
Sample records for actinium 215

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    International Nuclear Information System (INIS)

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Spectroscopic and computational investigation of actinium coordination chemistry. (United States)

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes


    Fry, C; Thoennessen, M


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources. (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R


    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. IT 215 courses / snaptutorial


    IT 210 snaptutorial


    For more classes visit   IT 215 Week 1 CheckPoint: Text Printing Program   IT 215 Week 1 DQ 1   IT 215 Week 1 DQ 2   IT 215 Week 2 CheckPoint: Payroll Program Part 1   IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge   IT 215 Week 3 CheckPoint: Payroll Program Part 2   IT 215 Week 3 DQ 1   IT 215 Week 3 DQ 2   IT 215 Week 4 CheckPoint: Method...

  8. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    International Nuclear Information System (INIS)

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    International Nuclear Information System (INIS)

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    International Nuclear Information System (INIS)

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  12. Comment: 215 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 215.png Taxonomy icon (c) Database Center for Life Science licensed under CC Attribution2.1 Japan アイコン:電子顕微鏡バージョン bando 2010/02/15 15:30:03 2010/02/15 15:30:03 ...

  13. A new method for the determination of low-level actinium-227 in geological samples

    International Nuclear Information System (INIS)

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  14. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  16. IT 215 UOP Tutorial Courses/ Uoptutorial




    For more course tutorials visit   IT 215 Week 1 CheckPoint: Text Printing Program   IT 215 Week 1 DQ 1   IT 215 Week 1 DQ 2   IT 215 Week 2 CheckPoint: Payroll Program Part 1   IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge   IT 215 Week 3 CheckPoint: Payroll Program Part 2   IT 215 Week 3 DQ 1   IT 215 Week 3 DQ 2   IT 215 Week 4 CheckPoin...

  17. IT 215 UOP Course Tutorial / Tutorialoutlet




    For more course tutorials visit       IT 215 Week 1 CheckPoint: Text Printing Program IT 215 Week 1 Discussion Question 1 IT 215 Week 1 Discussion Question 2 IT 215 Week 2 CheckPoint: Payroll Program Part 1 IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge IT 215 Week 3 CheckPoint: Payroll Program Part 2 IT 215 Week 3 Discussion Question 1 IT 215 Week 3 Discussion Question 2 IT 215 Week 4 Check...

  18. 76 FR 6536 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T... (United States)


    ... products. That NPRM was published in the Federal Register on November 9, 2010 (75 FR 68728). That NPRM... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant.... Model CL-215-1A10 (CL- 215), CL-215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant)...





    For more course tutorials visit   IT 215 Week 1 CheckPoint: Text Printing Program   IT 215 Week 1 Discussion Question 1   IT 215 Week 1 Discussion Question 2   IT 215 Week 2 CheckPoint: Payroll Program Part 1   IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge   IT 215 Week 3 CheckPoint: Payroll Program Part 2   IT 215 Week 3 Discussion Question 1   IT 215 Week...

  20. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    International Nuclear Information System (INIS)

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  1. 75 FR 68728 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T... (United States)


    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10 (CL- 215), CL-215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes...: * * * * * Seven cases of on-ground hydraulic accumulator screw cap or end cap failure have been experienced on...

  2. 48 CFR 215.404 - Proposal analysis. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Proposal analysis. 215.404 Section 215.404 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Proposal analysis....

  3. 48 CFR 1333.215 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1333.215 Section 1333.215 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1333.215 Contract clauses. Alternate I of...

  4. 48 CFR 1433.215 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1433.215 Section 1433.215 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1433.215 Contract clauses. The...

  5. 48 CFR 833.215 - Contract clause. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 833.215 Section 833.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 833.215 Contract clause. The...

  6. 7 CFR 65.215 - Pork. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pork. 65.215 Section 65.215 Agriculture Regulations of..., PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.215 Pork. Pork means meat produced from hogs....

  7. 31 CFR 800.215 - Foreign national. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign national. 800.215 Section 800.215 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.215 Foreign national. The term foreign national means...

  8. 6 CFR 21.5 - Discrimination prohibited. (United States)


    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Discrimination prohibited. 21.5 Section 21.5... FROM THE DEPARTMENT OF HOMELAND SECURITY § 21.5 Discrimination prohibited. (a) General. No person in... participation in, be denied the benefits of, or be otherwise subjected to discrimination under, any program...

  9. 49 CFR 21.5 - Discrimination prohibited. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Discrimination prohibited. 21.5 Section 21.5... DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.5 Discrimination... discrimination under, any program to which this part applies. (b) Specific discriminatory actions prohibited:...

  10. 22 CFR 215.2 - Definitions. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 215.2 Section 215.2 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF 1974 § 215.2... citizen of the United States or an alien lawfully admitted for permanent residence; (e) Maintain...

  11. 2 CFR 215.34 - Equipment. (United States)


    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Equipment. 215.34 Section 215.34 Grants and... ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Property Standards § 215.34 Equipment. (a) Title to equipment acquired by a recipient with Federal funds shall vest in the recipient, subject to conditions...

  12. 32 CFR 215.6 - Responsibilities. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 215.6 Section 215.6 National... EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.6 Responsibilities. (a) The... the accomplishment of his public affairs responsibilities set forth in paragraph (f) of this...

  13. 14 CFR 121.215 - Cabin interiors. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cabin interiors. 121.215 Section 121.215 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS..., FLAG, AND SUPPLEMENTAL OPERATIONS Special Airworthiness Requirements § 121.215 Cabin interiors....

  14. 33 CFR 117.215 - Niantic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niantic River. 117.215 Section 117.215 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.215 Niantic River. (a) The draw...

  15. 47 CFR 80.215 - Transmitter power. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 80.215 Section 80.215... MARITIME SERVICES General Technical Standards § 80.215 Transmitter power. (a) Transmitter power shown on the radio station authorization is the maximum power the licensee is authorized to use. Power...

  16. 49 CFR 215.203 - Restricted cars. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Restricted cars. 215.203 Section 215.203..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Restricted Equipment § 215.203 Restricted cars. (a) This section restricts the operation of any railroad freight car that is— (1) More than...

  17. 27 CFR 555.215 - Housekeeping. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Housekeeping. 555.215 Section 555.215 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.215 Housekeeping....

  18. 7 CFR 215.15 - Withholding payments. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Withholding payments. 215.15 Section 215.15 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.15 Withholding payments. In accordance with Departmental regulations...

  19. 7 CFR 215.10 - Reimbursement procedures. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Reimbursement procedures. 215.10 Section 215.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.10 Reimbursement procedures. (a) To be entitled to...

  20. 7 CFR 215.17 - Program information. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program information. 215.17 Section 215.17 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.17 Program information. School Food Authorities and...

  1. 7 CFR 215.8 - Reimbursement payments. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Reimbursement payments. 215.8 Section 215.8 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.8 Reimbursement payments. (a) (b)(1) The rate of reimbursement...

  2. 25 CFR 215.12 - Advertising costs. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertising costs. 215.12 Section 215.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.12 Advertising costs. All advertising costs, publication fees,...

  3. 48 CFR 215.270 - Peer Reviews. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Peer Reviews. 215.270 Section 215.270 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... of Proposals and Information 215.270 Peer Reviews. Agency officials shall conduct Peer Reviews...

  4. 47 CFR 215.1 - Background. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Background. 215.1 Section 215.1... POINT FOR ELECTROMAGNETIC PULSE (EMP) INFORMATION § 215.1 Background. (a) The nuclear electromagnetic... available protective measures, and in order to avoid duplication of research efforts, it is desirable...

  5. ADJ 215 UOP Course Tutorial/TutorialRank




    For more course tutorials visit Tutorial Purchased: 1 Times, Rating:     ADJ 215 Week 1 Checkpoint Survey of Local Crime Prevention Methods ADJ 215 Week 1 DQ 1 and DQ 2 ADJ 215 Week 2 Assignment Just Desserts ADJ 215 Week 3 DQ 1 and DQ 2 ADJ 215 Week 4 Checkpoint Social Structure Crime ADJ 215 Week 4 Checkpoint Diversion Program ADJ 215 Week 4 Assignment Socialization and Criminal Behavior ADJ 215 Week 5 Checkpoint...

  6. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL (United States)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  7. 76 FR 34014 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and... (United States)


    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10, CL- 215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes AGENCY.... Model CL-215-1A10 airplanes, serial numbers 1051 through 1125 inclusive; Model CL-215- 6B11...

  8. Dicty_cDB: SSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI215 (Link to dictyBase) - - - Contig-U12249-1 SSI215Z (Link... to Original site) - - SSI215Z 640 - - - - Show SSI215 Library SS (Link to library) Clone ID SSI215 (Link Representative seq. ID SSI21...5Z (Link to Original site) Representative DNA sequence >SSI215 (SSI215Q) /CSM/SS/SSI2-A/SSI215Q.Seq.d/ XXXXX... producing significant alignments: (bits) Value SSI215 (SSI215Q) /CSM/SS/SSI2-A/SSI215Q.Seq.d/ 803 0.0 VSC83

  9. 7 CFR 215.3 - Administration. (United States)


    ... administration of the Program in the State in accordance with the provisions of this part, 7 CFR parts 235, 245, 15, 15a, 15b and, as applicable, 7 CFR part 3015, 7 CFR part 3016 and 7 CFR part 3019, and with FNS... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 215.3 Section 215.3...

  10. 5 CFR 179.215 - Refunds. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Refunds. 179.215 Section 179.215 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... (unless expressly prohibited by statute or regulation); or (2) An administrative or judicial order...

  11. 48 CFR 233.215 - Contract clause. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause. 233.215....215 Contract clause. Use Alternate I of the clause at FAR 52.233-1, Disputes, when— (1) The... (v) Tracked combat vehicles (vi) Related electronic systems; (2) The contracting officer...

