour, appearance, aroma, texture, flavour
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
Helling, T S; Gyles, N R; Eisenstein, C L; Soracco, C A
1989-10-01
Tube thoracostomy (TT) is required in the treatment of many blunt and penetrating injuries of the chest. In addition to complications from the injuries, TT may contribute to morbidity by introducing microorganisms into the pleural space or by incomplete lung expansion and evacuation of pleural blood. We have attempted to assess the impact of TT following penetrating and blunt thoracic trauma by examining a consecutive series of 216 patients seen at two urban trauma centers with such injuries who required TT over a 30-month period. Ninety-four patients suffered blunt chest trauma; 122 patients were victims of penetrating wounds. Patients with blunt injuries had longer ventilator requirements (12.6 +/- 14 days vs. 3.7 +/- 7.1 days, p = 0.003), longer intensive care stays (12.2 +/- 12.5 days vs. 4.1 +/- 7.5 days, p = 0.001), and longer periods of TT, (6.5 +/- 4.9 days vs. 5.2 +/- 4.5 days, p = 0.018). Empyema occurred in six patients (3%). Residual hemothorax was found in 39 patients (18%), seven of whom required decortication. Recurrent pneumothorax developed in 51 patients (24%) and ten required repeat TT. Complications occurred in 78 patients (36%). Patients with blunt trauma experienced more complications (44%) than those with penetrating wounds (30%) (p = 0.04). However, only seven of 13 patients developing empyema or requiring decortication had blunt trauma. Despite longer requirements for mechanical ventilation, intensive care, and intubation, victims of blunt trauma seemed to have effective drainage of their pleural space by TT without increased risk of infectious complications.
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
Daumont, L.; Auwera, J. Vander; Teffo, J.-L.; Perevalov, V. I.; Tashkun, S. A.
2001-08-01
This work continues a series of publications devoted to the application of the effective operator approach to the vibrational-rotational treatment of linear triatomic molecules, aiming at the analysis and prediction of their infrared spectra. In that frame work, we have started a large-scale work aiming at the global description of line intensities of cold and hot bands of 14N216O in its ground electronic state in the spectral range above 3600 cm-1. In 14N216O, vibrational interacting levels group in polyads as a result of the relation 2ω1≈4ω2≈ω3 existing between the harmonic frequencies. The polyads are identified by the so-called polyad number P=2V1+V2+4V3. The work described in the present paper concerns bands associated with transitions corresponding to ΔP=7, 8, and 9. The absorption spectra of N2O at room temperature have been recorded at a resolution of 0.007 cm-1 in the range from 4300 to 5200 cm-1 using a Bruker IFS120HR Fourier transform spectrometer. Sample pressure/absorption path length products ranging from 7 to 1753 mbar × m have been used. More than 3000 absolute line intensities have been measured in 66 different bands belonging to the ΔP=7, 8, and 9 series. Dicke narrowing has been observed in the high-pressure spectra. Using wavefunctions previously determined from a global fit of an effective Hamiltonian to about 18,000 line positions (S. A. Tashkun, V. I. Perevalov, and J.-L. Teffo to be published), the experimental intensities measured in this work and by R. A. Toth (J. Mol. Spectrosc.197, 158-187 (1999)) were fitted to 47 parameters of a corresponding effective dipole moment, with residuals very close to the experimental uncertainty. Exa mples are given showing that the modeling reproduces intensities of perturbed lines well.
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
An Investigation of Comet Hale-Bopp at 21.6 and 27.2 AU from the Sun
Kramer, Emily A.; Fernandez, Y. R.; Kelley, M. S.; Woodney, L. M.; Lisse, C. M.
2010-05-01
Comet Hale-Bopp offered us an unprecedented opportunity to observe a large, bright comet in great detail. Since its 1997 perihelion, continued observations have let us observe how its activity has changed over time. Here we present 2005 and 2008 Spitzer Space Telescope observations of Hale-Bopp that show coma and tail, which is uncommon given its heliocentric distance -- 21.6 AU in 2005 and 27.2 AU in 2008. We have images at 24 µm (obtained with MIPS, the Multiband Imaging Photometer for Spitzer) that show thermal emission from the dust, and we are using dynamical models [1,2] to explain the dust morphology and constrain the dust's properties. Preliminary work suggests that the motion of the dust cannot be solely due to the effects of gravity and radiation pressure, which generally are the dominant forces. We investigate the role of other possible driving forces such as the so-called rocket force [3]. Our science goals are to: understand the comet's activity mechanism, constrain the age of the dust, find the size of the grains, and compare properties of the dust we see now to those of the dust seen in the 1990s. Our overarching goal is to use Hale-Bopp and other distant, active comets to understand cometary activity and the structure of cometary nuclei, which is related to icy planetesimal formation and evolution. We acknowledge support from the NSF, NASA and the Spitzer Science Center for this work. References: [1] Kelley, M.S., et al. 2008, Icarus 193, 572, [2] Lisse, C.M., et al. 1998, ApJ 496, 971, [3] Reach, W.T., et al. 2009, Icarus 203, 571.
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
Letko, W; Denaci, H. G.; Freed, C
1943-01-01
Hinge-moment, lift, and pressure-distribution measurements were made in the two-dimensional test section of the NACA stability tunnel on a blunt-nose balance-type aileron on an NACA 66,2-216 airfoil at speeds up to 360 miles per hour corresponding to a Mach number of 0.475. The tests were made primarily to determine the effect of speed on the action of this type of aileron. The balance-nose radii of the aileron were varied from 0 to 0.02 of the airfoil chord and the gap width was varied from 0.0005 to 0.0107 of the airfoil chord. Tests were also made with the gap sealed.
Barthlott, Sabine; Schneider, Matthias; Hase, Frank; Blumenstock, Thomas; Kiel, Matthäus; Dubravica, Darko; García, Omaira E.; Sepúlveda, Eliezer; Mengistu Tsidu, Gizaw; Takele Kenea, Samuel; Grutter, Michel; Plaza-Medina, Eddy F.; Stremme, Wolfgang; Strong, Kim; Weaver, Dan; Palm, Mathias; Warneke, Thorsten; Notholt, Justus; Mahieu, Emmanuel; Servais, Christian; Jones, Nicholas; Griffith, David W. T.; Smale, Dan; Robinson, John
2017-01-01
We report on the ground-based FTIR (Fourier transform infrared) tropospheric water vapour isotopologue remote sensing data that have been recently made available via the database of NDACC (Network for the Detection of Atmospheric Composition Change; MUSICA/" target="_blank">ftp://ftp.cpc.ncep.noaa.gov/ndacc/MUSICA/) and via doi:10.5281/zenodo.48902. Currently, data are available for 12 globally distributed stations. They have been centrally retrieved and quality-filtered in the framework of the MUSICA project (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water). We explain particularities of retrieving the water vapour isotopologue state (vertical distribution of H216O, H218O, and HD16O) and reveal the need for a new metadata template for archiving FTIR isotopologue data. We describe the format of different data components and give recommendations for correct data usage. Data are provided as two data types. The first type is best-suited for tropospheric water vapour distribution studies disregarding different isotopologues (comparison with radiosonde data, analyses of water vapour variability and trends, etc.). The second type is needed for analysing moisture pathways by means of H2O, δD-pair distributions.
Abate, Misganaw; Lakew, Zufan
2006-01-01
to measure the magnitude of eclampsia and its maternal and perinatal outcome. A 5 years retrospective descriptive study was conducted on 216 eclamptic cases diagnosed, admitted and managed from October 1994 to September 1999 in the two teaching hospitals of Addis Ababa; namely Tikur Anbessa and St Paul's Hospitals. There were 257 mothers with eclampsia treated in the given period and 35741 deliveries making the incidence of eclampsia 7.1/1000 deliveries. Eighty-four women (38.9%) had any antenatal care, 157 (72.7%) were nulli-parous and 69 (31.8%) were aged below 20. Convulsion occurred ante-partum in 133 (61.6%), intrapartum in 49 (22.7%) and postpartum in 34 (15.7%) mothers. The most frequently sited symptoms before convulsion include headache in 83.8%, visual disturbance in 41.6% and epigastric pain in 38.4% of the cases. Ninety nine (45.8%) women were delivered by cesarean section making the cesarean section rate among eclamptic mothers significantly higher than the rate among the general population, which was 16.6% at the same period. (P = 0.0001). The multiple pregnancy rate was 5.7%, which was significantly higher than the rate among the general population of 1.5% at the same time. Seventy-four mothers had repeated convulsion after admission to the hospitals and initiation of the standard treatment. Twenty-eight mothers with eclampsia died making the case fatality rate 13%. Seven mothers (3.2%) died before delivery. Forty-four Stillbirths and twenty-five early neonatal deaths occurred making the perinatal mortality rate 312.2/1000 deliveries. Eclampsia is a common complication still associated with high level of maternal and perinatal mortality as well as morbidity. ANC coverage should be strengthened to detect preclampsia, and prevent eclampsia. Management in the hospital should be optimized to prevent recurrent convulsions and complications after admission.
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
Tashkun, S.A.; Perevalov, V.I.; Karlovets, E.V.; Kassi, S.; Campargue, A.
2016-01-01
In a recent work (Karlovets et al., 2016 [1]), we reported the measurement and rovibrational assignments of more than 3300 transitions belonging to 64 bands of five nitrous oxide isotopologues ("1"4N_2"1"6O, "1"4N"1"5N"1"6O, "1"5N"1"4N"1"6O, "1"4N_2"1"8O and "1"4N_2"1"7O) in the high sensitivity CRDS spectrum recorded in the 7915–8334 cm"−"1 spectral range. The assignments were performed by comparison with predictions of the effective Hamiltonian models developed for each isotopologue. In the present paper, the large amount of measurements from our previous work mentioned above and literature are gathered to refine the modeling of the nitrous oxide spectrum in two ways: (i) improvement of the intensity modeling for the principal isotopologue, "1"4N_2"1"6O, near 8000 cm"−"1 from a new fit of the relevant effective dipole moment parameters, (ii) global modeling of "1"4N_2"1"8O line positions from a new fit of the parameters of the global effective Hamiltonian using an exhaustive input dataset collected in the literature in the 12–8231 cm"−"1 region. The fitted set of 81 parameters allowed reproducing near 5800 measured line positions with an RMS deviation of 0.0016 cm"−"1. The dimensionless weighted standard deviation of the fit is 1.22. As an illustration of the improvement of the predictive capabilities of the obtained effective Hamiltonian, two new "1"4N_2"1"8O bands could be assigned in the CRDS spectrum in the 7915–8334 cm"−"1 spectral range. A line list at 296 K has been generated in the 0–10,700 cm"−"1 range for "1"4N_2"1"8O in natural abundance with a 10"−"3"0 cm/molecule intensity cutoff. - Highlights: • Line parameters of two new "1"4N_2"1"8O bands centered at 7966 cm"−"1 and at 8214 cm"−"1. • Refined sets of the "1"4N_2"1"6O effective dipole moment parameters for ΔP=13,14 series. • Global modeling of "1"4N_2"1"8O line positions and intensities in the 12–8231 cm"−"1 range. • 5800 observed of "1"4N_2"1"8O line positions
IRC +10 216 in 3D: morphology of a TP-AGB star envelope
Guélin, M.; Patel, N. A.; Bremer, M.; Cernicharo, J.; Castro-Carrizo, A.; Pety, J.; Fonfría, J. P.; Agúndez, M.; Santander-García, M.; Quintana-Lacaci, G.; Velilla Prieto, L.; Blundell, R.; Thaddeus, P.
2018-02-01
During their late pulsating phase, AGB stars expel most of their mass in the form of massive dusty envelopes, an event that largely controls the composition of interstellar matter. The envelopes, however, are distant and opaque to visible and NIR radiation: their structure remains poorly known and the mass-loss process poorly understood. Millimeter-wave interferometry, which combines the advantages of longer wavelength, high angular resolution and very high spectral resolution is the optimal investigative tool for this purpose. Mm waves pass through dust with almost no attenuation. Their spectrum is rich in molecular lines and hosts the fundamental lines of the ubiquitous CO molecule, allowing a tomographic reconstruction of the envelope structure. The circumstellar envelope IRC +10 216 and its central star, the C-rich TP-AGB star closest to the Sun, are the best objects for such an investigation. Two years ago, we reported the first detailed study of the CO(2-1) line emission in that envelope, made with the IRAM 30-m telescope. It revealed a series of dense gas shells, expanding at a uniform radial velocity. The limited resolution of the telescope (HPBW 11″) did not allow us to resolve the shell structure. We now report much higher angular resolution observations of CO(2-1), CO(1-0), CN(2-1) and C4H(24-23) made with the SMA, PdB and ALMA interferometers (with synthesized half-power beamwidths of 3″, 1″ and 0.3″, respectively). Although the envelope appears much more intricate at high resolution than with an 11″ beam, its prevailing structure remains a pattern of thin, nearly concentric shells. The average separation between the brightest CO shells is 16″ in the outer envelope, where it appears remarkably constant. Closer to the star (system with a period of 700 yr and a near face-on elliptical orbit. The companion fly-by triggers enhanced episodes of mass loss near periastron. The densification of the shell pattern observed in the central part of the
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
Lifescience Database Archive (English)
Full Text Available trep. 216 3e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3...H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510...165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3...C. 216 3e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. ...216 3e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloni
A virtual microscope for academic medical education: the pate project.
Brochhausen, Christoph; Winther, Hinrich B; Hundt, Christian; Schmitt, Volker H; Schömer, Elmar; Kirkpatrick, C James
2015-05-11
Whole-slide imaging (WSI) has become more prominent and continues to gain in importance in student teaching. Applications with different scope have been developed. Many of these applications have either technical or design shortcomings. To design a survey to determine student expectations of WSI applications for teaching histological and pathological diagnosis. To develop a new WSI application based on the findings of the survey. A total of 216 students were questioned about their experiences and expectations of WSI applications, as well as favorable and undesired features. The survey included 14 multiple choice and two essay questions. Based on the survey, we developed a new WSI application called Pate utilizing open source technologies. The survey sample included 216 students-62.0% (134) women and 36.1% (78) men. Out of 216 students, 4 (1.9%) did not disclose their gender. The best-known preexisting WSI applications included Mainzer Histo Maps (199/216, 92.1%), Histoweb Tübingen (16/216, 7.4%), and Histonet Ulm (8/216, 3.7%). Desired features for the students were latitude in the slides (190/216, 88.0%), histological (191/216, 88.4%) and pathological (186/216, 86.1%) annotations, points of interest (181/216, 83.8%), background information (146/216, 67.6%), and auxiliary informational texts (113/216, 52.3%). By contrast, a discussion forum was far less important (9/216, 4.2%) for the students. The survey revealed that the students appreciate a rich feature set, including WSI functionality, points of interest, auxiliary informational texts, and annotations. The development of Pate was significantly influenced by the findings of the survey. Although Pate currently has some issues with the Zoomify file format, it could be shown that Web technologies are capable of providing a high-performance WSI experience, as well as a rich feature set.