  12. 14 CFR 21.215 - Application. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Application. 21.215 Section 21.215 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION... Office in the geographic area in which the manufacturer or air carrier is located. The application...

  13. 2 CFR 215.52 - Financial reporting. (United States)


    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Financial reporting. 215.52 Section 215.52... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized... information and the recipient's accounting records are not normally kept on the accrual basis, the...

  14. 2 CFR 215.31 - Insurance coverage. (United States)


    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Insurance coverage. 215.31 Section 215.31 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for...

  15. 25 CFR 215.13 - Bond. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Bond. 215.13 Section 215.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW... or notes in the aggregate sum prescribed as security for the carrying out of the terms,...

  16. 36 CFR 2.15 - Pets. (United States)


    ... section does not apply to dogs used by authorized Federal, State and local law enforcement officers in the... accordance with applicable Federal and State laws and in accordance with conditions which may be established... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Pets. 2.15 Section 2.15...

  17. 24 CFR 884.215 - Lease requirements. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lease requirements. 884.215 Section... RENTAL HOUSING PROJECTS Project Development and Operation § 884.215 Lease requirements. The Lease shall... provisions listed in paragraph (c) of this section. (a) Term of lease. The term of the Lease shall be for...

  18. 76 FR 66620 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and... (United States)


    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10, CL- 215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes AGENCY... comments. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Bombardier, Inc. Model...

  19. 49 CFR 215.303 - Stenciling of restricted cars. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Stenciling of restricted cars. 215.303 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Stenciling § 215.303 Stenciling of restricted cars. (a) Each restricted railroad freight car that is described in § 215.205(a)...

  20. 49 CFR 215.7 - Prohibited acts. (United States)


    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS General § 215.7 Prohibited acts. Any... railroad; a manager, supervisor, official, or other employee or agent of a railroad; any owner... providing goods or services to a railroad; and any employee of such owner, manufacturer, lessor, lessee,...

  1. 10 CFR 215.3 - Supply reports. (United States)


    ... ENERGY OIL COLLECTION OF FOREIGN OIL SUPPLY AGREEMENT INFORMATION § 215.3 Supply reports. (a) Any person having the right to lift for export by virtue of any equity interest, reimbursement for services... barrels per day or more of crude oil for a period of at least one year, or (2) a total of...

  2. 2 CFR 215.24 - Program income. (United States)


    ... to further eligible project or program objectives. (2) Used to finance the non-Federal share of the... REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Financial and Program Management § 215.24...

  3. 23 CFR 645.215 - Approvals. (United States)


    .... 109, 111, and 116, and 23 CFR 1.23 and 1.27, and meet the requirements of this regulation, the FHWA... Accommodation of Utilities § 645.215 Approvals. (a) Each State transportation department shall submit a... the FHWA for prior concurrence, except when the proposed installation is not in accordance with...

  4. 48 CFR 215.404-4 - Profit. (United States)


    ... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-4... prenegotiation profit or fee objective on any negotiated contract action when cost or pricing data is obtained... analysis when assessing cost realism in competitive acquisitions. (2) When using a structured approach,...

  5. 48 CFR 215.407-5 - Estimating systems. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Estimating systems. 215.407-5 Section 215.407-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM....407-5 Estimating systems....

  6. 29 CFR 1910.215 - Abrasive wheel machinery. (United States)


    ... 29 Labor 5 2010-07-01 2010-07-01 false Abrasive wheel machinery. 1910.215 Section 1910.215 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.215 Abrasive wheel machinery. (a... wheel in motion. (5) Excluded machinery. Natural sandstone wheels and metal, wooden, cloth, or...

  7. 23 CFR 668.215 - Programming and project procedures. (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Programming and project procedures. 668.215 Section 668.215 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS EMERGENCY RELIEF PROGRAM Procedures for Federal Agencies for Federal Roads § 668.215...

  8. 41 CFR 101-6.215-3 - Supervision and coordination. (United States)


    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Supervision and coordination. 101-6.215-3 Section 101-6.215-3 Public Contracts and Property Management Federal Property...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.215-3 Supervision and coordination....

  9. 26 CFR 1.215-1 - Periodic alimony, etc., payments. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Periodic alimony, etc., payments. 1.215-1 Section 1.215-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME..., etc., payments. (a) A deduction is allowable under section 215 with respect to periodic payments...

  10. 40 CFR 5.215 - Membership practices of certain organizations. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Membership practices of certain organizations. 5.215 Section 5.215 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL... Coverage § 5.215 Membership practices of certain organizations. (a) Social fraternities and...

  11. 49 CFR 215.119 - Defective freight car truck. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective freight car truck. 215.119 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.119 Defective freight car truck. A railroad may not place or continue in service...

  12. 40 CFR 21.5 - Issuance of statements. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Issuance of statements. 21.5 Section 21.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.5 Issuance of statements. (a) Upon application by a small business concern pursuant to § 21.3 the...

  13. 48 CFR 215.407-3 - Forward pricing rate agreements. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forward pricing rate agreements. 215.407-3 Section 215.407-3 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.407-3 Forward pricing rate agreements. (b)(i) Use forward pricing rate agreement...

  14. 7 CFR 215.9 - Effective date for reimbursement. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Effective date for reimbursement. 215.9 Section 215.9 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.9 Effective date for reimbursement. (a) A State Agency,...

  15. 7 CFR 215.14a - Procurement standards. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement standards. 215.14a Section 215.14a Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.14a Procurement standards. (a) General. State agencies and...

  16. 7 CFR 215.7 - Requirements for participation. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Requirements for participation. 215.7 Section 215.7 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.7 Requirements for participation. (a) Any school or...

  17. 7 CFR 215.6 - Use of funds. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Use of funds. 215.6 Section 215.6 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.6 Use of funds. (a) Federal funds made available under the Program shall be...

  18. 7 CFR 215.1 - General purpose and scope. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 215.1 Section 215.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.1 General purpose and scope. This part announces the policies...

  19. 7 CFR 215.13 - Management evaluations and audits. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Management evaluations and audits. 215.13 Section 215.13 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.13 Management evaluations and audits. (a) Unless...

  20. 7 CFR 215.11 - Special responsibilities of State agencies. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Special responsibilities of State agencies. 215.11 Section 215.11 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.11 Special responsibilities of State agencies....

  1. 7 CFR 215.5 - Method of payment to States. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Method of payment to States. 215.5 Section 215.5 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.5 Method of payment to States. (a) Funds to be paid to any...

  2. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    International Nuclear Information System (INIS)

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  3. 25 CFR 215.7 - Advertisement of sale of leases. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement of sale of leases. 215.7 Section 215.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.7 Advertisement of sale of leases. Upon authority being granted by the Secretary of the Interior to...

  4. 32 CFR 215.8 - Organization and administration. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Organization and administration. 215.8 Section...) MISCELLANEOUS EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.8 Organization and administration. (a) A DoD Civil Disturbance Steering Committee will be established to provide advice...

  5. 36 CFR 215.7 - Legal notice of decision. (United States)


    ... subject to appeal pursuant to 36 CFR part 215 and include the following: (i) Name and address of the Appeal Deciding Officer with whom an appeal is to be filed. The notice shall specify a street, postal..., or a designee, has determined that an emergency situation exists (§ 215.10), and which portion of...

  6. 12 CFR 347.215 - Exemptions from deposit insurance requirement. (United States)


    ... importance of maintaining and improving the availability of credit to all sectors of the United States... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Exemptions from deposit insurance requirement. 347.215 Section 347.215 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS...

  7. 10 CFR 215.5 - Pricing and volume reports. (United States)


    ... DEPARTMENT OF ENERGY OIL COLLECTION OF FOREIGN OIL SUPPLY AGREEMENT INFORMATION § 215.5 Pricing and volume reports. To the extent not reported pursuant to § 215.3, any person lifting for export crude oil from a... directly or indirectly for crude oil; changes in participation ratios; changes in...

  8. 48 CFR 952.215-70 - Key Personnel. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Key Personnel. 952.215-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.215-70 Key Personnel. As prescribed in 915.408-70, the contracting officer shall insert the following clause: Key Personnel (DEC...

  9. 48 CFR 2052.215-70 - Key personnel. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Key personnel. 2052.215-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2052.215-70 Key personnel. As... following clause as applicable to the requirement: Key Personnel (JAN 1993) (a) The following...

  10. 2 CFR 215.45 - Cost and price analysis. (United States)


    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Cost and price analysis. 215.45 Section 215... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER... Cost and price analysis. Some form of cost or price analysis shall be made and documented in...

  11. 49 CFR 215.121 - Defective car body. (United States)


    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Car Bodies § 215.121 Defective car body. A railroad may not place or continue in service a car, if: (a) Any portion of... 49 Transportation 4 2010-10-01 2010-10-01 false Defective car body. 215.121 Section...

  12. 14 CFR 21.5 - Airplane or Rotorcraft Flight Manual. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane or Rotorcraft Flight Manual. 21.5... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.5 Airplane or Rotorcraft Flight Manual. (a) With each airplane or rotorcraft that was not type certificated with an Airplane or Rotorcraft Flight...

  13. 47 CFR 36.215 - Miscellaneous revenue-Account 5200. (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Miscellaneous revenue-Account 5200. 36.215..., REVENUES, EXPENSES, TAXES AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 Operating Revenues and Certain Income Accounts Operating Revenues § 36.215 Miscellaneous revenue—Account 5200. (a) Directory...

  14. 32 CFR Appendix C to Part 45 - DD Form 215 (United States)


    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 215 C Appendix C to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. C Appendix C to Part 45—DD Form 215 EC21OC91.050...

  15. 2 CFR 215.42 - Codes of conduct. (United States)


    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Codes of conduct. 215.42 Section 215.42... Codes of conduct. The recipient shall maintain written standards of conduct governing the performance of... interest is not substantial or the gift is an unsolicited item of nominal value. The standards of...

  16. 22 CFR 215.6 - Special procedures: Medical records. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Special procedures: Medical records. 215.6... PRIVACY ACT OF 1974 § 215.6 Special procedures: Medical records. If the Assistant Director for Administration or the Privacy Liaison Officer, determines that the release directly to the individual of...

  17. 20 CFR 416.215 - You leave the United States. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You leave the United States. 416.215 Section... Eligible § 416.215 You leave the United States. You lose your eligibility for SSI benefits for any month during all of which you are outside of the United States. If you are outside of the United States for...

  18. 42 CFR 57.215 - Records, reports, inspection, and audit. (United States)


    ... overdue report. (3) The school must also comply with the requirements of 45 CFR part 74 and section 798(e... 42 Public Health 1 2010-10-01 2010-10-01 false Records, reports, inspection, and audit. 57.215... Health Professions Student Loans § 57.215 Records, reports, inspection, and audit. (a) Each...

  19. 48 CFR 215.470 - Estimated data prices. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Estimated data prices. 215.470 Section 215.470 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM....470 Estimated data prices. (a) DoD requires estimates of the prices of data in order to evaluate...

  20. 45 CFR 618.215 - Membership practices of certain organizations. (United States)


    ....215 Section 618.215 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL SCIENCE... institutions of higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX... Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  1. 37 CFR 1.215 - Patent application publication. (United States)


    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application publication. 1.215 Section 1.215 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions...

  2. Dicty_cDB: VFH215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um calcium-dependent cell adhesion molecule-1 DdCAD-1 (cadA) mRNA, complete cds. 1065 0...3 |AF340153.1 Dictyostelium discoideum calcium-dependent cell adhesion molecule-1...ts) Value ( P54657 ) RecName: Full=Calcium-dependent cell adhesion molecule ... 378 e-104 U20997_1( U20997 | Representative seq. ID VFH215F (Link to Original si...te) Representative DNA sequence >VFH215 (VFH215Q) /CSM/VF/VFH2-A/VFH215Q.Seq.d/ AAATA

  3. 18 CFR 367.2150 - Account 215, Appropriated retained earnings. (United States)


    ... NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2150 Account 215, Appropriated... ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED...

  4. Dicty_cDB: VHP215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gy vs Protein Score E Sequences producing significant alignments: (bits) Value AY631393_1( AY631393 |pid:none) Dictyostelium discoide...G19... 132 4e-29 AF350242_1( AF350242 |pid:none) Pichia angusta aminopeptidase gen...e... 130 9e-29 ( P32454 ) RecName: Full=Aminopeptidase 2, mitochondrial; ... 129 3e-28 protein update 2009....e URL seq. ID VHP215P (Link to Original site) Representative DNA sequence >VHP215 (VHP215Q) /CSM/VH/VHP2-A/VHP

  5. 48 CFR 215.404-76 - Reporting profit and fee statistics. (United States)


    ... statistics. 215.404-76 Section 215.404-76 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-76 Reporting profit and fee statistics. Follow the procedures at PGI 215.404-76 for reporting profit and fee statistics....

  6. 18 CFR 157.215 - Underground storage testing and development. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Underground storage... of the Natural Gas Act for Certain Transactions and Abandonment § 157.215 Underground storage testing... observation wells for the testing or development of underground reservoirs for the possible storage of gas,...

  7. 48 CFR 2052.215-75 - Proposal presentation and format. (United States)


    ... exception to submitting cost or pricing data shall be made in accordance with FAR 52.215-20(a). (iii) If the contracting officer does not grant the offeror an exception from the requirement to submit cost or pricing... the basic provision: (b)(2)(iv) The offeror's cost proposal shall be based on the NRC's...

  8. 48 CFR 215.404-71-1 - General. (United States)


    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215... range provides values based on above normal or below normal conditions. In the price negotiation... risk; (2) Contract type risk; (3) Facilities capital employed; and (4) Cost efficiency. (b)...

  9. 6 CFR 27.215 - Security vulnerability assessments. (United States)


    ...-risk, the facility must complete a Security Vulnerability Assessment. A Security Vulnerability... 6 Domestic Security 1 2010-01-01 2010-01-01 false Security vulnerability assessments. 27.215... provided in § 27.235, a covered facility must complete the Security Vulnerability Assessment through...

  10. 2 CFR 215.15 - Metric system of measurement. (United States)


    ... Programs” (56 FR 35801, 3 CFR, 1991 Comp., p. 343). ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Metric system of measurement. 215.15 Section... measurement. The Metric Conversion Act, as amended by the Omnibus Trade and Competitiveness Act (15 U.S.C....

  11. 36 CFR 215.5 - Legal notice of proposed actions. (United States)


    ... the notice of availability (NOA) in the Federal Register (§ 215.6(a)(2)). The legal notice must be published after the NOA and contain the NOA publication date. (vi) A statement that only those who submit... proposed action to be analyzed and documented in an EA. The publication date of the NOA in the...

  12. 36 CFR 215.19 - Appeal Reviewing Officer. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Appeal Reviewing Officer. 215... Reviewing Officer. (a) Designation. The Appeal Reviewing Officer shall be: (1) Designated by the Chief or... Appeal Reviewing Officer shall review an appeal and the decision documentation and make a...

  13. 49 CFR 180.215 - Reporting and record retention requirements. (United States)


    ... QUALIFICATION AND MAINTENANCE OF PACKAGINGS Qualification, Maintenance and Use of Cylinders § 180.215 Reporting... must include the following information: (1) Calibration test records. For each test to demonstrate calibration, the date; serial number of the calibrated cylinder; calibration test pressure; total, elastic...

  14. 20 CFR 628.215 - State Human Resource Investment Council. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false State Human Resource Investment Council. 628... PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Planning § 628.215 State Human Resource..., 702, and 703 of the Act, establish a State Human Resource Investment Council (HRIC). The...

  15. 36 CFR 21.5 - Therapeutic bathing requirements. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Therapeutic bathing... INTERIOR HOT SPRINGS NATIONAL PARK; BATHHOUSE REGULATIONS § 21.5 Therapeutic bathing requirements. Baths... physicians only if the bath is administered in accordance with the bath directions prescribed by...

  16. 7 CFR 1260.215 - Patents, copyrights, inventions and publications. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions and publications... AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Miscellaneous § 1260.215 Patents, copyrights, inventions and publications. (a) Any patents, copyrights, inventions or publications...

  17. 40 CFR 180.215 - Naled; tolerances for residues. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Naled; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.215 Naled; tolerances for residues. (a) General. (1) Tolerances are established for residues of...

  18. 48 CFR 52.215-17 - Waiver of Facilities Capital Cost of Money. (United States)


    ... Capital Cost of Money. 52.215-17 Section 52.215-17 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-17 Waiver of Facilities Capital Cost of Money. As prescribed in 15.408(i), insert the following clause: Waiver of Facilities Capital Cost of Money (OCT 1997) The Contractor did...

  19. 48 CFR 52.215-16 - Facilities Capital Cost of Money. (United States)


    ... Money. 52.215-16 Section 52.215-16 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-16 Facilities Capital Cost of Money. As prescribed in 15.408(h), insert the following provision: Facilities Capital Cost of Money (JUN 2003) (a) Facilities capital cost of money will be an allowable...

  20. 25 CFR 215.25 - Other minerals and deep-lying lead and zinc minerals. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Other minerals and deep-lying lead and zinc minerals. 215.25 Section 215.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.25 Other minerals and deep-lying...

  1. 41 CFR 102-37.215 - When must a SASP make a certification regarding lobbying? (United States)


    ... certification regarding lobbying? 102-37.215 Section 102-37.215 Public Contracts and Property Management Federal... Property § 102-37.215 When must a SASP make a certification regarding lobbying? You are subject to the anti-lobbying certification and disclosure requirements in part 105-69 of this title when all of the...

  2. 40 CFR 1065.215 - Pressure transducers, temperature sensors, and dewpoint sensors. (United States)


    ... sensors, and dewpoint sensors. 1065.215 Section 1065.215 Protection of Environment ENVIRONMENTAL... Measurement of Engine Parameters and Ambient Conditions § 1065.215 Pressure transducers, temperature sensors, and dewpoint sensors. (a) Application. Use instruments as specified in this section to...

  3. 50 CFR 226.215 - Critical habitat for the North Pacific Right Whale (Eubalaena japonica). (United States)


    ... Right Whale (Eubalaena japonica). 226.215 Section 226.215 Wildlife and Fisheries NATIONAL MARINE... DESIGNATED CRITICAL HABITAT § 226.215 Critical habitat for the North Pacific Right Whale (Eubalaena japonica). (a) Primary Constituent Elements. The primary constituent elements of the North Pacific right...

  4. 48 CFR 215.404-71-3 - Contract type risk and working capital adjustment. (United States)


    ... working capital adjustment. 215.404-71-3 Section 215.404-71-3 Federal Acquisition Regulations System... CONTRACTING BY NEGOTIATION Contract Pricing 215.404-71-3 Contract type risk and working capital adjustment. (a... varying contract types. The working capital adjustment is an adjustment added to the profit objective...

  5. 26 CFR 1.215-1T - Alimony, etc., payments (temporary). (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Alimony, etc., payments (temporary). 1.215-1T Section 1.215-1T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Additional Itemized Deductions for Individuals § 1.215-1T Alimony,...

  6. 41 CFR 102-34.215 - May Government contractors use Government motor vehicles? (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May Government contractors use Government motor vehicles? 102-34.215 Section 102-34.215 Public Contracts and Property... PROPERTY 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.215 May...