Kim, Bongyoung
2015-04-01
South Korea dispatches Korean nationals to partner developing countries as an Official Development Assistance (ODA) project through the Korea International Cooperation Agency (KOICA). In the health sector, KOICA dispatches international cooperation doctors (ICDs), nurses, physical therapists, radiologic technologists, nutritionists, medical laboratory technologists, occupational therapists, and dental hygienists. A total of 216 ICDs were dispatched over 19 times from 1995 until 2013. There were 19 areas of specialties among the ICDs. The most common specialty was internal medicine (61/216, 28.2%), the second most common specialty was general surgery (43/216, 19.9%), followed by oriental medicine (27/216, 12.5%), pediatrics (17/216, 7.9%), orthopedics (16/216, 7.4%), family medicine (16/216, 7.4%), and odontology (14/216, 6.5%). The ICDs have worked in 21 countries. KOICA dispatched the highest number of ICDs to Asia (97/216, 44.9%), followed by Africa (50/216, 23.1%), Latin America (34/216, 15.7%), the commonwealth of independent states (31/216, 14.4%), and Oceania (4/216, 1.9%). Nobody was dispatched to the Middle East. A total of 134 KOICA health professionals were dispatched to Peru from 1996 until October 1, 2014. Of these, 19.4% (26/134) were ICDs, 44.8% (60/216) were nurses, 20.1% (27/134) were physical therapists, 6.7% (9/134) were radiologic technologists, 2.2% (3/134) were nutritionists, and 6.7% (9/134) were medical laboratory. ICDs' specialties comprised internal medicine (13/26, 50%), family medicine (8/26, 30.8%), pediatrics (2/26, 7.7%), otorhinolaryngology (1/26, 3.8%), orthopedics (1/26, 3.8%), and oriental medicine (1/26, 3.8%). Most of the dispatched health professionals worked at institutions that were supported by KOICA. For this reason, the proportion of health professionals who worked at public health centers (PHCs) was the highest (58.2%, 78/134) when classified by workplace type. Other KOICA health professionals worked at hospitals
Lifescience Database Archive (English)
Full Text Available ector pDXA-3strep. 216 9e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 9e-54 2... X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 9e-54 2 AJ510165 |AJ510165.1 Cloning ...vector pDXA-3FLAG. 216 9e-54 2 X85118 |X85118.1 Artificial sequences cloning vect...or DNA pDXA-3C. 216 9e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 9e-54 2 AF...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 9e-54 2 X85120 |X85120.1 Artificial sequences cloning
Lifescience Database Archive (English)
Full Text Available pDXA-3strep. 216 7e-55 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 7e-55 2 X8512...2 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 7e-55 2 AJ510165... |AJ510165.1 Cloning vector pDXA-3FLAG. 216 7e-55 2 X85118 |X85118.1 Artificial sequences cloning vector DNA... pDXA-3C. 216 7e-55 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 7e-55 2 AF269236...120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 8e-55 2 AJ510166 |AJ510166.1 Cloning vector pDXA-
Vadose Zone Contaminant Fate and Transport Analysis for the 216-B-26 Trench
Energy Technology Data Exchange (ETDEWEB)
Ward, Andy L.; Gee, Glendon W.; Zhang, Z. F.; Keller, Jason M.
2004-10-14
The BC Cribs and Trenches, part of the 200 TW 1 OU waste sites, received about 30 Mgal of scavenged tank waste, with possibly the largest inventory of 99Tc ever disposed to the soil at Hanford and site remediation is being accelerated. The purpose of this work was to develop a conceptual model for contaminant fate and transport at the 216-B-26 Trench site to support identification and development and evaluation of remediation alternatives. Large concentrations of 99Tc high above the water table implicated stratigraphy in the control of the downward migration. The current conceptual model accounts for small-scale stratigraphy; site-specific changes soil properties; tilted layers; and lateral spreading. It assumes the layers are spatially continuous causing water and solutes to move laterally across the boundary if conditions permit. Water influx at the surface is assumed to be steady. Model parameters were generated with pedotransfer functions; these were coupled high resolution neutron moisture logs that provided information on the underlying heterogeneity on a scale of 3 inches. Two approaches were used to evaluate the impact of remedial options on transport. In the first, a 1-D convolution solution to the convective-dispersive equation was used, assuming steady flow. This model was used to predict future movement of the existing plume using the mean and depth dependent moisture content. In the second approach, the STOMP model was used to first predict the current plume distribution followed by its future migration. Redistribution of the 99Tc plume was simulated for the no-action alternative and on-site capping. Hypothetical caps limiting recharge to 1.0, 0.5, and 0.1 mm yr-1 were considered and assumed not to degrade in the long term. Results show that arrival time of the MCLs, the peak arrival time, and the arrival time of the center of mass increased with decreasing recharge rate. The 1-D convolution model is easy to apply and can easily accommodate initial
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Energy Technology Data Exchange (ETDEWEB)
De Marchi, Armanda, E-mail: armanda.demarchi@tiscali.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Prever, Elena Brach del, E-mail: elena.brach@unito.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Cavallo, Franco, E-mail: franco.cavallo@unito.it [Department of Public health and Paediatrics, University of Turin, Via Santena 5-bis, 10126 Torino (Italy); Pozza, Simona, E-mail: simona.pozza@tin.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Linari, Alessandra, E-mail: linaralessandra@libero.it [Department of Pathology, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, Regina Margherita Hospital, Piazza Polonia, 10126 Torino (Italy); Lombardo, Paolo, E-mail: pao.lombardo82@gmail.com [Department of DiagnosticImaging and Radiotherapy of the University of Turin, Azienda Ospedaliero-Universitaria Città della Salute e della Scienza di Torino, Via Genova 3, 10126 Torino (Italy); Comandone, Alessandro, E-mail: alessandro.comandone@gradenigo.it [Department of Oncology, Gradenigo Hospital, Corso Regina Margherita, 8/10.10153 Torino (Italy); Piana, Raimondo, E-mail: raimondo.piana@libero.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Faletti, Carlo [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy)
2015-01-15
Introduction: Musculoskeletal Soft Tissue Tumours (STT) are frequent heterogeneous lesions. Guidelines consider a mass larger than 5 cm and deep with respect to the deep fascia potentially malignant. Contrast Enhanced Ultrasound (CEUS) can detect both vascularity and tumour neoangiogenesis. We hypothesised that perfusion patterns and vascularisation time could improve the accuracy of CEUS in discriminating malignant tumours from benign lesions. Materials and methods: 216 STT were studied: 40% benign lesions, 60% malignant tumours, 56% in the lower limbs. Seven CEUS perfusion patterns and three types of vascularisation (arterial-venous uptake, absence of uptake) were applied. Accuracy was evaluated by comparing imaging with the histological diagnosis. Univariate and multivariate analysis, Chi-square test and t-test for independent variables were applied; significance was set at p < 0.05 level, 95% computed CI. Results: CEUS pattern 6 (inhomogeneous perfusion), arterial uptake and location in the lower limb were associated with high risk of malignancy. CEUS pattern has PPV 77%, rapidity of vascularisation PPV 69%; location in the limbs is the most sensitive indicator, but NPV 52%, PPV 65%. The combination of CEUS-pattern and vascularisation has 74% PPV, 60% NPV, 70% sensitivity. No correlation with size and location in relation to the deep fascia was found. Conclusion: US with CEUS qualitative analysis could be an accurate technique to identify potentially malignant STT, for which second line imaging and biopsy are indicated in Referral Centers. Intense inhomogeneous enhancement with avascular areas and rapid vascularisation time could be useful in discriminating benign from malignant SST, overall when the lower limbs are involved.
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
Lifescience Database Archive (English)
Full Text Available 4 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 3e-54 2... X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510165.1 Cloning ...vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 3e-54 2... X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 3e-54 2 AF...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloning
Lifescience Database Archive (English)
Full Text Available 64 |AJ510164.1 Cloning vector pDXA-3strep. 216 6e-54 2 X85119 |X85119.1 Artificial sequences cloning vector ...DNA pDXA-3H. 216 6e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 6e-54 2 AJ510...165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 6e-54 2 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 6e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA...X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 7e-54 2 AJ510166 |A
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
Lifescience Database Archive (English)
Full Text Available 630 e-177 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-55 2 X85119 |X85119.1 Artificial sequences cloning... vector DNA pDXA-3H. 216 8e-55 2 X85122 |X85122.1 Artificial sequences cloning...X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-55 2 X85123 |X85123.1 Artificial sequences cloning...FLAG, complete sequence. 216 8e-55 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 9
Lifescience Database Archive (English)
Full Text Available 4.1 Cloning vector pDXA-3strep. 216 3e-67 3 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H.... 216 3e-67 3 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 2...16 3e-67 3 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-67 3 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 3e-67 3 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 2...3e-67 3 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 3e-67 3 AJ510166 |AJ510166.1 C
Lifescience Database Archive (English)
Full Text Available 1 Artificial sequences cloning vector DNA pDXA-3H. 216 8e-54 2 X85122 |X85122.1 Artificial sequences cloni...216 8e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-54 2 X85123 |X85123.1 Artificial sequences cloni...Cloning vector pDXA-FLAG, complete sequence. 216 8e-54 2 X85120 |X85120.1 Artificial sequences cloning vecto...steine proteinase 1. 1217 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-54 2 X85119 |X85119....ng vector DNA pDXA-HY. 216 8e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG.
Hot wire production of single-wall and multi-wall carbon nanotubes
Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.
2010-10-26
Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).
Lifescience Database Archive (English)
Full Text Available 622 e-175 1 AJ510162 |AJ510162.1 Cloning vector pDXA-YFP-NotI. 216 1e-52 1 X85120 |X85120.1 Artificial sequences cloning...pDXA-GFP2, complete sequence. 216 1e-52 1 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. ...XA-CFP. 216 1e-52 1 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA...-HC. 216 1e-52 1 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-52 1 AJ510166 |AJ5
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
Aliisedimentitalea scapharcae gen. nov., sp. nov., isolated from ark shell Scapharca broughtonii.
Kim, Young-Ok; Park, Sooyeon; Nam, Bo-Hye; Kim, Dong-Gyun; Won, Sung-Min; Park, Ji-Min; Yoon, Jung-Hoon
2015-08-01
A Gram-negative, aerobic, non-spore-forming, motile and ovoid or rod-shaped bacterial strain, designated MA2-16(T), was isolated from ark shell (Scapharca broughtonii) collected from the South Sea, South Korea. Strain MA2-16(T) was found to grow optimally at 30°C, at pH 7.0-8.0 and in the presence of 2.0% (w/v) NaCl. Neighbour-joining, maximum-likelihood and maximum-parsimony phylogenetic trees based on 16S rRNA gene sequences revealed that strain MA2-16(T) clustered with the type strain of Sedimentitalea nanhaiensis. The novel strain exhibited a 16S rRNA gene sequence similarity value of 97.1% to the type strain of S. nanhaiensis. In the neighbour-joining phylogenetic tree based on gyrB sequences, strain MA2-16(T) formed an evolutionary lineage independent of those of other taxa. Strain MA2-16(T) contained Q-10 as the predominant ubiquinone and C18:1 ω7c and 11-methyl C18:1 ω7c as the major fatty acids. The major polar lipids of strain MA2-16(T) were phosphatidylcholine, phosphatidylglycerol, phosphatidylethanolamine, an unidentified aminolipid and an unidentified lipid. The DNA G+C content of strain MA2-16(T) was 57.7 mol% and its DNA-DNA relatedness values with the type strains of S. nanhaiensis and some phylogenetically related species of the genera Leisingera and Phaeobacter were 13-24%. On the basis of the data presented, strain MA2-16(T) is considered to represent a novel genus and novel species within the family Rhodobacteraceae, for which the name Aliisedimentitalea scapharcae gen. nov., sp. nov. is proposed. The type strain is MA2-16(T) (=KCTC 42119(T) =CECT 8598(T)).
Monitoring Plan for Fiscal Year 1999 Borehole Logging at 200 East Area Specific Retention Facilities
International Nuclear Information System (INIS)
Horton, D.G.
1999-01-01
The Hanford Groundwater Monitoring Project's vadose zone monitoring effort for fiscal year (FY) 1999 involves monitoring 30 boreholes for moisture content and gamma-ray emitting radionuclides. The boreholes are associated with specific retention trenches and cribs in the 200 East Area of the Hanford Site. The facilities to be monitored are the 216-A-2, -4, and -7 cribs, the 216-A-18 trench, the 216-B-14 through -19 cribs, the 216-B-20 through -34, -53A, and -58 trenches, the 216-B-35 through -42 trenches, and the 216-C-5 crib. This monitoring plan describes the facilities and the vadose zone at the cribs and trenches to be monitored; the field activities to be accomplished; the constituents of interest and the monitoring methods, including calibration issues; and the quality assurance and quality control requirements governing the monitoring effort. The results from the FY 1999 monitoring will show the current configuration of subsurface contamination and will be compared with past monitoring results to determine whether changes in contaminant distribution have occurred since the last monitoring effort
Lifescience Database Archive (English)
Full Text Available 4 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 2e-54 2 X85122 |X85122.1 Artificial sequences cloning...4 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 2e-54 2... X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 2e-54 2 AF269236 |AF269236.1 Cloning ...vector pDXA-FLAG, complete sequence. 216 2e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pD
Lifescience Database Archive (English)
Full Text Available 119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-54 2 X85122 |X85122.1 Artificial sequences cloning...118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 1e-54 2 X85123... |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 1e-54 2 AF269236 |AF269236.1 Cloning vector ...pDXA-FLAG, complete sequence. 216 1e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H.
Energy Technology Data Exchange (ETDEWEB)
Smith, R.M.; Bates, D.J.; Lundgren, R.E.
1989-09-01
This report describes the progress of 13 Hanford ground-water monitoring projects for the period April 1 to June 30, 1989. These projects are for the 300 area process trenches (300 area), 183-H solar evaporation basins (100-H area), 200 areas low-level burial grounds, nonradioactive dangerous waste landfill (southeast of the 200 areas), 1301-N liquid waste disposal facility (100-N area), 1324-N surface impoundment and 1324-NA percolation pond (100-N area), 1325-N liquid waste disposal facility (100-N area), 216-A-10 crib (200-east area), 216-A-29 ditch (200-east area), 216-A-36B crib (200-east area), 216-B-36B crib (200-east area), 216-B-3 pond (east of the 200-east area), 2101-M pond (200-east area), grout treatment facility (200-east area).
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
49 CFR 571.216a - Standard No. 216a; Roof crush resistance; Upgraded standard.
2010-10-01
... (SAE) Standard J826 “Devices for Use in Defining and Measuring Vehicle Seating Accommodation,” SAE J826... Automotive Engineers, Inc., 400 Commonwealth Drive, Warrendale, PA 15096. Phone: 1-724-776-4841; Web: http... J826, revised July 1995, “Devices for Use in Defining and Measuring Vehicle Seating Accommodation...