  7. 7 CFR 215.4 - Payments of funds to States and FNSROs. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Payments of funds to States and FNSROs. 215.4 Section 215.4 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.4 Payments of funds to States and FNSROs. (a) For...

  8. 7 CFR 215.18 - Information collection/recordkeeping-OMB assigned control numbers. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Information collection/recordkeeping-OMB assigned control numbers. 215.18 Section 215.18 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.18 Information...

  9. 7 CFR 215.12 - Claims against schools or child-care institutions. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Claims against schools or child-care institutions. 215.12 Section 215.12 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.12 Claims against schools or...

  10. 7 CFR 215.16 - Suspension, termination and grant closeout procedures. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Suspension, termination and grant closeout procedures. 215.16 Section 215.16 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.16 Suspension, termination and...

  11. 48 CFR 1452.215-70 - Examination of Records by the Department of the Interior. (United States)


    ... the Department of the Interior. 1452.215-70 Section 1452.215-70 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1452.215-70 Examination of Records by the Department of the Interior. As prescribed...

  12. Dicty_cDB: CFJ215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFJ215 (Link to dictyBase) - - - Contig-U16287-1 - (Link to Original site) ... equence. 66 6e-07 1 CF514038 |CF514038.1 CAbud0007_IVF _G07 Vitis vinifera cv. cabernet sauvignon (Clone 8 ... ) Bud - CABUD Vitis vinifera cDNA clone CAbud0007_IVF _G07 5', mRNA sequence. 64 3e-06 1 CB910900 |CB9109 ...

  13. 27 CFR 24.215 - Wine or wine products not for beverage use. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine or wine products not for beverage use. 24.215 Section 24.215 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.215 Wine or wine products not for...

  14. Functional brain studies with H215O-PET

    International Nuclear Information System (INIS)

    Positron emission tomography (PET) with intravenous injection of H215O allows us to obtain regional cerebral blood flow (rCBF) images repeatedly within a short period of time. Since the increase of electrical activity in a specific brain region is followed by the abrupt increase of rCBF, the technique with H215O-PET is suitable for functional stimulation-activation studies. In this study, we examined the following fundamental issues : (1) reproducibility of rCBF during resting condition (2) effect of physiological stimulation on CBF (3) anatomical identification of activated area. Our data suggest that relative CBF images and their paired subtraction are suitable for tapping functional localization. The changes in rCBF in association cortex for more complicated tasks are, in general, smaller than those in primary cortex. Combination display of PET image with MR-3D reconstructed brain surface image in each subject is the most reliable technique for anatomical identification of activated site. (J.P.N.)

  15. 22 CFR 215.4 - Times, places, and requirements for identification of individuals making requests. (United States)


    ... identification of individuals making requests. 215.4 Section 215.4 Foreign Relations AGENCY FOR INTERNATIONAL... verify the individual's identity; e.g. driver's license, employee identification card or medicare card... identity and which stipulates that the individual understands that knowingly or willfully seeking...

  16. 22 CFR 215.5 - Access to requested information by individuals. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Access to requested information by individuals. 215.5 Section 215.5 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR..., determination that access to the record may be granted, verification of the identity of the individual...

  17. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547....

  18. 48 CFR 215.404-70 - DD Form 1547, Record of Weighted Guidelines Method Application. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-70 DD Form 1547, Record of Weighted Guidelines Method Application. Follow the procedures at PGI 215.404-70 for use of DD Form 1547 whenever a...

  19. 12 CFR 215.5 - Additional restrictions on loans to executive officers of member banks. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Additional restrictions on loans to executive officers of member banks. 215.5 Section 215.5 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM LOANS TO EXECUTIVE OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) §...

  20. 31 CFR 20.215 - What must I include in my drug-free awareness program? (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false What must I include in my drug-free awareness program? 20.215 Section 20.215 Money and Finance: Treasury Office of the Secretary of the Treasury...-free awareness program to inform employees about— (a) The dangers of drug abuse in the workplace;...

  1. 25 CFR 215.21 - Payment of gross production tax on lead and zinc. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Payment of gross production tax on lead and zinc. 215.21... ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.21 Payment of gross production tax on lead and zinc. The superintendent of the Quapaw Indian Agency is hereby authorized and directed to pay at...

  2. 49 CFR 215.9 - Movement of defective cars for repair. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of defective cars for repair. 215.9... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS General § 215.9 Movement of defective cars for repair. (a) A railroad freight car which has any component described as defective in...

  3. 49 CFR 40.215 - What information about the DER do employers have to provide to BATs and STTs? (United States)


    ... to provide to BATs and STTs? 40.215 Section 40.215 Transportation Office of the Secretary of... Personnel § 40.215 What information about the DER do employers have to provide to BATs and STTs? As an employer, you must provide to the STTs and BATs the name and telephone number of the appropriate DER (and...

  4. 41 CFR 102-85.215 - What if another customer agency forces a GSA customer to move? (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What if another customer agency forces a GSA customer to move? 102-85.215 Section 102-85.215 Public Contracts and Property... § 102-85.215 What if another customer agency forces a GSA customer to move? If a GSA customer agency,...

  5. 49 CFR Appendix A to Part 215 - Railroad Freight Car Components (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Pt. 215, App. A Appendix A to... manufactured before May 7, 1958. 4. Griffin, three-riser cast steel wheel, ball rim design, 70-ton capacity....

  6. Importance of the CEP215-Pericentrin Interaction for Centrosome Maturation during Mitosis


    Seongjae Kim; Kunsoo Rhee


    At the onset of mitosis, the centrosome undergoes maturation, which is characterized by a drastic expansion of the pericentriolar material (PCM) and a robust increase in microtubule-organizing activity. CEP215 is one of the major PCM components which accumulates at the centrosome during mitosis. The depletion phenotypes indicate that CEP215 is essential for centrosome maturation and bipolar spindle formation. Here, we performed a series of knockdown-rescue experiments to link the protein-prot...

  7. 31 CFR 585.215 - Conveyances and cargo suspected of being in violation of United Nations sanctions; detention... (United States)


    ... being in violation of United Nations sanctions; detention; blocking. 585.215 Section 585.215 Money and... and cargo suspected of being in violation of United Nations sanctions; detention; blocking. (a) Except... § 585.201, but which are suspected of a violation of United Nations Security Council Resolutions No....

  8. 30 CFR 250.215 - What hydrogen sulfide (H2S) information must accompany the EP? (United States)


    ... methodologies outlined in 40 CFR part 68. ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What hydrogen sulfide (H2S) information must... Contents of Exploration Plans (ep) § 250.215 What hydrogen sulfide (H2S) information must accompany the...

  9. 20 CFR 405.215 - Procedures before a Federal reviewing official. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Procedures before a Federal reviewing... PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.215 Procedures before a Federal reviewing official. (a) General. The Federal...

  10. 75 FR 32440 - Catalog of Federal Domestic Assistance (CFDA) Number: 84.215J (United States)


    ... Federal Relay Service, toll free, at 1-800-877-8339. SUPPLEMENTARY INFORMATION: Purpose of Program: The...-Service Community Schools Catalog of Federal Domestic Assistance (CFDA) Number: 84.215J AGENCY: Office of..., definitions, and selection criteria for the Full-Service Community Schools (FSCS) program. The Secretary...

  11. 9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed... REQUIREMENTS Killed Virus Vaccines § 113.215 Bovine Virus Diarrhea Vaccine, Killed Virus. Bovine Virus Diarrhea... paragraph. (i) Eight bovine virus diarrhea susceptible calves (five vaccinates and three controls) shall...

  12. Molecular and immuno-characteristics of immunoglobulin-like glycoproteins in cancer cell-expressed biomarker, CA215. (United States)

    Lee, Gregory; Cheung, Anthony P; Li, Bo; Ge, Bixia; Chow, Po-Ming


    RP215 monoclonal antibody (Mab) was shown to recognize a specific carbohydrate-associated epitope found in cancer cell-expressed glycoproteins, known as CA215. The membrane-bound and soluble forms of CA215 were detected in almost all of the cancer cells in humans, but rarely found in normal tissues. Through MALDI-TOF MS analysis, it has been reported previously that as much as 40% of the detected tryptic peptides of CA215 showed high degrees of sequence homology to those found in immunoglobulin heavy chains. The cancer cell-derived immunoglobulins were further purified from CA215 by affinity column-linked with goat anti-human IgG for molecular characterizations. Semi-quantitative RT-PCR was used to determine the mRNA levels of various immunoglobulin genes expressed by cancer cells of single or multi-cell origins and compared with those found in normal human serum. The stability of CA215 was investigated under different experimental conditions. It was observed that the RP215-specific epitope in CA215 is stable at neutral pH, in human serum or in mice (half life of 5-18 days), but unstable at extreme pH's (pH ≤ 2.0; pH ≥ 12.0) or high temperatures. Enzyme immunoassays were performed with several secondary antibody probes related to human IgG. It was demonstrated that cancer cell-expressed immunoglobulins with RP215-specific epitope have much lower immunoactivity than that of normal human IgG (≤ 5%), despite the fact that both showed almost identical amino acid sequence in the respective Fc region reported previously. This could be the result of aberrant glycosylation of CA215 in cancer cells. Aberrant glycosylation of glycoproteins may have important biological implications on the proliferation of cancer cells in vitro or in vivo. PMID:22417288

  13. 48 CFR 853.215-70 - VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA. (United States)


    ..., Application for Furnishing Nursing Home Care to Beneficiaries of VA. 853.215-70 Section 853.215-70 Federal... 853.215-70 VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA. VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA, will be used...

  14. Downregulation of Plasma miR-215 in Chronic Myeloid Leukemia Patients with Successful Discontinuation of Imatinib

    Directory of Open Access Journals (Sweden)

    Kazuma Ohyashiki


    Full Text Available Approximately 40% of chronic myeloid leukemia (CML patients who discontinue imatinib (IM therapy maintain undetectable minimal residual disease (UMRD for more than one year (stopping IM (STOP-IM. To determine a possible biomarker for STOP-IM CML, we examined plasma miRNA expression in CML patients who were able to discontinue IM. We first screened candidate miRNAs in unselected STOP-IM patients, who had sustained UMRD after discontinuing IM for more than six months, in comparison with healthy volunteers, by using a TaqMan low-density array for plasma or exosomes. Exosomal miR-215 and plasma miR-215 were downregulated in the STOP-IM group compared to the control, indicating that the biological relevance of the plasma miR-215 level is equivalent to that of the exosomal level. Next, we performed real-time quantitative RT-PCR in 20 STOP-IM patients, 32 patients with UMRD on continued IM therapy (IM group and 28 healthy volunteers. The plasma miRNA-215 level was significantly downregulated in the STOP-IM group (p < 0.0001; we determined the cut-off level and divided the IM group patients into two groups according to whether the plasma miR-215 was downregulated or not. The IM group patients with a low plasma miR-215 level had a significantly higher total IM intake, compared to the patients with elevated miR-215 levels (p = 0.0229. Functional annotation of miR-215 target genes estimated by the Database for Annotation, Visualization and Integrated Discovery (DAVID bioinformatic tools involved cell cycle, mitosis, DNA repair and cell cycle checkpoint. Our study suggests a possible role of miR-215 in successful IM discontinuation.

  15. 49 CFR Appendix C to Part 215 - FRA Freight Car Standards Defect Code (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Pt. 215, App. C Appendix C to... 13/4″. (C)(1) Rim thickness is 11/16″ or less; (2) Rim thickness is 5/8″ or less; (3) Rim thickness is 9/16″ or less; (D) Wheel cracked or broken in: (1) rim, (2) flange, (3) plate or (4) hub area....

  16. 49 CFR Appendix B to Part 215 - Schedule of Civil Penalties 1 (United States)


    ... $100,000 for any violation where circumstances warrant. See 49 CFR part 209, appendix A. Failure to... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Pt. 215, App. B Appendix B to... 7,500 (c) Rim thickness of: (1) 11/16″ or less but more than 5/8″ 2,500 5,000 (2) 5/8″ or less...

  17. Synthesis of 2,15-Hexadecanedione as a Precursor of Muscone

    Institute of Scientific and Technical Information of China (English)

    郭媛; 顾焕; 史真


    Muscone is a precious fragrant compound scarce in nature. Many synthetic attempts for this unique natural product have been carried out. In this work, the one-carbon unit transfer reaction of tetrahydrofolate coenzyme was initialed. Bisbenzimidazolium salt was used as tetrahydrofolate coenzyme model, and thus the biomimetic synthesis of 2,15-hexadecanedione, a precursor of muscone, was successfully accomplished by using the addition-hydrolysis reaction of bisbenzimidazolium salt with methyl magnesium iodide.

  18. Modal Interpolation Program, L 215 (INTERP). Volume 2; Supplemental System Design and Maintenance Document (United States)

    Hirayama, M. Y.; Kroll, R. I.; Clemmons, R. E.


    The design, structure, and usage of the modal interpolation program L215 are presented. The program uses modal data sets of arrays containing interpolation coefficients. The interpolation arrays are used to determine displacements at various aerodynamic control points. The displacements consist of translations normal to the aerodynamic surface and surface slopes that are parallel and perpendicular to the free stream direction. Five different interpolation methods are available.

  19. Molecular line survey of Orion A from 215 to 247 GHz

    International Nuclear Information System (INIS)

    Molecular line emission from the core of the Orion molecular cloud has been surveyed from 215 to 247 GHz to an average sensitivity of about 0.2 K. A total of 544 resolvable lines were detected, of which 517 are identified and attributed to 25 distinct chemical species. A large fraction of the lines are partially blended with other identified transitions. Because of the large line width in the Orion core, the spectrum is near the confusion limit for the weakest lines identified (roughly-equal0.2 K)

  20. System for cerebral blood flow measurement using an H215O autoradiographic method and positron emission tomography

    International Nuclear Information System (INIS)

    A system for CBF measurement using an H215O autoradiographic method and positron emission tomography (PET) has been designed and installed as a clinical tool. Following an intravenous injection of H215O, a radioactivity accumulation in the brain tissue for 60 s and a continuous record of radioactivity in arterial blood were measured by a high counting speed PET device and a beta-ray detector, respectively, and CBF was calculated by a table-lookup procedure. First, this method was compared with the C15O2 inhalation steady-state method on 17 cerebrovascular disease patients and four normal subjects. The two values for CBF agreed with each other when H215O autoradiographic method was applied by correction for the dispersion in the measured arterial radioactivity-time curve. However, without the correction, the CBF by the H215O autoradiographic method revealed substantial overestimation by 30.6 +/- 17.5%. A reduced gray/white ratio of CBF was also observed in the H215O autoradiographic method. Second, simulation was performed in order to determine optimal accumulation time by PET scan; the result was that errors due to dispersion and time mismatch became critical as the accumulation time was shortened to less than 60 s

  1. A possible Chandra and Hubble Space Telescope detection of extragalactic WHIM towards PG 1116+215

    CERN Document Server

    Bonamente, M; Tilton, E; Liivamagi, J; Tempel, E; Heinamaki, P; Fang, T


    (Abridged) We have analyzed Chandra LETG and XMM-Newton RGS spectra towards the z=0.177 quasar PG 1116+215, a sightline that is rendered particularly interesting by the HST detection of several OVI and HI broad Lyman-alpha absorption lines that may be associated with the warm-hot intergalactic medium. We performed a search for resonance K-alpha absorption lines from OVII and OVIII at the redshifts of the detected far-ultraviolet lines. We detected an absorption line in the Chandra spectra at 5.2 sigma confidence level at wavelengths corresponding to OVIII K-alpha at z=0.0911+-0.0004+-0.0005 (statistical followed by systematic error). This redshift is within 3 sigma of that of a HI broad Lyman-alpha of b=130 km/s at z=0.09279+-0.00005. We have also analyzed the available XMM-Newton RGS data towards PG 1116+215. Unfortunately, the XMM-Newton data are not suitable to investigate this line because of instrumental features at the wavelengths of interest. At the same redshift, the Chandra and XMM-Newton spectra hav...

  2. A possible Chandra and Hubble Space Telescope detection of extragalactic WHIM towards PG 1116+215 (United States)

    Bonamente, M.; Nevalainen, J.; Tilton, E.; Liivamägi, J.; Tempel, E.; Heinämäki, P.; Fang, T.


    We have analysed Chandra low energy transmission grating and XMM-Newton Reflection Grating Spectrometer (RGS) spectra towards the z = 0.177 quasar PG 1116+215, a sightline that is rendered particularly interesting by the Hubble Space Telescope (HST) detection of several O VI and H I broad Lyman α absorption (BLA) lines that may be associated with the warm-hot intergalactic medium (WHIM). We performed a search for resonance Kα absorption lines from O VII and O VIII at the redshifts of the detected far-ultraviolet lines. We detected an absorption line in the Chandra spectra at the 5.2σ confidence level at wavelengths corresponding to O VIII Kα at z = 0.0911 ± 0.0004 ± 0.0005 (statistical followed by systematic error). This redshift is within 3σ of that of an H I broad Lyman α of b ≃ 130 km s-1 (corresponding to a temperature of log T(K) ≃ 6.1) at z = 0.092 79 ± 0.000 05. We have also analysed the available XMM-Newton RGS data towards PG 1116+215. Unfortunately, the XMM-Newton data are not suitable to investigate this line because of instrumental features at the wavelengths of interest. At the same redshift, the Chandra and XMM-Newton spectra have O VII Kα absorption-line features of significance 1.5σ and 1.8σ, respectively. We also analysed the available Sloan Digital Sky Survey (SDSS) spectroscopic galaxy survey data towards PG 1116+215 in the redshift range of interest. We found evidence for a galaxy filament that intersect the PG 1116+215 sightline and additional galaxy structures that may host WHIM. The H I BLA and the O VIII Kα absorbers are within a few Mpc of the filament (assuming that redshifts track Hubble flow distances) or consistent with gas accreting on to the filament from either direction relative to the sightline with velocities of a few × 100 km s-1. The combination of HST, Chandra, XMM-Newton and SDSS data indicates that we have likely detected a multi-temperature WHIM at z ≃ 0.091-0.093 towards PG 1116+215. The O VIII K

  3. Conformational flexibility related to enzyme activity: evidence for a dynamic active-site gatekeeper function of Tyr(215) in Aerococcus viridans lactate oxidase. (United States)

    Stoisser, Thomas; Brunsteiner, Michael; Wilson, David K; Nidetzky, Bernd


    L-Lactate oxidase (LOX) belongs to a large family of flavoenzymes that catalyze oxidation of α-hydroxy acids. How in these enzymes the protein structure controls reactivity presents an important but elusive problem. LOX contains a prominent tyrosine in the substrate binding pocket (Tyr(215) in Aerococcus viridans LOX) that is partially responsible for securing a flexible loop which sequesters the active site. To characterize the role of Tyr(215), effects of substitutions of the tyrosine (Y215F, Y215H) were analyzed kinetically, crystallographically and by molecular dynamics simulations. Enzyme variants showed slowed flavin reduction and oxidation by up to 33-fold. Pyruvate release was also decelerated and in Y215F, it was the slowest step overall. A 2.6-Å crystal structure of Y215F in complex with pyruvate shows the hydrogen bond between the phenolic hydroxyl and the keto oxygen in pyruvate is replaced with a potentially stronger hydrophobic interaction between the phenylalanine and the methyl group of pyruvate. Residues 200 through 215 or 216 appear to be disordered in two of the eight monomers in the asymmetric unit suggesting that they function as a lid controlling substrate entry and product exit from the active site. Substitutions of Tyr(215) can thus lead to a kinetic bottleneck in product release. PMID:27302031

  4. 20 CFR 652.215 - Do any provisions in WIA change the requirement that State merit-staff employees must deliver... (United States)


    ... requirement that State merit-staff employees must deliver services provided under the Act? 652.215 Section 652... § 652.215 Do any provisions in WIA change the requirement that State merit-staff employees must deliver... authority of the Act, including services to veterans, be provided by State merit-staff employees....