Directory of Open Access Journals (Sweden)
Tropp Hans
2005-06-01
Full Text Available Abstract Background The tissue origin of low back pain (LBP or referred lower extremity symptoms (LES may be identified in about 70% of cases using advanced imaging, discography and facet or sacroiliac joint blocks. These techniques are invasive and availability varies. A clinical examination is non-invasive and widely available but its validity is questioned. Diagnostic studies usually examine single tests in relation to single reference standards, yet in clinical practice, clinicians use multiple tests and select from a range of possible diagnoses. There is a need for studies that evaluate the diagnostic performance of clinical diagnoses against available reference standards. Methods We compared blinded clinical diagnoses with diagnoses based on available reference standards for known causes of LBP or LES such as discography, facet, sacroiliac or hip joint blocks, epidurals injections, advanced imaging studies or any combination of these tests. A prospective, blinded validity design was employed. Physiotherapists examined consecutive patients with chronic lumbopelvic pain and/or referred LES scheduled to receive the reference standard examinations. When diagnoses were in complete agreement regardless of complexity, "exact" agreement was recorded. When the clinical diagnosis was included within the reference standard diagnoses, "clinical agreement" was recorded. The proportional chance criterion (PCC statistic was used to estimate agreement on multiple diagnostic possibilities because it accounts for the prevalence of individual categories in the sample. The kappa statistic was used to estimate agreement on six pathoanatomic diagnoses. Results In a sample of chronic LBP patients (n = 216 with high levels of disability and distress, 67% received a patho-anatomic diagnosis based on available reference standards, and 10% had more than one tissue origin of pain identified. For 27 diagnostic categories and combinations, chance clinical agreement
What is Mine is Yours: The Art of Operational Integration
2016-05-10
141 Dorn, Walkout, 67-68. 142 Stilwell, The Stilwell Papers, 77. 143 Max Hastings, Retribution (New York: Alfred A. Knopf, 2008), 216. 144...impose the urgency of the situation in Burma on 152 Stilwell, The Stilwell Papers, 90. 153 Hastings, Retribution , 216. 154 Dorn, Walkout, 86. 155...to the Rhine, 33. 171 Tombin, With Utmost Spirit, 385,388. 172 Hastings, Retribution , 216. 173 Davies, Dragon by the Tail, 262. 174 Bagby
2010-01-01
... the company, as the Board determines. (h) Customer means a consumer who has a customer relationship with you. (i)(1) Customer relationship means a continuing relationship between a consumer and you under... you establish a continuing advisory relationship. (iv) If you hold ownership or servicing rights to an...
2010-04-01
... AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF... means the superintendent or other officer of the Bureau of Indian Affairs having jurisdiction under delegated authority, over the lands involved. (b) Mining supervisor means the Regional Mining Supervisor, or...
2010-10-01
... lookouts can be counted among required lookouts as long as supervisors monitor their progress and... submerged objects). This does not forbid personnel being trained as lookouts from being counted as those... to detect any vocalizing marine mammals (particularly sperm whales) in the vicinity of the exercise...
2010-10-01
... identify, evaluate, or resolve conservation problems. (2) Research that is not on marine mammals, but that... following: The collection of dead animals, or parts thereof; the restraint or detention of a marine mammal... and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...
2010-04-01
... significantly affecting the environment. (4) Environmental Assessment. A detailed study of the reasonably..., deterioration of the environment and the natural resource base, illiteracy as well as the lack of adequate... the factual basis for a Threshold Decision as to whether an Environmental Assessment or an...
2010-10-01
... the Safety Range either due to the animal(s) swimming out of the Safety Range or due to the Safety Range moving beyond the mammal's last verified location. (2) If a North Atlantic right whale or other... must not occur until the animal is positively resighted outside the Safety Range and at least one...
2010-04-01
... living employee can establish another individual's eligibility for a spouse annuity or cause an increase... child in care; (b) To establish annuity eligibility for a widow(er), or surviving divorce spouse or...
2010-04-01
... approval of the PP or PAAD and the method of implementation will include consideration of the Environmental... shall include a separate section evaluating the economic, social and environmental risks and benefits of... Examination does not indicate a potentially unreasonable risk arising from the pesticide use, an Environmental...
2010-10-01
.../are dead), location, time of first discovery, observed behavior (if alive), and photo or video (if... and conditions. (xxx) When marine mammals have been sighted in the area, Navy vessels shall increase...
2010-10-01
..., consistent with the safety of the ship. (xxx) The Navy shall abide by the letter of the “Stranding Response... video (if available). Based on the information provided, NMFS shall determine if, and advise the Navy.../are dead), location, time of first discovery, observed behaviors (if alive), and photo or video (if...
2010-07-01
...’ secured its access * * * We do not think that the military recruiter has received equal 'access' [when a... institution of higher education is a discrete (although not necessarily autonomous) organizational entity that...
2010-07-01
.... Applications for statements involving financial assistance in meeting user cost or fee schedules related to... authority under the Act. (2) Cost recovery and user charges. Applications for statements involving a request... to such areas of cost. (7) Evidence of financial responsibility. Applications for statements...
2010-07-01
... service in the Department of Homeland Security. The policies herein also affect the Departments of... and Health Review Commission, the National Commission on Libraries and Information Science, the...
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Ovarian carcinoma glyco-antigen targeted by human IgM antibody.
Directory of Open Access Journals (Sweden)
Yi Chen
Full Text Available Epithelial Ovarian Cancer (EOC cells expression of a novel carbohydrate antigen was defined using a human VH4-34 encoded IgM monoclonal antibody (mAb216. MAb216 binds to a poly N-acetyllactosamine epitope expressed on B cells and kills normal and malignant B cells in vitro and in vivo. EOC patient ascites and EOC cell lines were used to study the anti tumor effect of mAb216. Various assays were used to characterize the epitope and demonstrate antibody-mediated binding and cytotoxicity in EOC. Drug and antibody combination effects were determined by calculating the combination index values using the Chou and Talalay method. MAb216 displays direct antibody mediated cytotoxicity on a population of human EOC tumor and ascites samples and EOC cell lines, which express high amounts of poly N-acetyllactosamine epitope, carried by CD147/CD98. Eighty four percent of patient samples, including platin resistant, had a tumor population that bound the monoclonal antibody. The binding pattern of mAb216 and mechanism of cytotoxicity was similar to that seen on normal and malignant B cells with unique general membrane disruption and "pore" formation. In vitro incubation with mAb216 and cisplatin enhanced killing of OVCAR3 cell line. In EOC cell lines percent cytotoxicity correlated with percent expression of epitope. Although in vitro data shows specific EOC cytotoxicity, for possible treatment of EOC MAb216 would need to be evaluated in a clinical trial with or without chemotherapy.
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
Gclust Server: 159999 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 159999 TET_216.m00068 Cluster Sequences - 53 hypothetical protein chr_0_8254828_216...; no annotation 1 1.00e-22 0.0 11.11 0.0 0.0 0.0 0.0 Show 159999 Cluster ID 159999 Sequence ID TET_216.m0006...Syn: 0 Glv: 0 Tel: 0 YelA: 0 YelB: 0 S63: 0 S79: 0 S81: 0 S93: 0 S96: 0 S99: 0 Pm
Kurotobi, Toshiya; Shimada, Yoshihisa; Kino, Naoto; Ito, Kazato; Tonomura, Daisuke; Yano, Kentaro; Tanaka, Chiharu; Yoshida, Masataka; Tsuchida, Takao; Fukumoto, Hitoshi
2015-03-01
The features of intrinsic ganglionated plexi (GP) in both atria after extensive pulmonary vein isolation (PVI) and their clinical implications have not been clarified in patients with atrial fibrillation (AF). The purpose of this study was to assess the features of GP response after extensive PVI and to evaluate the relationship between GP responses and subsequent AF episodes. The study population consisted of 216 consecutive AF patients (104 persistent AF) who underwent an initial ablation. We searched for the GP sites in both atria after an extensive PVI. GP responses were determined in 186 of 216 patients (85.6%). In the left atrium, GP responses were observed around the right inferior GP in 116 of 216 patients (53.7%) and around the left inferior GP in 57 of 216 (26.4%). In the right atrium, GP responses were observed around the posteroseptal area: inside the CS in 64 of 216 patients (29.6%), at the CS ostium in 150 of 216 (69.4%), and in the lower right atrium in 45 of 216 (20.8%). The presence of a positive GP response was an independent risk factor for AF recurrence (hazard ratio 4.04, confidence interval 1.48-11.0) in patients with paroxysmal, but not persistent, AF. The incidence of recurrent atrial tachyarrhythmias in patients with paroxysmal AF with a positive GP response was 51% vs 8% in those without a GP response (P = .002). The presence of GP responses after extensive PVI was significantly associated with increased AF recurrence after ablation in patients with paroxysmal AF. Copyright © 2015 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.
High figure of merit and thermoelectric properties of Bi-doped Mg2Si0.4Sn0.6 solid solutions
International Nuclear Information System (INIS)
Liu, Wei; Zhang, Qiang; Yin, Kang; Chi, Hang; Zhou, Xiaoyuan; Tang, Xinfeng; Uher, Ctirad
2013-01-01
The study of Mg 2 Si 1−x Sn x -based thermoelectric materials has received widespread attention due to a potentially high thermoelectric performance, abundant raw materials, relatively low cost of modules, and non-toxic character of compounds. In this research, Mg 2.16 (Si 0.4 Sn 0.6 ) 1−y Bi y solid solutions with the nominal Bi content of 0≤y≤0.03 are prepared using a two-step solid state reaction followed by spark plasma sintering consolidation. Within this range of Bi concentrations, no evidence of second phase segregation was found. Bi is confirmed to occupy the Si/Sn sites in the crystal lattice and behaves as an efficient n-type dopant in Mg 2 Si 0.4 Sn 0.6 . Similar to the effect of Sb, Bi doping greatly increases the electron density and the power factor, and reduces the lattice thermal conductivity of Mg 2.16 Si 0.4 Sn 0.6 solid solutions. Overall, the thermoelectric figure of merit of Bi-doped Mg 2.16 Si 0.4 Sn 0.6 solid solutions is improved by about 10% in comparison to values obtained with Sb-doped materials of comparable dopant content. This improvement comes chiefly from a marginally higher Seebeck coefficient of Bi-doped solid solutions. The highest ZT∼1.4 is achieved for the y=0.03 composition at 800 K. - Graphical abstract: (a)The relationship between electrical conductivity and power factor for Sb/Bi-doped Mg 2.16 (Si 0.4 Sn 0.6 ) 1−y (Sb/Bi) y (0 2.16 (Si 0.4 Sn 0.6 ) 1−y Bi y (0≤y≤0.03) solid solutions. (c)Temperature dependent dimensionless figure of merit ZT of Mg 2.16 (Si 0.4 Sn 0.6 ) 1−y Bi y (0≤y≤0.03) solid solutions. - Highlights: • Bi doped Mg 2.16 Si 0.4 Sn 0.6 showed 15% enhancement in the power factor as compared to Sb doped samples. • Bi doping reduced κ ph of Mg 2.16 Si 0.4 Sn 0.6 due to stronger point defect scattering. • The highest ZT=1.4 at 800 K was achieved for Mg 2.16 (Si 0.4 Sn 0.6 ) 0.97 Bi 0.03
Ataxia, Dementia, and Hypogonadotropism Caused by Disordered Ubiquitination
DEFF Research Database (Denmark)
Margolin, David H.; Kousi, Maria; Chan, Yee-Ming
2013-01-01
and a deubiquitinase, respectively, were found in three affected siblings in a consanguineous family. Additional screening identified compound heterozygous truncating mutations in RNF216 in an unrelated patient and single heterozygous deleterious mutations in four other patients. Knockdown of rnf216 or otud4...
2011-11-21
..., using any of the following methods: [cir] Regulations.gov : http://www.regulations.gov . Submit comments... Training 252.209-7003, Reserve Officer Corps and Military Recruiting on Training Corps and Military Campus. Recruiting on Campus-- Representation. 252.216-7000, Economic Price 252.216-70XX, Economic Price Adjustment...
International Nuclear Information System (INIS)
1995-11-01
On December 23, 1991, the US DOE< Richland Operation Office (RL) and the Washington State Department of Ecology (Ecology) agreed to adhere to the provisions of the Department of Ecology Consent Order No. DE91NM-177 (216 Consent Order) (Ecology and US DOE 1991). The 216 Consent Order list regulatory milestones for liquid effluent streams at the Hanford Site and requires compliance with the permitting requirements of Washington Administrative Code. Hanford Site liquid effluent streams discharging to the soil column have been categorized on the 216 Consent Order as follows: Phase I Streams; Phase II Streams; Miscellaneous Streams. Phase I and Phase II Streams were initially addressed in two report. Miscellaneous Streams are subject to the requirements of several milestones identified in the 216 Consent Order. This document constitutes the Categorical State Waste Discharge Permit application for hydrotest,maintenance and construction discharges throughout the Hanford Site. This categorical permit application form was prepared and approved by Ecology
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-01
On December 23, 1991, the US DOE< Richland Operation Office (RL) and the Washington State Department of Ecology (Ecology) agreed to adhere to the provisions of the Department of Ecology Consent Order No. DE91NM-177 (216 Consent Order) (Ecology and US DOE 1991). The 216 Consent Order list regulatory milestones for liquid effluent streams at the Hanford Site and requires compliance with the permitting requirements of Washington Administrative Code. Hanford Site liquid effluent streams discharging to the soil column have been categorized on the 216 Consent Order as follows: Phase I Streams; Phase II Streams; Miscellaneous Streams. Phase I and Phase II Streams were initially addressed in two report. Miscellaneous Streams are subject to the requirements of several milestones identified in the 216 Consent Order. This document constitutes the Categorical State Waste Discharge Permit application for hydrotest,maintenance and construction discharges throughout the Hanford Site. This categorical permit application form was prepared and approved by Ecology.
41 CFR 101-6.216 - Definitions.
2010-07-01
... providing education, health care, housing, social services, or parks and recreation; or (ii) The entire...) grants and loans of Federal funds, (2) the grant or donation of Federal property and interests in... other than a casual or transient basis), Federal property or any interest in such property without...
Publications | Page 216 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Born into the Digital Age in the south of Africa: the reconfiguration of the "digital citizen" (restricted access). In the South African context, being a "digital native" is not about age but about experience, and does not apply to a generation but to an elite. At the centre of the digital divide is the issue of access to technology.
23 CFR 646.216 - General procedures.
2010-04-01
... the project site or specifically purchased and delivered to the company for use on the project may be... restoring the company's service by adustments of existing facilities away from the project site, in lieu of... protective services during performance of the work, the type of protective services and the method of...
50 CFR 216.23 - Native exceptions.
2010-10-01
..., processing, and shipping materials; (iii) A proposal for a system of bookkeeping and/or inventory segregation... subsistence practices of barter and sharing of Cook Inlet beluga parts and products. (ii) Beluga whale calves...
38 CFR 21.216 - Special equipment.
2010-07-01
... enable a veteran to mitigate or overcome the effects of disability in pursuing a rehabilitation program... specifically designed to mitigate or overcome the effects of disability. They range from eyeglasses and hearing aids to closed-circuit TV systems which amplify reading material for veterans with severe visual...
22 CFR 216.6 - Environmental assessments.
2010-04-01
... developed countries as well as assist in building an indigenous institutional capability to deal nationally... significance; possible conflicts between the proposed action and land use plans, policies and controls for the...
32 CFR 216.6 - Information requirements.
2010-07-01
...) have been assigned Report Control Symbol DD-P&R-(AR)-2038 in accordance with DoD 8910.1-M 2 . 2 Copies... of) ABC University)] by a policy or practice of the school. Specifically, military recruiting...-recruiting information refers to a student's name, address, telephone listing, age (or year of birth), level...
Publications | Page 216 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Explore outputs from more than four decades of IDRC-supported research. Visit the IDRC Digital Library now. ... show that the closer the ethical distance between countries, the greater the trade. Ethics in international trade are important where purchasing, exports, marketing and sales activities are more likely to involve.
22 CFR 216.4 - Private applicants.
2010-04-01
..., projects or activities for which financing from A.I.D. is sought by private applicants, such as PVOs and...) or (d), preliminary proposals for financing submitted by private applicants shall be accompanied by... Environmental Examination. The Threshold Decision shall be made by the Mission Director for the country to which...