  5. Conformational flexibility related to enzyme activity: evidence for a dynamic active-site gatekeeper function of Tyr215 in Aerococcus viridans lactate oxidase (United States)

    Stoisser, Thomas; Brunsteiner, Michael; Wilson, David K.; Nidetzky, Bernd


    L-Lactate oxidase (LOX) belongs to a large family of flavoenzymes that catalyze oxidation of α-hydroxy acids. How in these enzymes the protein structure controls reactivity presents an important but elusive problem. LOX contains a prominent tyrosine in the substrate binding pocket (Tyr215 in Aerococcus viridans LOX) that is partially responsible for securing a flexible loop which sequesters the active site. To characterize the role of Tyr215, effects of substitutions of the tyrosine (Y215F, Y215H) were analyzed kinetically, crystallographically and by molecular dynamics simulations. Enzyme variants showed slowed flavin reduction and oxidation by up to 33-fold. Pyruvate release was also decelerated and in Y215F, it was the slowest step overall. A 2.6-Å crystal structure of Y215F in complex with pyruvate shows the hydrogen bond between the phenolic hydroxyl and the keto oxygen in pyruvate is replaced with a potentially stronger hydrophobic interaction between the phenylalanine and the methyl group of pyruvate. Residues 200 through 215 or 216 appear to be disordered in two of the eight monomers in the asymmetric unit suggesting that they function as a lid controlling substrate entry and product exit from the active site. Substitutions of Tyr215 can thus lead to a kinetic bottleneck in product release. PMID:27302031

  6. 48 CFR 215.403-1 - Prohibition on obtaining cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). (United States)


    ... METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.403-1 Prohibition on obtaining... clearly established on the basis of price analysis (see FAR 15.404-1(b)). (3) Commercial items. (A) Follow the procedures at PGI 215.403-1(c)(3)(A) for pricing commercial items. (B) By November 30th of...

  7. Results of the radiological survey at 1110 Central Avenue, Albany, New York (AL215)

    International Nuclear Information System (INIS)

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 1110 Central Avenue in Albany, New York (AL215) was the subject of a radiological investigation initiated May 4, 1987. This commercial property consists of a one-story concrete block office building (Building 1), a one-story concrete block warehouse (Building 2), and four connected storage buildings constructed variously of wood, metal, or concrete block. The structures are situated on an irregularly shaped lot. A diagram of the property showing the approximate boundaries and the 10-m grid network established for measurements outside the buildings is shown. The lot included in the radiological survey was /approximately/45 m wide by 98 m deep. Two views of the property are shown. 13 refs., 6 figs., 5 tabs

  8. 1 215例次恶性胆管梗阻内镜治疗的体会%Endoscopic management of 1 215 malignant bile duct obstructions

    Institute of Scientific and Technical Information of China (English)

    胡冰; 周岱云; 龚彪; 王书智; 杨广顺; 吴孟超


    目的探讨采用治疗性内窥镜逆行胰胆管插管技术(ERCP技术),姑息性解除恶性肿瘤所致胆管梗阻的可行性。方法采用ERCP治疗929例1 215例次胆管恶性梗阻,包括胆管癌567例次、肝癌255例次、胆囊癌83例次、胰腺癌172例次、乳头壶腹癌97例次、其它转移性肿瘤41例次;导致胆管低位梗阻263例次、中段梗阻43例次、高位梗阻909例次;血清胆红素(284.3±174.5)μmol/L。共行胆道内置管引流599例次、鼻胆管引流385例次,放置可膨式金属胆道支架167例次,联合引流39例次,乳头括约肌切开19例次,乳头开窗造口术6例次。结果操作成功率94.3%,消除黄疸总有效率81.8%,治疗后患者平均生存14个月,1、2、3年的预计存活率分别为75.9%、44.0%和25.2%。全组发生与操作有关并发症23例(2.6%),死亡3例(0.2%)。结论内镜介入治疗技术是安全有效解除胆道恶性梗阻的方法,对中晚期胆道肿瘤患者基本可替代姑息性胆道手术。%Objective To review the experience with endoscopic palliation of malignant obstructive jaundice (MOJ) in 929 patients. Methods From 1994 to 1998, 929 patients (598 Males and 331 females) underwent 1 215 endoscopic palliation drainages for MOJ in our hospital. The mean age of these patients was 57 years (range 8-86). Tumor obstruction occurred in the distal CBD (263 patients), the middle CBD (43), and the hilum (909), with a mean bilirubin level of 284 μmol/L (range 26-810). Of the 1 215 drainages, 599 were performed by stenting with plastic endoprosthesis, 385 by nasobiliary catheterization, 167 by expandable metal stents, 39 by combined drainage methods, 19 by tumor papillotomy, and 6 by endoscopic fistulostomy.  Results The success rate of endoscopic procedure was 94.3%. Jaundice was inproved in 81.8% of the patients with a significant reduction of serum bilirubin (64.7%). Post-drainage complication rate was 2.6%; which

  9. Functional brain mapping using H215O positron emission tomography (II): mapping of human working memory

    International Nuclear Information System (INIS)

    To localize and compare the neural basis of verbal and visual human working memory, we performed functional activation study using H215O PET. Repeated H215O PET scans with one control and three different activation tasks were performed on six right-handed normal volunteers. Each activation task was composed of 13 matching trials. On each trial, four targets, a fixation dot and a prove were presented sequentially and subject's tasks was to press a response button to indicate whether or not the prove was one of the previous targets. Short meaningful Korean words, simple drawings and monochromic pictures of human faces were used as matching objects for verbal or visual memory. All the images were spatially normalized and the differences between control and activation states were statistically analyzed using SPM96. Statistical analysis of verbal memory activation with short words showed activation in the left Broca's area, premotor cortex, cerebellum and right cingulate gyrus. In verbal memory with simple drawing, activation was shown in the larger regions including where activated with short words and left superior temporal cortex, basal ganglia, thalamus, prefrontal cortex, anterior portion of right superior temporal gyrus and right infero-lateral frontal cortex. On the other hand, the visual memory task activated predominantly right-sided structures, especially inferior frontal cortex, supplementary motor cortex and superior parietal cortex. The results are consistent with the hypothesis of the laterality and dissociation of the verbal and visual working memory from the invasive electrophysiological studies and emphasize the pivotal role of frontal cortex and cingulate gyrus in working memory system

  10. 12 CFR Appendix to Part 215 - Section 5200 of the Revised Statutes Total Loans and Extensions of Credit (United States)


    ... funds to or on behalf of a person pursuant to a contractual commitment; and (2) The term person shall... surplus. (5) Loans or extensions of credit to or secured by unconditional takeout commitments or... Loans and Extensions of Credit Appendix to Part 215 Banks and Banking FEDERAL RESERVE SYSTEM BOARD...

  11. Nonlinear competition between the whistler and Alfven firehoses. Journal of Geophysical Research, 106, 13,215, 2001

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Matsumoto, H.


    Roč. 106, - (2001), s. 13,215-13,224. ISSN 0148-0227 R&D Projects: GA AV ČR IAB3042106 Institutional research plan: CEZ:AV0Z3042911 Keywords : instability * whistler * Alfven wave Subject RIV: BE - Theoretical Physics Impact factor: 2.609, year: 2001

  12. Zum 215. Gebutstag von Admiral Ferdinand Baron von Wrangell : (29. Dezember 1797 - 25. 25. Mai 1870) / Peter Krienitz

    Index Scriptorium Estoniae

    Krienitz, Peter


    Admiral Ferdinand Baron von Wrangellist tema 215. sünniaastapäeva puhul. Silmapaistavast Kirde-Siberi uurijast. Tema poliitilisest tegevusest ja elust Roela mõisas. Ferdinand Baroni poolt seatud viisil tähistati jõulusid Roelas kuni 1944. aasta lõpuni.

  13. Application of a network analysis in H215O-PET study

    International Nuclear Information System (INIS)

    The goal of this study was to examine effective connectivity among brain areas involved in a memory function using a statistical method, i.e., structural equation modeling (SEM). Eight brain areas were chosen in left hemisphere including visual, frontal, and parahippocampal areas activated (analyzed with SPM99) during an associative memory task based on a H215O-PET study. A connectivity model consisting of these brain regions, its anatomical pathways, and the functional influences of these paths was hypothesized and task effect (picture memory task vs. perceptual control task) was compared with a statistical package program for SEM (AMOS 4.0). The strongest functional linkage from fusiform to parahippocampus was found in both tasks. Linkages both from cuneus and inferior prefrontal areas to middle frontal were significantly strong in the perceptual task (p<.005), whereas linkages from cuneus to fusiform as well as from parahippocampus to middle frontal were significantly strong in the memory task (p<.005). Our results confirmed that SEM can be a useful analysis method on hypothesized neural pathways among brain areas identified in functional images

  14. Autoguía para el telescopio 2,15 mts de CASLEO (United States)

    Aballay, J. A.; Casagrande, A. R.; Pereyra, P. F.; Marún, A. H.