Publications | Page 216 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
restricted access). The Pan Asia Networking (PAN) localization project has been developing sustainable human capacity for R&D in local language computing and technological support for Asian Languages. Representatives of the project have ...
International Nuclear Information System (INIS)
Shiotsuki, Masao; Miyahara, Kaname
2003-01-01
The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)
International Nuclear Information System (INIS)
Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.
2011-01-01
South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
75 FR 16876 - Proposed Data Collection Available for Public Comment and Recommendations.
2010-04-02
... (RRA) provides for the payment of disability annuities to qualified employees. Section 2 also provides... 20 CFR 216.21-216.23. Certain types of work may actually indicate an annuitant's recovery from disability. Regulations related to an annuitant's recovery from disability of work are prescribed in 20 CFR...
75 FR 28074 - Advisory Committee on Reactor Safeguards
2010-05-19
..., 2009, (74 FR 52829-52830). Wednesday, June 9, 2010, Conference Room T2-B1, Two White Flint North... Regulatory Guide (RG) 1.216, ``Containment Structural Integrity Evaluation for Internal Pressure Loadings... representatives of the NRC staff regarding draft final RG 1.216, ``Containment Structural Integrity Evaluation for...
Internet use in patients with cardiovascular diseases: Bad Berka Cross-Sectional Study (BABSY).
Ohlow, M-A; Brunelli, M; Lauer, B
2013-10-01
Internet has become a significant resource for dissemination of medical information. We sought to investigate prevalence and usage patterns of Internet access among consecutive patients with cardiovascular diseases. A cross-sectional study was performed using a questionnaire as study tool. Among patients with Internet access, the type of health information sought and the impact of these on daily life were assessed. Of 1063 patients invited to the study, 1000 patients [68% male gender, mean age 66 ± 11 years (range 27-83 years)] agreed to complete the questionnaire. 216/1000 (21.6%) used Internet to obtain information related to their disease. The patient education was graded as: low (15%), medium (66%) and high (19%). Reasons for Internet use were as follows: 24-h availability 142/216 (65.7%); free of charge 58/216 (26.9%); and anonymity 50/216 (23.2%). Younger (≤ 66 years) age (35.2% vs. 15.3%; p = 0.0001), male gender (24.6% vs. 15.4%; p = 0.001) and higher education level (49.4% vs. 16.1%; p = 0.001) were significantly associated with Internet use. 30.6% (66/216) of Internet users changed their individual health behaviour attributable to information found on the Internet. However, this was not related to age, gender or level of education (p = 0.5, p = 0.6 and p = 0.4, respectively). Patients without Internet use obtain health information mainly from the pharmacist (62%) or from their treating physician (58%). A relevant number of patients with cardiovascular disease access the Internet for health information. The impact of such information on health-related behaviour in daily life was low. © 2013 John Wiley & Sons Ltd.
Qekwana, Daniel Nenene; Sebola, Dikeledi; Oguttu, James Wabwire; Odoi, Agricola
2017-09-15
Antimicrobial resistance is becoming increasingly important in both human and veterinary medicine. This study investigated the proportion of antimicrobial resistant samples and resistance patterns of Staphylococcus isolates from cats presented at a veterinary teaching hospital in South Africa. Records of 216 samples from cats that were submitted to the bacteriology laboratory of the University of Pretoria academic veterinary hospital between 2007 and 2012 were evaluated. Isolates were subjected to antimicrobial susceptibility testing against a panel of 15 drugs using the disc diffusion method. Chi square and Fisher's exact tests were used to assess simple associations between antimicrobial resistance and age group, sex, breed and specimen type. Additionally, associations between Staphylococcus infection and age group, breed, sex and specimen type were assessed using logistic regression. Staphylococcus spp. isolates were identified in 17.6% (38/216) of the samples submitted and 4.6% (10/216) of these were unspeciated. The majority (61.1%,11/18) of the isolates were from skin samples, followed by otitis media (34.5%, 10/29). Coagulase Positive Staphylococcus (CoPS) comprised 11.1% (24/216) of the samples of which 7.9% (17/216) were S. intermedius group and 3.2% (7/216) were S. aureus. Among the Coagulase Negative Staphylococcus (CoNS) (1.9%, 4/216), S. felis and S. simulans each constituted 0.9% (2/216). There was a significant association between Staphylococcus spp. infection and specimen type with odds of infection being higher for ear canal and skin compared to urine specimens. There were higher proportions of samples resistant to clindamycin 34.2% (13/25), ampicillin 32.4% (2/26), lincospectin 31.6% (12/26) and penicillin-G 29.0% (11/27). Sixty three percent (24/38) of Staphylococcus spp. were resistant to one antimicrobial agent and 15.8% were multidrug resistant (MDR). MDR was more common among S. aureus 28.6% (2/7) than S. intermedius group isolates 11.8% (2
48 CFR 1816.307-70 - NASA contract clauses.
2010-10-01
... officer may insert a clause substantially as stated at 1852.216-87, Submission of Vouchers for Payment, in... ADMINISTRATION CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Cost-Reimbursement Contracts 1816.307-70... clause at 1852.216-75, Payment of Fixed Fee, in cost-plus-fixed-fee contracts. Modifications to the...
78 FR 12799 - Notice of Intent To Grant Exclusive License
2013-02-25
... the invention described and claimed in U.S. Patent Application Serial No. US 13/ 534,804, Alpha-Stream... industries. The patent rights in these inventions as applicable have been assigned to the United States of... Rd, Cleveland OH 44135. Phone (216) 433-5754. Facsimile (216) 433-6790. FOR FURTHER INFORMATION...
Czech Academy of Sciences Publication Activity Database
Pruner, Petr; Schnabl, Petr; Čížková, Kristýna; Elbra, Tiiu; Kdýr, Šimon; Svobodová, Andrea; Reháková, D.
2017-01-01
Roč. 120 (2017), s. 216-216 ISSN 1017-8880. [International Symposium on the Cretaceous /10./. 21.08.2017-26.08.2017, Vienna] R&D Projects: GA ČR(CZ) GA16-09979S Institutional support: RVO:67985831 Keywords : stratigraphy * Jurassic-Cretaceous sequences * Western Carpathians Subject RIV: DB - Geology ; Mineralogy
A designated centre for people with disabilities operated by Health Service Executive, Sligo
LENUS (Irish Health Repository)
Gegenbauer, Kristina
2013-11-01
Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.
LENUS (Irish Health Repository)
Gegenbauer, Kristina
2013-11-01
Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.
76 FR 28986 - Agency Information Collection Request. 30-Day Public Comment Request
2011-05-19
... through a variety of research methods for developing and testing communications involving health....50 216 Screening for General Public Focus Group 2,160 1 10/60 360 Interviews Web usability testing sessions 144 1 1.50 216 Screening for Web usability testing 2,160 1 10/60 360 Self-Administered Surveys 2...
Cosmogenic Radionuclides in Bunburra Rockhole Achondrite Fall
Czech Academy of Sciences Publication Activity Database
Welten, K.C.; Nishiizumi, K.; Caffee, M. W.; Meier, M.M.M.; Bland, P.A.; Spurný, Pavel
2009-01-01
Roč. 44, Supplement (2009), A216-A216 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * cosmogenic radionuclide concentrations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009
TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER
International Nuclear Information System (INIS)
Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.
2004-01-01
As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and
EST Table: DC438616 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available DC438616 E_FL_epM-_24J06_F_0 10/09/28 52 %/216 aa ref|XP_625076.2| PREDICTED: similar to fear...e:AGAP005405 10/09/10 52 %/216 aa gnl|Amel|GB30341-PA 10/09/10 52 %/179 aa gi|91086723|ref|XP_970869.1| PREDICTED: similar to fear
Directory of Open Access Journals (Sweden)
Josemeyre Bonifácio da Silva
2009-07-01
Full Text Available The objective of this work was to evaluate the chemical and physical characteristics of grains of soybean (Glycine max cultivars for food processing. The soybean cultivars evaluated were: grain-type - BRS 133 and BRS 258; food-type - BRS 213 (null lipoxygenases, BRS 267 (vegetable-type and BRS 216 (small grain size. BRS 267 and BRS 216 cultivars showed higher protein content, indicating that they could promote superior nutritional value. BRS 213 cultivar showed the lowest lipoxygenase activity, and BRS 267, the lowest hexanal content. These characteristics can improve soyfood flavor. After cooking, BRS 267 cultivar grains presented a higher content of aglycones (more biologically active form of isoflavones and oleic acid, which makes it proper for functional foods and with better stability for processing, and also showed high content of fructose, glutamic acid and alanine, compounds related to the soybean mild flavor. Because of its large grain size, BRS 267 is suitable for tofu and edamame, while small-grain-sized BRS 216 is good for natto and for soybean sprouts production. BRS 216 and BRS 213 cultivars presented shorter cooking time, which may be effective for reducing processing costs.O objetivo deste trabalho foi avaliar as características químicas e físicas de grãos de cultivares de soja (Glycine max para o processamento de alimentos. As cultivares avaliadas foram: tipo grão - BRS 133 e BRS 258; tipo alimento - BRS 213 (desprovida de lipoxigenases, BRS 267 (tipo hortaliça e BRS 216 (tamanho de grão pequeno. As cultivares BRS 216 e BRS 267 apresentaram maior teor de proteínas e poderiam promover valor nutricional superior. A cultivar BRS 213 apresentou a menor atividade de lipoxigenases e a BRS 267, o menor teor de hexanal. Essas características podem melhorar o sabor dos alimentos. Com o cozimento, os grãos da cultivar BRS 267 apresentaram maior teor de agliconas (forma biologicamente mais ativa das isoflavonas e de ácido oleico
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
48 CFR 1852.216-88 - Performance incentive.
2010-10-01
... credit the next payment voucher for the amount due, as directed by the Contracting Officer. (2) When the performance level exceeds the standard level, the Contractor may request payment of the incentive amount associated with a given level of performance, provided that such payments shall not be more frequent than...
(216-IJBCS-Article-A B Béchir)
African Journals Online (AJOL)
RHUMSIKI
L'objectif de cette étude a été d'analyser les variations saisonnières des ressources .... Tableau 1: Caractéristiques climatiques des saisons selon les agro-éleveurs et éleveurs du Tchad. Type de saison en ..... pour illustrer au mieux la situation globale dans notre ... ses limites dans un environnement sahélien soumis entre ...
216 ORGANISATIONA L CHANGE MANAGEMENT AND WORKERS ...
African Journals Online (AJOL)
touches deeply at the very heart of the organisational structures and processes. Such a change ... machinery and obsolescence of skills and abilities of workers. However .... This is based on the principle of extinction; behaviour will stop ...
48 CFR 52.216-25 - Contract Definitization.
2010-10-01
..., including data other than certified cost or pricing data, and certified cost or pricing data, in accordance... is [insert target date for definitization of the contract and dates for submission of proposal... certified cost or pricing data]: (c) If agreement on a definitive contract to supersede this letter contract...
Gender | Page 216 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
La ville de Fès est devenue un modèle primé en matière de mise en oeuvre efficace des technologies de l'information et de la communication (TIC) dans les ... they found that together they could break down the barriers and develop new ways to ensure that valuable resources are both protected and equitably shared.
50 CFR 216.37 - Marine mammal parts.
2010-10-01
...: (1) The person transferring the part receives no remuneration of any kind for the marine mammal part... specifically authorized by the Regional Director, consistent with the requirements of paragraphs (a)(1) and (a... Regional Director of the transfer, including a description of the part, the person to whom the part was...
24 CFR 884.216 - Termination of tenancy.
2010-04-01
... domestic violence, dating violence, stalking, or criminal activity directly related to domestic violence, dating violence, or stalking is involved or claimed to be involved. [56 FR 7541, Feb. 22, 1991, as... of tenancy for criminal activity by a covered person is subject to 24 CFR 5.858 and 5.859, and...
48 CFR 216.504 - Indefinite-quantity contracts.
2010-10-01
... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Indefinite... intelligence or intelligence-related activities of DoD, notification shall also be provided to the Select Committee on Intelligence of the Senate and the Permanent Select Committee on Intelligence of the House of...
48 CFR 552.216-73 - Ordering Information.
2010-10-01
... transmission or □ computer-to-computer Electronic Data Interchange (EDI). (b) An offeror electing to receive computer-to-computer EDI is requested to indicate below the name, address, and telephone number of the representative to be contacted regarding establishment of an EDI interface. (c) An offeror electing to receive...
47 CFR 216.2 - Publication of Directives.
2010-10-01
... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL NATIONAL COMMUNICATIONS... internal administrative purposes, that publication of the current directives is worthwhile. The appendix to... of the hyphenated letters indicates the subject category: “1” for “Organization, Membership and...
50 CFR 216.72 - Restrictions on taking.
2010-10-01
... discussion of the number of seals expected to be taken annually over the next 3 years to satisfy the subsistence requirements of each island. This discussion will include an assessment of factors and conditions...) St. Paul Island—Seals may only be harvested from the following haulout areas: Zapadni, English Bay...
48 CFR 652.216-71 - Price Adjustment.
2010-10-01
...) The contract price may be increased or decreased in actual costs of direct service labor which result...] Government. Direct service labor costs include only the costs of wages and direct benefits (such as social... number] of this contract. Price adjustments will include only changes in direct service labor costs...
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
Energy Technology Data Exchange (ETDEWEB)
Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)
2011-03-15
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
International Nuclear Information System (INIS)
Kulagin, N.A.
2011-01-01
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.
Review of radionuclide source terms used for performance-assessment analyses
International Nuclear Information System (INIS)
Barnard, R.W.
1993-06-01
Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)
2011-02-07
Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.
International Nuclear Information System (INIS)
Koyama, Mutsuo
1989-01-01
Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology
Directory of Open Access Journals (Sweden)
Jigal Beez
2013-01-01
Full Text Available Review of the monograph:Lisa Mackenrodt, Swahili Spirit Possession and Islamic Healing in Contemporary Tanzania: The Jinn Fly on Friday, Hamburg: Verlag Dr. Kovač, 2011, ISBN 978-3-8300-5806-9, 216 pagesBesprechung der Monographie:Lisa Mackenrodt, Swahili Spirit Possession and Islamic Healing in Contemporary Tanzania: The Jinn Fly on Friday, Hamburg: Verlag Dr. Kovač, 2011, ISBN 978-3-8300-5806-9, 216 Seiten
Laine, M J; Nakhei, H; Dreier, J; Lehtilä, K; Meletzus, D; Eichenlaub, R; Metzler, M C
1996-05-01
In this paper we describe transformation of Clavibacter michiganensis subsp. sepedonicus, the potato ring rot bacterium, with plasmid vectors. Three of the plasmids used, pDM100, pDM302, and pDM306, contain the origin of replication from pCM1, a native plasmid of C. michiganensis subsp. michiganensis. We constructed two new cloning vectors, pHN205 and pHN216, by using the origin of replication of pCM2, another native plasmid of C. michiganensis subsp. michiganensis. Plasmids pDM302, pHN205, and pHN216 were stably maintained without antibiotic selection in various strains of C. michiganensis subsp. sepedonicus. We observed that for a single plasmid, different strains of C. michiganensis subsp. sepedonicus showed significantly different transformation efficiencies. We also found unexplained strain-to-strain differences in stability with various plasmid constructions containing different arrangements of antibiotic resistance genes and origins of replication. We examined the effect of a number of factors on transformation efficiency. The best transformation efficiencies were obtained when C. michiganensis subsp. sepedonicus cells were grown on DM agar plates, harvested during the early exponential growth phase, and used fresh (without freezing) for electroporation. The maximal transformation efficiency obtained was 4.6 x 10(4) CFU/microgram of pHN216 plasmid DNA. To demonstrate the utility of this transformation system, we cloned a beta-1,4-endoglucanase-encoding gene from C. michiganensis subsp. sepedonicus into pHN216. When this construction, pHN216:C8, was electroporated into competent cells of a cellulase-deficient mutant, it restored cellulase production to almost wild-type levels.
Energy Technology Data Exchange (ETDEWEB)
Elia, D.; Molinari, S.; Schisano, E.; Pestalozzi, M.; Benedettini, M.; Di Giorgio, A. M.; Pezzuto, S.; Rygl, K. L. J. [Istituto di Astrofisica e Planetologia Spaziali-INAF, Via Fosso del Cavaliere 100, I-00133 Roma (Italy); Fukui, Y.; Hayakawa, T.; Yamamoto, H. [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Olmi, L. [Osservatorio Astrofisico di Arcetri-INAF, Largo E. Fermi 5, I-50125 Firenze (Italy); Veneziani, M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Schneider, N.; Piazzo, L. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universit Paris Diderot, F-91191 Gif-sur-Yvette (France); Ikhenaode, D. [DIET-Dipartimento di Ingegneria dell' Informazione, Elettronica e Telecomunicazioni, Universita di Roma La Sapienza, via Eudossina 18, I-00184 Roma (Italy); Mizuno, A. [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Onishi, T. [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Polychroni, D. [Department of Astrophysics, Astronomy and Mechanics, Faculty of Physics, University of Athens, Panepistimiopolis, 15784 Zografos, Athens (Greece); Maruccia, Y., E-mail: davide.elia@iaps.inaf.it [Dipartimento di Matematica e Fisica, Universita del Salento, CP 193, I-73100 Lecce (Italy)
2013-07-20
We present the first Herschel PACS and SPIRE photometric observations in a portion of the outer Galaxy (216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5 and -2 Degree-Sign {approx}< b {approx}< 0 Degree-Sign ) as a part of the Hi-GAL survey. The maps between 70 and 500 {mu}m, the derived column density and temperature maps, and the compact source catalog are presented. NANTEN CO(1-0) line observations are used to derive cloud kinematics and distances so that we can estimate distance-dependent physical parameters of the compact sources (cores and clumps) having a reliable spectral energy distribution that we separate into 255 proto-stellar and 688 starless sources. Both typologies are found in association with all the distance components observed in the field, up to {approx}5.8 kpc, testifying to the presence of star formation beyond the Perseus arm at these longitudes. Selecting the starless gravitationally bound sources, we identify 590 pre-stellar candidates. Several sources of both proto- and pre-stellar nature are found to exceed the minimum requirement for being compatible with massive star formation based on the mass-radius relation. For the pre-stellar sources belonging to the Local arm (d {approx}< 1.5 kpc) we study the mass function whose high-mass end shows a power law N(log M){proportional_to}M {sup -1.0{+-}0.2}. Finally, we use a luminosity versus mass diagram to infer the evolutionary status of the sources, finding that most of the proto-stellar sources are in the early accretion phase (with some cases compatible with a Class I stage), while for pre-stellar sources, in general, accretion has not yet started.
Experimental and Computational Studies of Heat Transfer in Complex Internal Flows.
1981-01-01
space having cross-sectional dimensions of 21.6 x 21.6 cm (8.5 x 8.5 in.). Into this space was poured silica aerogel powder insulation whose thermal...types of insulation (silica aerogel and styrofoam) and the surround- ing wooden containment structure. A total of 1600 grid points were used to resolve...Young, G., and Iverson, H. W., "An Investigation of Aircraft Heaters XXVII--Distribution of Heat Transfer Rate in the Entrance Section of a Circular
CORREIA,N.M.; ACRA,L.T.; BALIEIRO,G.
2015-01-01
This study aimed to control different populations of Digitaria insularisby glyphosate herbicide, isolated and mixed, besides the combination of methods (chemical and mechanical) to manage resistant adult plants. Three experiments were conducted, one in pots which were maintained under non-controlled conditions and two under field conditions. In the experiment in pots, twelve populations of D. insularis were sprayed with isolated glyphosate (1.44 and 2.16 kg a.e. ha-1) and mixed (1.44 and 2.16...
DISCOVERY OF CRYSTALLIZED WATER ICE IN A SILHOUETTE DISK IN THE M43 REGION
Energy Technology Data Exchange (ETDEWEB)
Terada, Hiroshi [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohoku Place, Hilo, HI 96720 (United States); Tokunaga, Alan T., E-mail: terada@subaru.naoj.org [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu 96822 (United States)
2012-07-01
We present the 1.9-4.2 {mu}m spectra of the five bright (L {<=} 11.2) young stars associated with silhouette disks with a moderate to high inclination angle of 39 Degree-Sign -80 Degree-Sign in the M42 and M43 regions. The water ice absorption is seen toward d121-1925 and d216-0939, while the spectra of d182-316, d183-405, and d218-354 show no water ice feature around 3.1 {mu}m within the detection limits. By comparing the water ice features toward nearby stars, we find that the water ice absorption toward d121-1925 and d216-0939 most likely originates from the foreground material and the surrounding disk, respectively. The angle of the disk inclination is found to be mainly responsible for the difference of the optical depth of the water ice among the five young stars. Our results suggest that there is a critical inclination angle between 65 Degree-Sign and 75 Degree-Sign for the circumstellar disk where the water ice absorption becomes strong. The average density at the disk surface of d216-0939 was found to be 6.38 Multiplication-Sign 10{sup -18} g cm{sup -3}. The water ice absorption band in the d216-0939 disk is remarkable in that the maximum optical depth of the water ice band is at a longer wavelength than detected before. It indicates that the primary carrier of the feature is purely crystallized water ice at the surface of the d216-0939 disk with characteristic size of {approx}0.8 {mu}m, which suggests grain growth. This is the first direct detection of purely crystallized water ice in a silhouette disk.
Pharmacokinetics of heparin and related polysaccharides
International Nuclear Information System (INIS)
Boneu, B.; Dol, F.; Caranobe, C.; Sie, P.; Houin, G.
1989-01-01
The pharmacodynamic profile of standard heparin (SH), a low molecular weight derivative (CY 216) and of dermatan sulfate (DS), a new potential antithrombotic drug, was investigated in the rabbit over a large range of doses. After bolus i.v. injection of low doses, the biological activity of SH disappeared exponentially; however, its half-life was prolonged when the dose injected increased, and over 158 micrograms/kg (100 anti-factor Xa U/kg) the biological activity disappeared as a concave-convex curve. CY 216 disappeared more slowly than SH at low doses but faster than SH at higher doses. More than 90% of the DS biological activity present 1 minute after the i.v. injection disappeared exponentially without dose-dependent effects. Increasing doses of the three drugs were then delivered for 5 h under continuous infusions. Below 500 micrograms/kg/h the DS and CY 216 plateau concentrations were higher than that of SH while above this dose the SH concentration was higher than that of DS and CY 216. These observations may be explained by the results of pharmacokinetics experiments where 125 I-labeled compounds were delivered by bolus i.v. injection in association with increasing doses of their unlabeled counterparts. For SH there was a 10-fold difference between the half-life of the lower dose (32 micrograms/kg or 5 anti-factor Xa U/kg) and that of the higher dose (3200 micrograms/kg); it was demonstrated that the half-life of SH continuously shortened as its plasma concentration decreased. In contrast the CY 216 and DS half-lives were very close, independent of the dose delivered, and therefore longer than that of SH at low doses and shorter than that of SH at higher doses
Directory of Open Access Journals (Sweden)
Zeković Zoran P.
2016-01-01
Full Text Available Coriandrum sativum L. (coriander seeds (CS were used for preparation of extracts with high content of biologically active compounds. In order to optimize ultrasoundassisted extraction process, three levels and three variables of Box-Behnken experimental design (BBD in combination with response surface methodology (RSM were applied, yielding maximized total phenolics (TP and flavonoids (TF content and antioxidant activity (IC50 and EC50 values. Independent variables were temperature (40-80oC, extraction time (40-80 min and ultrasonic power (96-216 W. Experimental results were fitted to a second-order polynomial model with multiple regression, while the analysis of variance (ANOVA was employed to assess the model fitness and determine optimal conditions for TP (79.60oC, 49.20 min, 96.69 W, TF (79.40oC, 43.60 min, 216.00 W, IC50 (80.00oC, 60.40 min, 216.00 W and EC50 (78.40oC, 68.60 min, 214.80 W. On the basis of the obtained mathematical models, three-dimensional surface plots were generated. The predicted values for TP, TF, IC50 and EC50 were: 382.68 mg GAE/100 g CS, 216 mg CE/100 g CS, 0.03764 mg/mL and 0.1425 mg/mL, respectively. [Projekat Ministarstva nauke Republike Srbije, br. TR31013
Factors of Consumer Behavior That Affect Purchasing Decisions on Blackberry Smartphone
Directory of Open Access Journals (Sweden)
Muhammad Tony Nawawi
2016-03-01
analysis used the method of multiple regression analysis and hypothesis testing and also testing conducted validity and reliability by using the help of SPSS (Statistical Program for the Science Society. The analysis shows that there is significant positive effect between the factors of cultural, social, personal, and psychological effect on purchasing decisions, with significance 0,000 < 0,05, and Adjusted R Square is worth 0,216, it means that 21,6% of purchase decisions are influenced by these factors.
Directory of Open Access Journals (Sweden)
Senchuan Song
2013-12-01
Full Text Available Attempting to improve the anticancer activity and solubility of evodiamine in simulated gastric fluid (SGF and simulated intestinal fluid (SIF solutions, thirty-eight N13-substituted evodiamine derivatives were designed, synthesized and tested for antitumor activities against six kinds of human cancer cell lines, namely prostate cancer (DU-145 and PC-3, lung cancer (H460, breast cancer (MCF-7, colon cancer (HCT-5 and glioblastoma (SF-268. The solubility of these compounds in SGF and SIF solutions was evaluated, and apoptosis induced by 2-2, 2-3, 2-16 and 3-2 was determined. The results showed: (1 among all compounds examined, 2-16 showed the highest antitumor activity and a broader spectrum of activity, with IC50 values ranging from 1–2 µM; (2 their solubility was obviously improved; (3 2-3, 2-16 and 3-2 had a significant impact inducing apoptosis in some cancer cell lines. The preliminary structure-activity relationships of these derivatives were discussed.
Urinary estrogen metabolites and breast cancer
DEFF Research Database (Denmark)
Dallal, Cher M; Stone, Roslyn A; Cauley, Jane A
2013-01-01
Background: Circulating estrogens are associated with increased breast cancer risk, yet the role of estrogen metabolites in breast carcinogenesis remains unclear. This combined analysis of 5 published studies evaluates urinary 2-hydroxyestrone (2-OHE1), 16a-hydroxyestrone (16a-OHE1......), and their ratio (2:16a-OHE1) in relation to breast cancer risk. ¿Methods: Primary data on 726 premenopausal women (183 invasive breast cancer cases and 543 controls) and 1,108 postmenopausal women (385 invasive breast cancer cases and 723 controls) were analyzed. Urinary estrogen metabolites were measured using...... premenopausal 2:16a-OHE1 was suggestive of reduced breast cancer risk overall (study-adjusted ORIIIvsI=0.80; 95% CI: 0.49-1.32) and for estrogen receptor negative (ER-) subtype (ORIIIvsI=0.33; 95% CI: 0.13-0.84). Among postmenopausal women, 2:16a-OHE1 was unrelated to breast cancer risk (study-adjusted ORIIIvs...
Garbacz, Marta A; Lujan, Scott A; Burkholder, Adam B; Cox, Phillip B; Wu, Qiuqin; Zhou, Zhi-Xiong; Haber, James E; Kunkel, Thomas A
2018-02-27
To investigate nuclear DNA replication enzymology in vivo, we have studied Saccharomyces cerevisiae strains containing a pol2-16 mutation that inactivates the catalytic activities of DNA polymerase ε (Pol ε). Although pol2-16 mutants survive, they present very tiny spore colonies, increased doubling time, larger than normal cells, aberrant nuclei, and rapid acquisition of suppressor mutations. These phenotypes reveal a severe growth defect that is distinct from that of strains that lack only Pol ε proofreading (pol2-4), consistent with the idea that Pol ε is the major leading-strand polymerase used for unstressed DNA replication. Ribonucleotides are incorporated into the pol2-16 genome in patterns consistent with leading-strand replication by Pol δ when Pol ε is absent. More importantly, ribonucleotide distributions at replication origins suggest that in strains encoding all three replicases, Pol δ contributes to initiation of leading-strand replication. We describe two possible models.
48 CFR 1352.216-76 - Placement of orders.
2010-10-01
... price or estimated cost or fee; (4) Delivery or performance date; (5) Place of delivery or performance (including consignee); (6) Packaging, packing, and shipping instructions, if any; (7) Accounting and...
36 CFR 223.216 - Special Forest Products definitions.
2010-07-01
..., Christmas trees, cones, ferns, firewood, forbs, fungi (including mushrooms), grasses, mosses, nuts, pine straw, roots, sedges, seeds, transplants, tree sap, wildflowers, fence material, mine props, posts and...
47 CFR Appendix to Part 216 - NCS Directives
2010-10-01
... responsive and survivable national telecommunications infrastructure to meet the NSEP telecommunications... telecommunications infrastructure and service capabilities within the framework outlined in Executive Order No. 12472... Surveillance Act (50 U.S.C. 1801, et seq. and 18 U.S.C. 2511, 2518, and 2519). e. Title 47, Code of Federal...
Lifescience Database Archive (English)
Full Text Available sllmkinselhqamkp*wklsri*kprttefqslkmkl ml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsst...sllmkinselhqamkp*wklsri*kprtte fqslkmklml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyql inklmlvkml*phntf
Education in Healthy Lifestyles: Curriculum Implications. Fastback 216.
Seffrin, John R.; Torabi, Mohammad R.
The nature of a healthy lifestyle and its significance to quality of life is examined. Following a discussion on what is involved in a healthy lifestyle, major health problems are described: (1) smoking; (2) alcohol and drug abuse; (3) sexually transmitted diseases; (4) diet and obesity; (5) stress; and (6) inadequate sleep. Recommendations are…
15 CFR 280.216 - Proceeding without a hearing.
2010-01-01
... will be decided on the record by the administrative law judge. Proceeding without a hearing does not... supplement other documentary evidence in the record. The administrative law judge will give each party...
50 CFR 216.242 - Permissible methods of taking.
2010-10-01
... percent of the number of takes indicated below): (i) Mysticetes: (A) North Atlantic right whale (Eubalaena...) Sperm whales (Physeter macrocephalus)—48790 (an average of 9758 annually). (B) Pygmy or dwarf sperm...
50 CFR 216.241 - Effective dates and definitions.
2010-10-01
... pair of any of the following marine mammals of concern: beaked whale of any species, dwarf or pygmy sperm whales, melon-headed whales, pilot whales, right whales, humpback whales, sperm whales, blue...
48 CFR 216.601 - Time-and-materials contracts.
2010-10-01
...-Hour Proposal Requirements—Non-Commercial Item Acquisition with Adequate Price Competition, with 252... contract type for non-commercial items if the price is expected to be based on adequate competition. [71 FR... of the contract or order; establishing fixed prices for portions of the requirement); and (D...