    Se está desarrollando un sistema de autoguía para el telescopio de 2,15 mts. El mismo se realizará aprovechando el Offset Guider. Al ocular móvil de éste se vinculará alguna cámara digital (ST4-ST7-CH250) para lograr la visión del objeto. El funcionamiento del equipo será el siguiente: primero, dadas las coordenadas del objeto a observar, se tomarán las coordenadas del telescopio para que, a través de una base de datos, se determine un campo de objetos que sirvan para la cámara de visión, luego, la PC obtendrá el offset entre la estrella de observación y la estrella seleccionada como guía, este valor será trasladado a los motores que posicionarán en forma automática el ocular. Una vez que la estrella es visualizada en la cámara (monitor de PC ) se correrá el programa que guiará el telescopio automáticamente.

  15. Biopsy of human morula-stage embryos: outcome of 215 IVF/ICSI cycles with PGS.

    Directory of Open Access Journals (Sweden)

    Elena E Zakharova

    Full Text Available Preimplantation genetic diagnosis (PGD is commonly performed on biopsies from 6-8-cell-stage embryos or blastocyst trophectoderm obtained on day 3 or 5, respectively. Day 4 human embryos at the morula stage were successfully biopsied. Biopsy was performed on 709 morulae from 215 ICSI cycles with preimplantation genetic screening (PGS, and 3-7 cells were obtained from each embryo. The most common vital aneuploidies (chromosomes X/Y, 21 were screened by fluorescence in situ hybridization (FISH. No aneuploidy was observed in 72.7% of embryos, 91% of those developed to blastocysts. Embryos were transferred on days 5-6. Clinical pregnancy was obtained in 32.8% of cases, and 60 babies were born. Patients who underwent ICSI/PGS treatment were compared with those who underwent standard ICSI treatment by examining the percentage of blastocysts, pregnancy rate, gestational length, birth height and weight. No significant differences in these parameters were observed between the groups. Day 4 biopsy procedure does not adversely affect embryo development in vitro or in vivo. The increased number of cells obtained by biopsy of morulae might facilitate diagnostic screening. There is enough time after biopsy to obtain PGD results for embryo transfer on day 5-6 in the current IVF cycle.

  16. Results of the ultraviolet photometry of stars by means of Kosmos 215 satellite

    International Nuclear Information System (INIS)

    Photometric studies of stars have been made. Parallel direction telescopes with two photometers (lambdasub(max)=2740 A, Δlambda=120 A and lambdasub(max)=2275 A, Δlambda=110 A) for the entrance diafragm of 5 cm, visual field about 1 deg and relative aperture 1/3.5 were installed on the board of the ''Kosmos-215'' satellite. The satellite was not oriented, but a special damping system was used for lowering the angular velocity. The identification of stars was done with a magnetometer and two photometers which registered radiation fluxes from the stars in bands close to the B and V bands of the UBV system. Monochromatic fluxes in the wavelengths of 2740 and 2275 A have been determined for 36 stars; a comparison with other measurements was carried out for 15 stars. Data for 9 stars are in satisfactory agreement with the present measurements (within the accuracy limits of calibration and telemetry), for 6 stars a difference exists with the data obtained earlier. The dichromatic diagrams (U2740-V)-B-V) and (U2275-V)-(B-V) on the whole do not contradict the dependence found previously

  17. Measurement of regional cerebral blood flow with H215O positron emission tomography during Matas test - report of three cases

    International Nuclear Information System (INIS)

    The authors carried out a Matas test with a regional cerebral blood flow (rCBF) study using H215O positron emission tomography (PET) for three cases of large internal carotid artery aneurysms. There is a likely correlation between the cerebral blood flow (CBF) reduction rate obtained by PET, and the mean stump pressure available from a conventional balloon occlusion test. The advantages of this noninvasive and quantitative method are presented in comparison with other methods. (author)

  18. Cortical activation in profoundly deaf patients during cochlear implant stimulation demonstrated by H2(15)O PET

    International Nuclear Information System (INIS)

    Cochlear implants (CIs) are used to provide sensations of sound to profoundly deaf patients. The performance of the CI is assessed mainly by the subjective reports of patients. The aim of this study was to look for objective cortical responses to the stimulation of the CI. Two postlingually and two prelingually deaf patients were investigated by positron emission tomography (PET) using 15O-labeled water (H215O) to determine the regional cerebral blood flow (rCBF). Instead of quantifying rCBF in absolute terms, it was estimated by referring the regional tissue concentration of H215O to the mean whole brain concentration. CI stimulation encoded from white noise and sequential words led to an increased rCBF in the primary and secondary (Wernicke) auditory cortex. Relative elevations of up to 33% were observed bilaterally, although they were higher contralateral to the CI. These results were obtained not only in the postlingually deaf patients but also in two patients who had never been able to hear. Thus, it could be demonstrated that PET measurements of cerebral H215O distribution yield objective responses of the central auditory system during electrical stimulation by CIs in profoundly deaf patients

  19. microRNA-215异常激活抑制Dicer1促进肝癌细胞迁移和转化

    Institute of Scientific and Technical Information of China (English)

    李文娟; 韩翰; 孙丹; 沈洪星; 李友军; 张进祥



  20. ARCON: experience in 215 patients with advanced head-and-neck cancer

    International Nuclear Information System (INIS)

    Purpose: 'ARCON' combines accelerated radiotherapy to counteract tumor repopulation with carbogen breathing and nicotinamide to reduce chronic and acute hypoxia. The aim of this Phase II study was to assess the feasibility, toxicity, and potential effectiveness of ARCON for advanced head-and-neck cancer. Methods and Materials: The study included 215 patients with head-and-neck carcinoma distributed as follows: larynx, n = 100; hypopharynx, n=50; oropharynx, n=52; oral cavity, n=13; Stage II, n=8, Stage III, n=71, and Stage IV, n=136. Accelerated radiotherapy was given to a total dose of 64-68 Gy in 2-Gy fractions within 36-38 days. This was combined with carbogen breathing during irradiation and administration of nicotinamide (60-80 mg/kg) 1-1.5 h before irradiation. Results: There was full compliance with carbogen breathing in 88% of the patients. A nicotinamide dose of 80 mg/kg produced severe nausea and vomiting, necessitating discontinuation of the drug, in 31% of the patients. Adjustment of the dose to 60 mg/kg and antiemesis prophylaxis reduced the discontinuation rate to 10%. Confluent mucositis was observed in 91% of the patients with a median duration of 6 weeks. Grade 4 late complications occurred in 5% of the patients. The actuarial 3-year local control rates were 80% for larynx, 69% for hypopharynx, 88% for oropharynx, and 37% for oral cavity tumors. For T3-4 tumors, the local control rates were 80% for larynx, 60% for hypopharynx, 87% for oropharynx, and 29% for oral cavity. Regional control rates were 100% for N0, 93% for N1, and 74% for N2 disease. Conclusion: ARCON yields high local and regional control rates in advanced head-and-neck carcinomas, and compliance is satisfactory and morbidity acceptable. The local control rate of 80% for T3 and T4 larynx carcinomas offers excellent possibilities for organ preservation

  1. Functional brain mapping using H215O positron emission tomography (I): statistical parametric mapping method

    International Nuclear Information System (INIS)

    We investigated the statistical methods to compose the functional brain map of human working memory and the principal factors that have an effect on the methods for localization. Repeated PET scans with successive four tasks, which consist of one control and three different activation tasks, were performed on six right-handed normal volunteers for 2 minutes after bolus injections of 925 MBq H215O at the intervals of 30 minutes. Image data were analyzed using SPM96 (Statistical Parametric Mapping) implemented with Matlab (Mathworks Inc., U.S.A.). Images from the same subject were spatially registered and were normalized using linear and nonlinear transformation methods. Significant difference between control and each activation state was estimated at every voxel based on the general linear model. Differences of global counts were removed using analysis of covariance (ANCOVA) with global activity as covariate. Using the mean and variance for each condition which was adjusted using ANCOVA, t-statistics was performed on every voxel. To interpret the results more easily, t-values were transformed to the standard Gaussian distribution (Z-score). All the subjects carried out the activation and control tests successfully. Average rate of correct answers was 95%. The numbers of activated blobs were 4 for verbal memory I, 9 for verbal memory II, 9 for visual memory, and 6 for conjunctive activation of these three tasks. The verbal working memory activates predominantly left-sided structures, and the visual memory activates the right hemisphere. We conclude that rCBF PET imaging and statistical parametric mapping method were useful in the localization of the brain regions for verbal and visual working memory

  2. Growth, physicochemical properties, and morphogenesis of Chinese wild-type PRV Fa and its gene-deleted mutant strain PRV SA215

    Directory of Open Access Journals (Sweden)

    Tang Shanhu


    Full Text Available Abstract Background PRV Fa is common in China and causes most of the pseudorabies in the pig industry. A PRV SA215 strain with deleted gE, gI, and TK genes was constructed to develop a commercial attenuated live vaccine. However, the physicochemical properties, growth pattern, penetration kinetics, and morphogenesis of the PRV SA215 and its parental PRV Fa strain are unclear. Results A series of experiments were conducted to characterize both strains and provide more information. PRV Fa and PRV SA215 were found to have similar penetration patterns, with about 5 min half-time of penetration. The SA215 strain exhibited a slight delay in entry compared with PRV Fa. In the one-step growth test, the titers of the SA215 strain were first detected at 8 h, rapidly increased, and peaked at 12 h. A plateau was formed between 12-36 h of culturing. PRV SA215 showed delayed replication and approximately 10-30-fold lower titers during 0-16 h of culturing compared with the PRV-Fa strain. After 16 h, the PRV Fa titers dramatically decreased, whereas those of PRV SA215 were prolonged to 36 h and reached a titer value equal to that of PRV Fa and then decreased. Both strains were sensitive to both heat and acid-alkali treatments; however, PRV Fa was relatively more stable to heat treatment than PRV SA215. Both strains could propagate in the cultures with pH values from 5.0 to 9.0. Cultures with pH below 3.0 or above 11.0 were fatal to both strains. Both strains had considerable resistance to freeze-thawing treatments. Morphogenetic investigations showed that typical phases in the maturation pathway were observed in the PRV Fa-infected PK15 cells, whereas secondary envelopment was not observed in the PRV SA215 strain. Instead, capsid aggregations with concomitants of electrodense materials were observed. Conclusions These results suggest that PRV SA215 is a promising strain for vaccine development

  3. Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

    International Nuclear Information System (INIS)

    Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells

  4. Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Fabao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); You, Xiaona [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Chi, Xiumei [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Wang, Tao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Ye, Lihong [Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); Niu, Junqi, E-mail: [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Zhang, Xiaodong, E-mail: [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China)


    Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells.