Lifescience Database Archive (English)
Full Text Available TNTTTAGTTCAATTGCAAACTTTATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCT...ATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCTTAAAACTTTAGNTGCCGAAACTA
50 CFR 216.93 - Tracking and verification program.
2010-10-01
.... purse seine fishing, processing, and marketing in the United States and abroad. Verification of tracking... the Agreement on the IDCP. (d) Tracking cannery operations. (1) Whenever a U.S. tuna canning company..., canning, sale, rejection, etc.). (4) During canning activities, non-dolphin-safe tuna may not be mixed in...
48 CFR 1552.216-77 - Award term incentive.
2010-10-01
... award term incentive periods] years. (c) Right not to grant or cancel the award term incentive. (1) The Government has the unilateral right not to grant or to cancel award term incentive periods and the associated... the award term incentive is cancelled, a unilateral modification will cite this clause as the...
Page | 216 IMPLEMENTATION OF TREATIES IN NIGERIA: ISSUES ...
African Journals Online (AJOL)
Fr. Ikenga
empowered by the Constitution to make laws on behalf of the federal Government. .... the Elimination of All forms of Discrimination against Women. Also ..... which Nigeria has ratified relating to labour, employment, workplace, industrial.
27 CFR 9.216 - Upper Mississippi River Valley.
2010-04-01
...), east of St. Paul at Oakbury in Washington County. From the beginning point, proceed east on Interstate... Winnebago County to U.S. Highway 20 at Cherry Valley; then (6) Proceed west on U.S. Highway 20 to Illinois...), south of St. Paul; then (15) Follow Interstate Highway 494 (beltway) northeast into Washington County...
34 CFR 682.216 - Teacher loan forgiveness program.
2010-07-01
... secondary school as a highly qualified mathematics or science teacher, or at an eligible educational service agency as a highly qualified teacher of mathematics or science to secondary school students; or (ii) At... in reading, writing, mathematics, and other areas of the elementary school curriculum, as certified...
48 CFR 1852.216-80 - Task ordering procedure.
2010-10-01
... individual task order, accounting and appropriation data. (e) The Contractor shall provide acknowledgement of... conflict between the requirements of the task order and the Contractor's approved task plan, the task order...
31 CFR 31.216 - Communications with Treasury employees.
2010-07-01
... employee with personal or direct responsibility for that procurement. (2) Offer, give, or promise to offer... employee, except as permitted by Government-Wide Ethics Rules, 5 CFR part 2635. (3) Solicit or obtain from...
48 CFR 552.216-72 - Placement of Orders.
2010-10-01
...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...
Lifescience Database Archive (English)
Full Text Available anslated Amino Acid sequence *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAF... Frame A: *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAFGFWVIPNNIADRGFIFDKS
Paolo Sortino, Elisabeth, Torino, Einaudi, 2011, pp. 216.
African Journals Online (AJOL)
User
arte e della storia hanno il loro teatro di elezione, è facile pronosticare al mito di Partenope, affascinante e ingombrante, attraente e irritante, un lungo futuro. Franco Arato. (Università di Torino). Paolo Sortino, Elisabeth, Torino, Einaudi, 2011, ...
25 CFR 216.7 - Approval of mining plan.
2010-04-01
... quantity of water to be used and pollutants that are expected to enter any receiving waters; (5) A design for the necessary impoundment, treatment or control of all runoff water and drainage from workings so as to reduce soil erosion and sedimentation and to prevent the pollution of receiving waters; (6) A...
7 CFR 1709.216 - Evaluation criteria and weights.
2010-01-01
... announcement. (a) Program Design. Reviewers will consider the financial viability of the applicant's revolving... applications that are less detailed. (b) Assessment of needs. Reviewers will award more points to programs that... less severe physical and economic challenges. (c) Program evaluation and performance measures...
48 CFR 352.216-70 - Additional cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Additional cost principles... Additional cost principles. As prescribed in 316.307(j), the Contracting Officer shall insert the following clause: Additional Cost Principles (January 2006) (a) Bid and proposal (B & P) costs. (1) B & P costs are...
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uery: 121 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 178 ... QVPVNAIASSGTSEQALFTGAGERD...KESISNMRTIAAAARKAGMEVTELIVPGAGHDW Sbjct: 159 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 216
????????, ?. ?.
2015-01-01
??????? ???????????, ???????? ? ?????????? ????????? ??????????? ?????????????? ??????????-????????? ?????????? ?????? ?? ?? ???. 56 ?? ?? ????? ?????????????. ????????????????? ??????? ??? ??????????? ????????? ????????????? ??????? ??????????-???????? ???????? ?????? ? ????????????? ????????? 21,6 ? ? ????????? ?-6+2?0,85 ?, ????????? ? 1969 ?. ?? ?? ???. 56. ????????????? ?? ??????????? ?????????? ???????? ?? ?-8+2?1,5 ? ?????????? ?????????????? ????????? ?????? ?? ?????????? ...
Emanations and 'induced' radioactivity: from mystery to (mis)use
International Nuclear Information System (INIS)
Kolar, Z.I.
1999-01-01
The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
Energy Technology Data Exchange (ETDEWEB)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)
2014-05-15
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.
Neutron diffraction study of the magnetic long-range order in Tb
DEFF Research Database (Denmark)
Dietrich, O.W.; Als-Nielsen, Jens Aage
1967-01-01
Like other heavy rare-earth metals, Tb exhibits a magnetic phase with a spiral structure. This appears within the temperature region from 216 to 226deg K between the ferromagnetic phase and the paramagnetic phase. The transition between ferromagnetic and spiral structure is of first order and imp...... at 216deg K to 20.7deg at 226deg K. The temperature variation of the transverse magnetostriction has also been measured and was found to vary approximately in proportion to the square of the magnetic long-range order....
T(sub lambda) Depression by a Heat Current Along the lambda-Line
Liu, Yuanming; Larson, Melora; Iraelsson, Ulf E.
1999-01-01
We report measurements of the depression of the superfluid transition temperature by a heat current (1 less than or = Q less than or = 100 microW/sq cm) along the lambda-line (SVP less than or = P less than or = 21.6 bar). At P = 21.6 bar, measurements were also performed in a reduced gravity (0.2g). Experimental results show that the pressure dependence of the depression and the gravity effect on the measurements are small, in qualitative agreement with theoretical predictions. Keywords: superfluid helium; Lambda transition; heat current
Christner, Emanuel; Dyroff, Christoph; Kohler, Martin; Zahn, Andreas; Gonzales, Yenny; Schneider, Matthias
2013-04-01
Atmospheric water is an enormously crucial trace gas. It is responsible for ~70 % of the natural greenhouse effect (Schmidt et al., JGR, 2010) and carries huge amounts of latent heat. The isotopic composition of water vapor is an elegant tracer for a better understanding and quantification of the extremely complex and variable hydrological cycle in Earth's atmosphere (evaporation, cloud condensation, rainout, re-evaporation, snow), which in turn is a prerequisite to improve climate modeling and predictions. As H216O, H218O and HDO differ in vapor pressure and mass, isotope fractionation occurs due to condensation, evaporation and diffusion processes. In contrast to that, plants are able to transpire water with almost no isotope fractionation. For that reason the ratio of isotopologue concentrations in the boundary layer (BL) provides, compared to humidity measurements alone, independent and additional constraints for quantifying the strength of evaporation and transpiration. Furthermore the isotope ratios contain information about transport history of an air mass and microphysical processes, that is not accessible by humidity measurements. Within the project MUSICA (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water) a commercial Picarro Analyzer L2120-i is operated at Karlsruhe in Southwestern Germany, which is continuously measuring the isotopologues H216O, HDO and H218O of atmospheric water vapor since January 2012. A one year record of H216O, HDO and H218O shows clear seasonal, synoptic and diurnal characteristics and reveals the main driving processes affecting the isotopic composition of water vapor in the Middle European BL. Changes in continental plant transpiration and evaporation throughout the year lead to a slow seasonal HDO/H216O-variation, that cannot be explained by pure Rayleigh condensation. Furthermore, cold-front passages from NW lead to fast and pronounced depletion of the HDO/H216O-ratio within
[Experimental study on carcinogenesis by human papillomavirus type 8 E7 gene].
Nishikawa, T
1994-05-01
Human papillomavirus (HPV) 5 and HPV8 are often detected in skin cancers developed in patients suffering from epidermodysplasia verruciformis, as well as in skin cancers developed in immunosuppressed patients. In the present study, in order to examine the transforming activity of the HPV8E7 gene, the HPV8E7 and HPV8E6/E7 genes were cloned into the expression vector (pcD2-Y), under the SV40 enhancer/promoter to construct pcD2-8E7 and pcD2-8E6/E7, respectively. The E7 and E6/E7 genes of genital high-risk HPV16 were also cloned into pcD2-Y to construct pcD2-16E7 and pcD2-16E6/E7, respectively. They were tested for their ability to collaboratively transform primary rat embryo fibroblasts (REFs) with activated H-ras gene. Transfection experiments of REFs having an activated H-ras gene revealed that pcD2-8E7, as well as pcD2-16E7 and pcD2-16E6/E7, induced transformation of cells in G418-resistant colonies at efficiencies of 11.9%, 43.0% and 53.0%, respectively. Transformed cell lines induced by activated H-ras gene and pcD2-8E7 or pcD2-16E7 were named 8RE and 16RE cell lines, respectively. Tumor induction in syngeneic newborn rats by injected the 8RE cells was higher than that of the 16RE cells. In cytological and histological examination, the 8RE cell lines and their induced tumors were different from the 16RE cell lines and their induced tumors. The 8RE cell lines showed the characteristic transformation with efficient growth ability on plastic and colony formation in 0.3% soft agar. These results support the hypothesis that the HPV8E7 gene plays an important role in the carcinogenesis of skin cancers.
International Nuclear Information System (INIS)
Ericson, Kajsa M; Isinger, Anna P; Isfoss, Björn L; Nilbert, Mef C
2005-01-01
Upper urothelial cancer (UUC), i.e. transitional cell carcinomas of the renal pelvis and the ureter, occur at an increased frequency in patients with hereditary nonpolyposis colorectal cancer (HNPCC). Defective mismatch repair (MMR) specifically characterizes HNPCC-associated tumors, but also occurs in subsets of some sporadic tumors, e.g. in gastrointestinal cancer and endometrial cancer. We assessed the contribution of defective MMR to the development of UUC in a population-based series from the southern Swedish Cancer Registry, through microsatellite instability (MSI) analysis and immunohistochemical evaluation of expression of the MMR proteins MLH1, PMS2, MSH2, and MSH6. A MSI-high phenotype was identified in 9/216 (4%) successfully analyzed patients and a MSI-low phenotype in 5/216 (2%). Loss of MMR protein immunostaining was found in 11/216 (5%) tumors, and affected most commonly MSH2 and MSH6. This population-based series indicates that somatic MMR inactivation is a minor pathway in the development of UUC, but tumors that display defective MMR are, based on the immunohistochemical expression pattern, likely to be associated with HNPCC
Energy Technology Data Exchange (ETDEWEB)
Ericson, Kajsa M; Isinger, Anna P [Departments of Oncology, University Hospital, Lund (Sweden); Isfoss, Björn L [Departments of Pathology, University Hospital, Lund (Sweden); Nilbert, Mef C [Departments of Oncology, University Hospital, Lund (Sweden)
2005-01-01
Upper urothelial cancer (UUC), i.e. transitional cell carcinomas of the renal pelvis and the ureter, occur at an increased frequency in patients with hereditary nonpolyposis colorectal cancer (HNPCC). Defective mismatch repair (MMR) specifically characterizes HNPCC-associated tumors, but also occurs in subsets of some sporadic tumors, e.g. in gastrointestinal cancer and endometrial cancer. We assessed the contribution of defective MMR to the development of UUC in a population-based series from the southern Swedish Cancer Registry, through microsatellite instability (MSI) analysis and immunohistochemical evaluation of expression of the MMR proteins MLH1, PMS2, MSH2, and MSH6. A MSI-high phenotype was identified in 9/216 (4%) successfully analyzed patients and a MSI-low phenotype in 5/216 (2%). Loss of MMR protein immunostaining was found in 11/216 (5%) tumors, and affected most commonly MSH2 and MSH6. This population-based series indicates that somatic MMR inactivation is a minor pathway in the development of UUC, but tumors that display defective MMR are, based on the immunohistochemical expression pattern, likely to be associated with HNPCC.
Energy Technology Data Exchange (ETDEWEB)
Ludden, J.N.; Thompson, G.; Bryan, W.B.; Frey, F.A.
1980-08-10
Ferrobasalts from DSDP sites 214 and 216 on the Ninetyeast Ridge are characterized by high absolute iron (FeO>12.9 wt %), FeO/MgO>1.9, and TiO/sub 2/>2.0 wt %. Their trace element abundances indicate a tholeiitic affinity; however, they are distinct from midocean ridge incompatible element-depleted tholeiites owing to higher contents of Ba, Zr, and Sr and flat to slightly light-REE-enriched, chondrite-normalized REE patterns. Calculations using major and trace element abundances and phase compositions are generally consistent with a model relating most major elements and phase compositions in site 214 and 216 ferrobasalts by fractionation of clinopyroxene and plagio-class. However, some incompatible element abundances for site 216 basalts are not consistent with the fractional crystallization models. Baslats from site 214 can be related to andesitic rocks from the same site by fractionating clinopyroxene, plagioclase and titanomagnetite. Site 254 basalts, at the southern end of the Ninetyeast Ridge, and island tholeiites in the southern Indian Ocean (Amsterdam-St. Paul or Kerguelen-Heard volcanic provinces) possibly represent the most recent activity associated with a hot spot forming the Ninetyeast Ridge. These incompatible-element-enriched tholeiites have major element compositions consistent with those expected for a parental liquid for the site 214 and 216 ferrobasalts. However, differences in the trace element contents of the basalts from the Ninetyeast Ridge sites are not consistent with simple fractional crystallization derivation but require either a complex melting model or a heterogeneous mantle source.
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GDP Sbjct: 1 ... LSAGPAKKSLGAKRGRAVTLTDLASEEAPPPRAMSGIGELDRVLGGGLVPASAILVGGDP 60 ... Query: 157 TTLEAEKPGLVIIDSIQTMWADNVDSAPGSVSQVRASAHEL...TTFAKRTGISVIMVGHVTK 216 ... TTLEAEKPGLVIIDSIQTMWADNVDSAPGSVSQVRASAHELTTFAKRTG...ISVIMVGHVTK Sbjct: 121 TTLEAEKPGLVIIDSIQTMWADNVDSAPGSVSQVRASAHELTTFAKRTGISVIMVGHV
ORF Alignment: NC_002505 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available oup ... O1) ... Length = 67 ... Query: 216 MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEE...CNQIIS 275 ... MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEECNQIIS Sbjct: 1 ... MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEECNQIIS 60 ...
ORF Alignment: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available E Sbjct: 1 ... GPSSNTGAKGVLNEFKAFREQTRLAVESKNQKLIEQAKKGMMIGSKEEREKAQREDDEDE 60 ... Query: 164 LTRIVKILAADCPKTKFVR...ATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK 216 ... LTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK Sbjct: 121 LTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK 173
Kuan, C H; Goh, S G; Loo, Y Y; Chang, W S; Lye, Y L; Puspanadan, S; Tang, J Y H; Nakaguchi, Y; Nishibuchi, M; Mahyudin, N A; Radu, S
2013-06-01
A total of 216 chicken offal samples (chicken liver = 72; chicken heart = 72; chicken gizzard = 72) from wet markets and hypermarkets in Selangor, Malaysia, were examined for the presence and density of Listeria monocytogenes by using a combination of the most probable number and PCR method. The prevalence of L. monocytogenes in 216 chicken offal samples examined was 26.39%, and among the positive samples, the chicken gizzard showed the highest percentage at 33.33% compared with chicken liver (25.00%) and chicken heart (20.83%). The microbial load of L. monocytogenes in chicken offal samples ranged from Malaysia.
1992-04-01
understandings, the United States never ratified either of them. Id. at 459- * 68. 7Id. at 460. 79MOORE, supra note 5, at 81. See also Paul C. Szasz ...supra note 3, at 64. Although no source concludes that the 1977 ENMOD Convention is customary international law, see Szasz , supra note 79, at 216-17...156M. at 3-4. 1571d. at 4. 1581d. at 4-6. 1591d. at 6. 16° Szasz , supra note 79, at 217. 16ld. at 216-17. 162LAWS OF WAR, supra note 9, at 4. 100 0
Dicty_cDB: Contig-U16556-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 379 ) Dictyostelium discoideum cDNA clone:dda53n08, 3' ... 42 0.041 2 ( FK757919 ) av01018a06r1.1 Symbioti... DW145191 ) CLVX10263.b1_M22.ab1 CLV(XYZ) lettuce virosa Lact... 48 0.050 2 ( FK759690 ) av02060a20r1.1 Symbiotic...1597 ) CAXA9355.rev CAXA Helobdella robusta Subtracted L... 44 0.053 3 ( FK724153 ) av02100l05r1.1 Symbiot...ic sea anemone (Anemonia vi... 48 0.054 3 ( CL080652 ) CH216-159D22_RM4.1 CH216 Xen
2008-09-01
2.2.2.1 Theseus AUV 2-15 2.2.3 Air and Space 2-18 2.2.3.1 F-22A Flying Qualities Development 2-18 2.2.3.2 Apollo and Space Shuttle 2-19 2.2.3.3...Figure 2.14 The Multi-Mission Spartan Vehicle and the Remote Minehunting Vehicle Dorado 2-15 Figure 2.15 Theseus Schematic 2-16 Figure 2.16 The...Disciplines 6-3 RTO-TR-SCI-144 ix List of Tables Table Page Table 2.1 Thrust and Pitch Attitude Before the Accident 2-6 Table 2.2 Theseus
ORF Alignment: NC_006840 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... fischeri ES114] ... Length = 67 ... Query: 216 MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIK...DTEECNEIIG 275 ... MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEEC...NEIIG Sbjct: 1 ... MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEECNEIIG 60 ...
ASSESSMENT OF GOOD PRACTICES IN HOSPITAL FOOD SERVICE BY COMPARING EVALUATION TOOLS.
Macedo Gonçalves, Juliana; Lameiro Rodrigues, Kelly; Santiago Almeida, Ângela Teresinha; Pereira, Giselda Maria; Duarte Buchweitz, Márcia Rúbia
2015-10-01
since food service in hospitals complements medical treatment, it should be produced in proper hygienic and sanitary conditions. It is a well-known fact that food-transmitted illnesses affect with greater severity hospitalized and immunosuppressed patients. good practices in hospital food service are evaluated by comparing assessment instruments. good practices were evaluated by a verification list following Resolution of Collegiate Directory n. 216 of the Brazilian Agency for Sanitary Vigilance. Interpretation of listed items followed parameters of RCD 216 and the Brazilian Association of Collective Meals Enterprises (BACME). Fisher's exact test was applied to detect whether there were statistically significant differences. Analysis of data grouping was undertaken with Unweighted Pair-group using Arithmetic Averages, coupled to a correlation study between dissimilarity matrixes to verify disagreement between the two methods. Good Practice was classified with mean total rates above 75% by the two methods. There were statistically significant differences between services and food evaluated by BACME instrument. Hospital Food Services have proved to show conditions of acceptable good practices. the comparison of interpretation tools based on RCD n. 216 and BACME provided similar results for the two classifications. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Directory of Open Access Journals (Sweden)
Isfoss Björn L
2005-03-01
Full Text Available Abstract Background Upper urothelial cancer (UUC, i.e. transitional cell carcinomas of the renal pelvis and the ureter, occur at an increased frequency in patients with hereditary nonpolyposis colorectal cancer (HNPCC. Defective mismatch repair (MMR specifically characterizes HNPCC-associated tumors, but also occurs in subsets of some sporadic tumors, e.g. in gastrointestinal cancer and endometrial cancer. Methods We assessed the contribution of defective MMR to the development of UUC in a population-based series from the southern Swedish Cancer Registry, through microsatellite instability (MSI analysis and immunohistochemical evaluation of expression of the MMR proteins MLH1, PMS2, MSH2, and MSH6. Results A MSI-high phenotype was identified in 9/216 (4% successfully analyzed patients and a MSI-low phenotype in 5/216 (2%. Loss of MMR protein immunostaining was found in 11/216 (5% tumors, and affected most commonly MSH2 and MSH6. Conclusion This population-based series indicates that somatic MMR inactivation is a minor pathway in the development of UUC, but tumors that display defective MMR are, based on the immunohistochemical expression pattern, likely to be associated with HNPCC.
Téllez Lozano, Helena; Druce, John; Cooper, Samuel J.; Kilner, John A.
2017-12-01
18O and 2H diffusion has been investigated at a temperature of 300 °C in the double perovskite material PrBaCo2O5+δ (PBCO) in flowing air containing 200 mbar of 2H216O. Secondary ion mass spectrometry (SIMS) depth profiling of exchanged ceramics has shown PBCO still retains significant oxygen diffusivity ( 1.3 × 10-11 cm2s-1) at this temperature and that the presence of water (2H216O), gives rise to an enhancement of the surface exchange rate over that in pure oxygen by a factor of 3. The 2H distribution, as inferred from the 2H216O- SIMS signal, shows an apparent depth profile which could be interpreted as 2H diffusion. However, examination of the 3-D distribution of the signal shows it to be nonhomogeneous and probably related to the presence of hydrated layers in the interior walls of pores and is not due to proton diffusion. This suggests that PBCO acts mainly as an oxygen ion mixed conductor when used in PCFC devices, although the presence of a small amount of protonic conductivity cannot be discounted in these materials.
ORF Alignment: NC_002488 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uery: 96 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFVNTAYGEFFGVDLSSGTVPEWS 155 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFV...NTAYGEFFGVDLSSGTVPEWS Sbjct: 1 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFVNTAYGEFFGVDLSSGTVPEWS 60 ... Query: 216 SSPDVT 221 ... SSPDVT Sbjct: 121 SSPDVT 126
50 CFR 216.275 - Requirements for monitoring and reporting.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to U.S. Navy Training in the Southern... outlined in the SOCAL Range Complex Stranding Communication Plan, the Navy must notify NMFS immediately (or...
50 CFR 216.175 - Requirements for monitoring and reporting.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to U.S. Navy Training in the Hawaii Range... Communication Plan, the Holder of the Authorization must notify NMFS immediately (or as soon as clearance...
29 CFR 779.216 - Statutory construction of the terms.
2010-07-01
..., and the legislative history. In extending coverage of the Act on an “enterprise” basis, the Congress intended, by the 1961 and 1966 amendments to cover, among others, business organizations and chain store systems which may perform their related activities through complex business arrangements or business...
50 CFR 216.255 - Requirements for monitoring and reporting.
2010-10-01
... animals sighted. (4) Conduct shipboard monitoring to reduce impacts to protected species. Trained marine..., including the time of sighting and the direction of travel, into a marine animal tracking and sighting... will report all marine animals spotted and their directions of travel to the lead scientist onboard the...
Aeronautical Engineering: A Continuing Bibliography with Indexes (Supplement 216)
1987-08-01
HELO COMPUTER-AIDED PROCESSES FOR THE GROUND TESTING PATRICK J. DONOGHUE, PREBEN JENSEN, and ROBERT M. OF AVIATION EQUIPMENT [ SISTEMA ZADACH PROEKTIRO...Exploitation of Landes The digitall map as a tactical situation display DYAI EPNE(Frencee)-Front campaign and complesmentairy p 423 A87-3t4117
48 CFR 2052.216-73 - Accelerated task order procedures.
2010-10-01
... terms of the definitive task order and agrees to submit a cost proposal with supporting cost or pricing data. If agreement on a definitized task order is not reached by the target date mutually agreed upon...
All projects related to | Page 216 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-07-09
As African countries move toward universal health coverage, it is clear there is a shortage of African experts with applied research skills in health financing such as fiscal space analysis, needs-based resource allocation methods, and benefit incidence analysis of the equity impact of health funding. Start Date: July 9, 2012.
50 CFR 216.217 - Requirements for monitoring and reporting.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico...
NOAA Administrative Order 216-115: Strengthening NOAA's Research and
Advisory Committee Directives Management System NOAA Administrative Orders NOAA Circulars NOAA Delegations support NOAA in addressing critical science challenges, particularly those requiring integrated, holistic Quality Act (2001), the Office of Management and Budget (OMB) Circular A-11 (OMB, 2009a), the Open
18 CFR 367.2160 - Account 216, Unappropriated retained earnings.
2010-04-01
..., Unappropriated retained earnings. 367.2160 Section 367.2160 Conservation of Power and Water Resources FEDERAL... retained earnings. This account must include the balances, either debit or credit, of unappropriated retained earnings arising from earnings of the service company. This account must not include any amounts...
48 CFR 3452.216-71 - Negotiated overhead rates-fixed.
2010-10-01
... acceptability of cost allocation methods shall be determined in accordance with part 31 of the Federal... different period, for which the rates apply, and (4) the specific items treated as direct costs or any changes in the items previously agreed to be direct costs. (e) Pending establishment of fixed overhead...
48 CFR 52.216-15 - Predetermined Indirect Cost Rates.
2010-10-01
.... (c) Allowability of costs and acceptability of cost allocation methods shall be determined in...) the period for which the rates apply, and (4) the specific items treated as direct costs or any changes in the items previously agreed to be direct costs. The indirect cost rate agreement shall not...
7 CFR 800.216 - Activities that shall be monitored.
2010-01-01
... merchandising activities identified in this section shall be monitored in accordance with the instructions. (b) Grain merchandising activities. Grain merchandising activities subject to monitoring for compliance with...) Recordkeeping activities. Elevator and merchandising recordkeeping activities subject to monitoring for...
40 CFR 421.216 - Pretreatment standards for new sources.
2010-07-01
....171 Selenium 0.380 0.171 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 61.720 27.130 Fluoride 16.210 9.214 (b) Roaster SO2 scrubber. PSNS for the Primary Molybdenum and Rhenium Subcategory Pollutant....377 0.621 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 223.800 98.390 Fluoride 58.770 33.410 (c...
48 CFR 52.216-7 - Allowable Cost and Payment.
2010-10-01
... written understanding setting forth the final indirect cost rates. The understanding shall specify (i) the... special terms and the applicable rates. The understanding shall not change any monetary ceiling, contract... not subject to the interest penalty provisions of the Prompt Payment Act. Interim payments made prior...
50 CFR 216.245 - Requirements for monitoring and reporting.
2010-10-01
... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of first...
8 CFR 216.3 - Termination of conditional resident status.
2010-01-01
..., whichever is applicable, are true, or it becomes known to the government that an alien entrepreneur who was... applicable, are true, or that an alien entrepreneur who was admitted pursuant to section 203(b)(5) of the Act... immigration laws or an alien entrepreneur obtained permanent resident status through a commercial enterprise...
Selecting Schizosaccharomyces pombe diploids
DEFF Research Database (Denmark)
Ekwall, Karl; Thon, Genevieve
2017-01-01
Here we describe procedures for the selection of diploid Schizosaccharomyces pombe. ade6-M210/ade6-M216 heteroallelic complementation is widely used to select for Ade+ diploids. Such diploids will readily sporulate when starved of nitrogen. For some investigations, stable diploids are preferable (e.......g., for genetic complementation tests), and in these cases mating an h− strain with an h90 mat2-Pi-102 strain can be used to prevent sporulation. When ade6-M210/ade6-M216 mutations impact on, or show synthetic interactions with, the gene of interest, two different auxotrophic markers can be used to select...
Razif, S Mohd; Sulaiman, S; Hanie, S Soraya; Aina, E Nor; Rohaizak, M; Fuad, I; Nurismah, M I; Sharifah, N A
2011-08-01
Breast cancer is the most common cancer among Malaysian women. This study aimed to determine the reproductive for premenopausal breast cancer risk in Kuala Lumpur, Malaysia. A case-control study was conducted in 216 histopathologically confirmed cases of premenopausal breast cancer and 216 community-based controls that were matched by age within a 5-year period and ethnicity. The results of this study showed that premenopausal breast cancer risks were strongly related to parity, number of live births and family history of breast cancer. Premenopausal women with these known reproductive and family history risk factors should take extra measures to undergo appropriate screening method for early detection of breast cancer.
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
International Nuclear Information System (INIS)
Johansson, B.; Rosengren, A.
1975-01-01
A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K
ORF Alignment: NC_003075 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DNA-binding protein ... 19) ... Length = 153 ... Query: 96 ... EGCQKGARDASGRCISH...GGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGS 155 ... EGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKA...HGGGRRCEYLGCTKGAEGS Sbjct: 1 ... EGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGS 60 ... Query: 216 K
Directory of Open Access Journals (Sweden)
Fu Y
2014-06-01
Full Text Available Yunfeng Fu,1 Xinyu Wang,1 Xiaodong Cheng,1 Feng Ye,2 Xing Xie,1,2 Weiguo Lu1,2 1Department of Gynecologic Oncology, Women's Hospital, School of Medicine, Zhejiang University, 2Women's Reproduction and Health Laboratory of Zhejiang Province, Hangzhou, People's Republic of China Background: Glycogen synthase kinase-3 (GSK-3 plays an important role in human cancer. The aim of this study is to evaluate the clinicopathological significance of expression of GSK-3α/β and pGSK-3α/βTyr279/216 in patients with epithelial ovarian cancer and to investigate whether GSK-3 inhibition can influence cell viability and tumor growth of ovarian cancer. Methods: Immunohistochemistry was used to examine expression of GSK-3α/β and pGSK-3α/βTyr279/216 in 71 human epithelial ovarian cancer tissues and correlations between protein expression, and clinicopathological factors were analyzed. Cell viability was determined by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay following exposure of ovarian carcinoma cells to pharmacological inhibitors of GSK-3 or GSK-3 small interfering RNA. In vivo validation of tumor growth inhibition was performed with xenograft mice. Results: The expression levels of GSK-3α/β and pGSK-3α/βTyr279/216 in ovarian cancers were significantly higher than those in benign tumors. High expression of GSK-3α/β was more likely to be found in patients with advanced International Federation of Gynecology and Obstetrics (FIGO stages and high serum cancer antigen 125. Higher expression of pGSK-3α/βTyr279/216 was associated with advanced FIGO stages, residual tumor mass, high serum cancer antigen 125, and poor chemoresponse. Worse overall survival was revealed by Kaplan–Meier survival curves in patients with high expression of GSK-3α/β or pGSK-3α/βTyr279/216. Multivariate analysis indicated that FIGO stage, GSK-3α/β expression, and pGSK-3α/βTyr279/216 expression were independent prognostic factors for overall
International Nuclear Information System (INIS)
Seyhi, Brahima; Drogui, Patrick; Buelna, Gerardo; Azaïs, Antonin; Heran, Marc
2013-01-01
A submerged membrane bioreactor has been operated at the laboratory scale for the treatment of a synthetic effluent containing Bisphenol-A (BPA). COD, NH 4 –N, PO 4 –P and BPA were eliminated respectively, at 99%, 99%, 61% and 99%. The increase of volumetric loading rate from 0 to 21.6 g/m 3 /d did not affect the performance of the MBR system. However, the removal rate decreased rapidly when the BPA loading rate increased above 21.6 g/m 3 /d. The adsorption process of BPA on the biomass was very well described by Freundlich and Langmuir isotherms. Subsequently, biodegradation of BPA occurred and followed the first order kinetic reaction, with a constant rate of 1.13 ± 0.22 h −1 . During treatment, membrane fouling was reversible in the first 84 h of filtration, and then became irreversible. The membrane fouling was mainly due to the accumulation of suspended solid and development of biofilm on the membrane surface. -- Highlights: •High BPA removal rates (up to 99%) were obtained in the MBR. •A limit of the toxicity of 21.6 g/m 3 /d of BPA was recorded for the MBR. •The first order kinetic model described very well the biodegradation process for BPA. •The kinetic rates (0.61–1.13 h −1 ) depend on BPA loading (0.10–0.50 mg/g TSS). •The initial organic loading (0.04 and 0.20 g COD g −1 TSS) did not affect the kinetic. -- High BPA removal rates (up to 99%) were obtained in the MBR, with a limit of the toxicity closed to 21.6 g/m 3 /d of BPA
48 CFR 5119.1005 - Applicability.
2010-10-01
... SMALL BUSINESS AND SMALL DISADVANTAGED BUSINESS CONCERNS Small Business Competitiveness Demonstration... Z216. This includes both maintenance dredging and new start (new work) construction dredging. Dredging...
International Nuclear Information System (INIS)
Marshall, W.L.
1981-12-01
Two-liquid-phase boundaries at temperatures between 275 and 400 0 C were determined for potassium phosphate and sodium phosphate aqueous solutions for compositions from 0 to 60 wt % dissolved salt. The stoichiometric mole ratios, K/PO 4 or Na/PO 4 , were varied from 1.00 to 2.12 and from 1.00 to 2.16 for the potassium and sodium systems, respectively. Liquid-vapor critical temperatures were also determined for most of the dilute liquid phases that formed. The minimum temperatures (below which a single solution existed) of two-liquid-phase formation were 360 0 C for the potassium system and 279 0 C for the sodium system at mole ratios of 2.00 and 2.16, respectively. For the sodium system at mole ratios greater than 2.16, solids crystallized at lower temperatures as expected from earlier studies. In contrast, potassium solutions that were explored at mole ratios from 2.12 to 3.16 and at temperatures below 360 0 C did not produce solid phases nor liquid-liquid immiscibilities. Aside from the generally unusual observations of two immiscible liquids in an aqueous inorganic salt system, the results could possibly be applied to the use of phosphate additives in steam power generators. 16 refs
International Nuclear Information System (INIS)
Marshall, W.L.
1982-01-01
Two-liquid-phase boundaries at temperatures between 275 and 400 0 C were determined for potassium phosphate and sodium phosphate aqueous solutions for compositions from 0 to 60 wt % dissolved salt. The stoichiometric mole ratios, K/PO 4 or Na/PO 4 , were varied from 1.00 to 2.12 and from 1.00 to 2.16 for the potassium and sodium systems, respectively. Liquid-vapor critical temperatures were also determined for most of the dilute liquid phases that formed. The minimum temperatures (below which a single solution existed) of two-liquid-phase formation were 360 0 C for the potassium system and 279 0 C for the sodium system at mole ratios of 2.00 and 2.16, respectively. For the sodium system at mole ratios greater than 2.16, solids crystallized at lower temperatures as expected from earlier studies. In contrast, potassium solutions that were explored at mole ratios from 2.12 to 3.16 and at temperatures below 360 0 C did not produce solid phases or liquid-liquid immisibilities. Aside from the generally unusual observations of two immiscible liquids in an aqueous inorganic salt system, the results could possibly be applied to the use of phosphate additives in steam power generators
Czech Academy of Sciences Publication Activity Database
Kletetschka, Günther; Hrubá, J.
2015-01-01
Roč. 4, č. 1 (2015), s. 209-216 ISSN 2164-7860 Institutional support: RVO:67985831 Keywords : cryopreservation * cryptobiosis * DNA damage * extracellular damage * survival Subject RIV: BI - Acoustics
2013-05-15
... categories established in the NOFA. FOR FURTHER INFORMATION CONTACT: Joseph E. Taylor, Grants Management... Authority of the City of 209 Madison Street. Frederick MD......... 21701 216,000 Frederick. Housing...
K problému sekundárního (nepřímého) tlumočení v moderním českém biblickém překladu
Czech Academy of Sciences Publication Activity Database
Bartoň, Josef
2013-01-01
Roč. 5, č. 2 (2013), s. 207-216 ISSN 1804-1132 Institutional support: RVO:67985955 Keywords : Czech Biblical translation * indirect translation * second-hand translation Subject RIV: AI - Linguistics
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available sphate 3-epimerase (Pentose-5-phosphate ... 3-epimerase) (PPE) (R5P3E) ... Length = 216 ... Query: 1 ... MREEAMKKQGVLVAPSIM...GADLACIGREARNIEESGADLIHIDVMDGHFVPNITFGPGVV 60 ... MREEAMKKQGVLVAPSIMGADLACIGR...EARNIEESGADLIHIDVMDGHFVPNITFGPGVV Sbjct: 1 ... MREEAMKKQGVLVAPSIMGADLACIGREARNIEESG
Improving statistical reasoning: theoretical models and practical implications
National Research Council Canada - National Science Library
Sedlmeier, Peter
1999-01-01
... in Psychology? 206 References 216 Author Index 230 Subject Index 235 v PrefacePreface Statistical literacy, the art of drawing reasonable inferences from an abundance of numbers provided daily by...
48 CFR 204.1202 - Solicitation provision and contract clause.
2010-10-01
..., Offeror Representations and Certifications—Commercial Items. (iii) 252.216-7003, Economic Price Adjustment..., Secondary Arab Boycott of Israel. (vii) 252.225-7035, Buy American Act—Free Trade Agreements—Balance of...
Directory of Open Access Journals (Sweden)
Soner Solmaz
2016-12-01
Results: Of 216 SCD patients included in the study. Alloimmunization was detected in 67 (31.0% out of 216 patients who underwent transfusion, and in 17 (30.4% out of 56 patients in Group 1 and in 50 (31.3% out of 160 patients in Group 2. When the patients were analyzed according to alloimmunization development, our study revealed that neither SCD complications are a risk factor for alloimmunization nor alloimmunization increases mortality rates. Conclusion: High alloimmunization frequency found in our study suggests the insufficient adherence of alloimmunization-prevention policies in RBC transfusions performed except experienced institutions. Therefore alloimmunization may be reduced or prevented through performing extended red cell typing among SCD patients. [Cukurova Med J 2016; 41(4.000: 622-627
BDML Metadata: 177 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available -NC-SA 0.180 2f0b6ea4-8922-4cbf-a426-74f216c32563 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_R12B2.4_040819_02.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_R12B2.4_040819_02.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK..._P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/2f0b6ea4-8922-4cbf-a426-74f216c32563/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-90 ...
LOCAL GOVERNMENT AND INTERGOVERNMENTAL RELATIONS ...
African Journals Online (AJOL)
GRACE
study reveals that intergovernmental relations among the levels of government .... International Journal of Development and Management Review (INJODEMAR) Vol.10 June, 2015 ..... Administrative Science Quarterly, 16 (2): 216-229. Jinadu ...
48 CFR 1852.216-76 - Award Fee for service contracts.
2010-10-01
... payments exceed the final evaluation score, the Contractor will either credit the next payment voucher for... [insert payment office] will make payment based on [Insert method of authorizing award fee payment, e.g... fee has been paid, the Contracting Officer may direct the withholding of further payment of award fee...
12 CFR 216.4 - Initial privacy notice to consumers required.
2010-01-01
... individual who becomes your customer, not later than when you establish a customer relationship, except as... relationship with the consumer. (c) When you establish a customer relationship—(1) General rule. You establish a customer relationship when you and the consumer enter into a continuing relationship. (2) Special...
12 CFR 216.5 - Annual privacy notice to customers required.
2010-01-01
... annually during the continuation of the customer relationship. Annually means at least once in any period... annual notice to that customer by December 31 of year 2. (b)(1) Termination of customer relationship. You... customer concerning that relationship or you sell the credit card receivables without retaining servicing...
31 CFR 535.216 - Prohibition against prosecution of certain claims.
2010-07-01
... action, measure or process shall be taken after the effective date of this section in any judicial... result of popular movements in the course of the Islamic Revolution in Iran which were not an act of the...
48 CFR 52.216-17 - Incentive Price Revision-Successive Targets.
2010-10-01
... incurred plus an estimate of costs to complete performance, in the format of table 15-2, FAR 15.408 (or in... percents] of the total initial target cost. (3) If the total firm target cost plus the total firm target... is less than the total firm target cost, the adjustment is the total firm target profit, plus...
20 CFR 702.216 - Effect of failure to give notice.
2010-04-01
... supervisor was aware of the injury and/or in the case of a hearing loss, where the employer has furnished to the employee an audiogram and report which indicates a loss of hearing. Failure to give notice shall...'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims...
20 CFR 216.23 - Work which does not affect eligibility.
2010-04-01
... business, trade or profession as an independent contractor, rather than as an employee. An individual is... correspondence, by required attendance at meetings, or by other methods. (3) Integration into the employer's business. Integration of an individual's services into the business operations of an employer generally...
10 CFR 1021.216 - Procurement, financial assistance, and joint ventures.
2010-01-01
... competitive solicitations, unless the action is categorically excluded from preparation of an EA or EIS under...-source joint ventures, unless the action is categorically excluded from preparation of an EA or EIS under... reasoned decision. (g) The environmental critique will focus on environmental issues that are pertinent to...
48 CFR 216.505-70 - Orders under multiple award contracts.
2010-10-01
... under each order as one of the factors in the selection decision; and (4) The contracting officer should... statute expressly authorizes or requires that the purchase be made from a specified source; or (2) One of... the intent to make the purchase, including a description of the supplies to be delivered or the...
2-16 Thermonuclear Reaction Rates in rp Process of sd
Institute of Scientific and Technical Information of China (English)
Lam; Yihua[1; Nadezda; A.; Smirnova[2; W.A.; Richter[3
2014-01-01
Recently, we have constructed a new set of isospin non-conserving (INC) shell-model Hamiltonians as a combinationof isospin conserving (IC) Hamiltonian, Coulomb interaction and effective isospin-symmetry breaking forcesof nuclear origin[1]. The advantage is that Coulomb effects are taken into account with great care, thus the new ap-Fig. 1 (color online) The comparison of resonant rates of23Al(p;)24Si calculated by IC and INC Hamiltonians. TheINC Hamiltonians of OB+USD, OB+USDA, OB+USDBwere constructed in Ref. [5]; whereas (cd-USD), (cd-USDA),(cd-USDB) are INC Hamiltonians in Ref. [1]. USD, USDA,USDB are IC Hamiltonians in Ref. [6].proach allows one to describe more accurately and topredict unknown nuclear level schemes and decay modes.Since the approximate isospin-symmetry becomes broken,a realistic amount of isospin-mixing in nuclearstates is thus introduced. Among numerous applicationsto the structure of proton-rich nuclei, we usedthe new Hamiltonian to calculate resonant reaction andnon-resonant reaction (direct capture) rates of radiativeproton-capture reactions important for astrophysical rpprocess.
Guaviare: Reencontrando Espacios e Identidades (pág. 216-223
Directory of Open Access Journals (Sweden)
Cristian Alexis Gil Ruiz
2010-07-01
Full Text Available La riqueza colombiana está en las selvas, claro, la faunística y florística que enluce a nuestro querido país, a continuación les mostraré rasgos de esa riqueza encontrada en el departamento del Guaviare, más exactamente en la vereda cerro azul, en un sitio llamado Cerro pinturas y que es un patrimonio cultural y arqueológico del departamento, espacios como hay en muchos escenarios de Colombia , que es un país hermoso, con varios sitios que no se han visitado, y que son dignos de ver, es triste que como estudiantes, como docentes en formación y más que todo, como colombianos, nos estemos perdiendo estas oportunidades. Además de ello debe entenderse al docente como un sujeto no sólo educativo, también es un sujeto con vocación social, política y cultural y que sea como sea, es un ciudadano y nunca dejara de serlo, así que como docentes es nuestro deber apropiarnos de sitios como éste y educar para que sean admirados, protegidos y sobre todo respetados.
12 CFR Appendix A to Part 216 - Model Privacy Form
2010-01-01
... market to me.” (4) Nonaffiliate opt-out. If the financial institution shares personal information... market to me.” or “□ Do not use my personal information to market to me.” A financial institution that... personal information with other financial institutions to jointly market to me.” (h) Barcodes. A financial...
50 CFR 216.150 - Specified activity and specified geographical region.
2010-10-01
... species: northern elephant seals (Mirounga angustirostris), harbor seals (Phoca vitulina), and California... with the launching of a total of 40 Coyote (or similar sized and smaller) missiles per year from San...
Effect of Smoking on Pharmacokinetics of Clopidogrel, an ...
African Journals Online (AJOL)
... in patients undergoing PCI. Keywords: Antiplatelet, Clopidogrel, Pharmacokinetics, Smoking, Cigarette ..... regimen of choice to prevent thrombotic complications. [2,16]. ... either the parent drug [19] or the carboxylic acid metabolite as an ...
2010-10-01
....216-70, Estimated quantities. (15) 852.228-71, Indemnification and insurance. (16) 852.229-70, Sales...) 852.273-71, Alternative negotiation techniques. (3) 852.273-72, Alternative evaluation. (4) 852.273-73...
National Research Council Canada - National Science Library
Welch, Andrew
2001-01-01
.... These managers responded, to two separate rounds of questionnaires using the Delphi method. The first round resulted in 45 respondents who supplied a total of 216 competency phrases and 528 SKA phrases...
76 FR 38650 - Environmental Impacts Statements; Notice of Availability
2011-07-01
... Disposition of the Property Either Through Transfer, Donations, or Sale, Downtown Seattle, WA, Comment Period... Outer Continental Shelf Oil and Gas Lease Sales: 2012 Central Planning Area Lease Sales: 216 and 222...
Soil salinity increases survival of freezing in the enchytraeid Enchytraeus albidus
Czech Academy of Sciences Publication Activity Database
Patrício Silva, A. L.; Holmstrup, M.; Košťál, Vladimír; Amorim, M. J. B.
2013-01-01
Roč. 216, č. 14 (2013), s. 2732-2740 ISSN 0022-0949 Institutional support: RVO:60077344 Keywords : ice content * freeze tolerance * osmolality Subject RIV: ED - Physiology Impact factor: 3.002, year: 2013
International Nuclear Information System (INIS)
Segre, Nadia; Fagundes, Rosane Correa
2013-01-01
In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)
Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex
Alpha-emitting nuclides in the marine environment
Pentreath, R. J.
1984-06-01
The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.
Determination of radium in water
International Nuclear Information System (INIS)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)