  5. Superpave 在青海省 G215 大察公路上的应用

    Institute of Scientific and Technical Information of China (English)




  6. Crystal structure of spinel-type Li0.64Fe2.15Ge0.21O4


    Günther J. Redhammer; Gerold Tippelt


    Spinel-type Li0.64Fe2.15Ge0.21O4, lithium diiron(III) germanium tetraoxide, has been formed as a by-product during flux growth of an Li–Fe–Ge pyroxene-type material. In the title compound, lithium is ordered on the octahedral B sites, while Ge4+ orders onto the tetrahedral A sites, and iron distributes over both the octahedral and tetrahedral sites, and is in the trivalent state as determined from Mössbauer spectroscopy. The oxygen parameter u is 0.2543; thus, the spinel is close to having an...

  7. 外周血单个核细胞与HepG2.215细胞共培养体系的研究%Study of peripheral blood mononuclear cells and HepG2.215 cells co-culture system

    Institute of Scientific and Technical Information of China (English)

    胡勇; 吴晓蔓


    目的 建立外周血单个核细胞与HepG2.215细胞共培养体系,探讨不同培养基及效靶比对共培养体系的影响.方法 分离正常人外周血单个核细胞,加人植物血凝素(PHA),置于不同的培养基(DMEM,RPMI1640)中进行培养,采用不同效靶比((5:1、10:1、20:1、40:1)构建PBMCs与HepG2.215细胞共培养体系.用倒置显微镜观察细胞的形态及生长情况,台盼蓝拒染法检测PBMCs与HepG2.215细胞的细胞活力,cck-8法检测HepG2.215细胞的增殖活性.结果 DMEM培养基培养的HepG2.215细胞的细胞活力比RPM11640培养基培养的细胞高;而两种培养基培养的PBMCs的细胞活力无明显变化.共培养条件下,PBMCs对HepG2.215细胞增殖活性的抑制作用随效靶比的不同而有所差别,效靶比为20:1时抑制作用最强.结论 在PBMCs与HepG2.215细胞共培养体系中,细胞培养基和效靶比对HepG2.215细胞的生长有影响.%Objective To establish the co-culture system of peripheral blood mononuclear cells and HepG2.215 cells,and explore the effects of different culture medium and the target ratio on the impact of co-culture system. Methods PBMCs separated from normal human blood were cultured with PHA in different mediums (DMEM, RPMI1640).The co-culture system of PBMCs and HepG2.215 cells was established in different proportion (5:1,10:1,20:1,40:1 ).Morphology and growth condition of cells were observed by inverted microscope. The activity of PBMCs and HepG2.215 cells was evaluated by Trypan blue staining. The proliferation of HepG2.215 cells was measured by cck-8. Results The activity of HepG2.215 cells cultured with DMEM was higher than that of cells cultured with RPMI 1640(P<0.05). The activity of PBMCs had no significant change.The inhibition of PBMCs on HepG2.215 cells changed with the ratio of effector cells and target cells in co-culture condition,and shoed the strongest inhibition when the target ratio was 20:1. Conclusion In the PBMCs and HepG2.215

  8. Parametric image of rMBF using factor analysis and cluster analysis on H215 dynamic myocardial PET

    International Nuclear Information System (INIS)

    Composition of parametric image (PI) of rMBF measured by H215O PET has been the goal of many research efforts. However, this has been difficult to accomplish because of the low SNR of the TAC of each voxel, and the complex kinetic model which includes parameters to correct partial volume and spillover effects. To develop a method to make a PI of rMBF by combining factor analysis and cluster analysis on H215O dynamic myocardial PET. First, right and left ventricular input functions and their factor images were obtained by applying the factor analysis to dynamic frames. By subtracting the factor images from the original dynamic frames, tissue image was obtained in which the vascular components were excluded. Cluster analysis, which averaged voxels with the same shape TACs (NeuroImage, 9:554-61, 1999), was applied to the pure tissue image to reduce calculation time and to improve SNR of the PI. Image quality and contrast was significantly improved in comparison to either the factor image of tissue or the subtracted image composed by subtracting the initial 30 sec-image from the 2 min one. Computation time was less than 1 min on the workstation 333 MHz with CPU. Parametric image developed in this study will serve as an important investigative tool for cardiovascular disease

  9. Limited ability of humoral immune responses in control of viremia during infection with SIVsmmD215 strain

    Energy Technology Data Exchange (ETDEWEB)

    Ribiero, Ruy M [Los Alamos National Laboratory


    To investigate the impact of humoral immunity on SIV replication, 11 rhesus macaques (RMs) were inoculated with the neutralization-sensitive strain SIVsmmD215. Seven RMs were treated every three weeks, with 50 mglkg of an anti-CD20 antibody (Rituxan, gift from Genentech) starting from day -7 p.i., as follows: four RMs were treated for two months, and three were treated for five months. The remaining four RMs were used as controls. Three RMs were completely depleted of CD20 cells. Four RMs only partially depleted CD20 cells in the LNs and intestine. The efficacy of tissue CD20 depletion predicted the ablation of antibody production, with SIVsmm seroconversion being delayed in the animals with complete tissue CD20 depletion, and neutralizing antibody production being significantly delayed and at low levels in all CD20-depleted RMs. There was no significant difference in acute or chronic VLs between CD20-depleted RMs and control monkeys, with a tendency for lower set-point VLs in CD20-depleted RMs. At 6 weeks p.i., cellular immune responses were significantly stronger in CD20 depleted RMs than in controls. After two years p.i., there was no significant difference in survival between CD20-depleted and control RMs. We concluded that CD20 depletion plays no significant role in the control of SIV replication or disease progression in SIVsmmD215-infected RMs.

  10. MiR-21-5p Links Epithelial-Mesenchymal Transition Phenotype with Stem-Like Cell Signatures via AKT Signaling in Keloid Keratinocytes (United States)

    Yan, Li; Cao, Rui; Liu, YuanBo; Wang, LianZhao; Pan, Bo; Lv, XiaoYan; Jiao, Hu; Zhuang, Qiang; Sun, XueJian; Xiao, Ran


    Keloid is the abnormal wound healing puzzled by the aggressive growth and high recurrence rate due to its unrevealed key pathogenic mechanism. MicroRNAs contribute to a series of biological processes including epithelial-mesenchymal transition (EMT) and cells stemness involved in fibrotic disease. Here, using microRNAs microarray analysis we found mir-21-5p was significantly up-regulated in keloid epidermis. To investigate the role of miR-21-5p in keloid pathogenesis, we transfected miR-21-5p mimic or inhibitor in keloid keratinocytes and examined the abilities of cell proliferation, apoptosis, migration and invasion, the expressions of EMT-related markers vimentin and E-cadherin and stem-like cells-associated markers CD44 and ALDH1, and the involvement of PTEN and the signaling of AKT and ERK. Our results demonstrated that up-regulation or knockdown of miR-21-5p significantly increased or decreased the migration, invasion and sphere-forming abilities of keloid keratinocytes, and the phenotype of EMT and cells stemness were enhanced or reduced as well. Furthermore, PTEN and p-AKT were shown to participate in the regulation of miR-21-5p on EMT phenotypes and stemness signatures of keloid keratinocytes, which might account for the invasion and recurrence of keloids. This molecular mechanism of miR-21-5p on keloid keratinocytes linked EMT with cells stemness and implicated novel therapeutic targets for keloids. PMID:27596120

  11. MiR-21-5p Links Epithelial-Mesenchymal Transition Phenotype with Stem-Like Cell Signatures via AKT Signaling in Keloid Keratinocytes. (United States)

    Yan, Li; Cao, Rui; Liu, YuanBo; Wang, LianZhao; Pan, Bo; Lv, XiaoYan; Jiao, Hu; Zhuang, Qiang; Sun, XueJian; Xiao, Ran


    Keloid is the abnormal wound healing puzzled by the aggressive growth and high recurrence rate due to its unrevealed key pathogenic mechanism. MicroRNAs contribute to a series of biological processes including epithelial-mesenchymal transition (EMT) and cells stemness involved in fibrotic disease. Here, using microRNAs microarray analysis we found mir-21-5p was significantly up-regulated in keloid epidermis. To investigate the role of miR-21-5p in keloid pathogenesis, we transfected miR-21-5p mimic or inhibitor in keloid keratinocytes and examined the abilities of cell proliferation, apoptosis, migration and invasion, the expressions of EMT-related markers vimentin and E-cadherin and stem-like cells-associated markers CD44 and ALDH1, and the involvement of PTEN and the signaling of AKT and ERK. Our results demonstrated that up-regulation or knockdown of miR-21-5p significantly increased or decreased the migration, invasion and sphere-forming abilities of keloid keratinocytes, and the phenotype of EMT and cells stemness were enhanced or reduced as well. Furthermore, PTEN and p-AKT were shown to participate in the regulation of miR-21-5p on EMT phenotypes and stemness signatures of keloid keratinocytes, which might account for the invasion and recurrence of keloids. This molecular mechanism of miR-21-5p on keloid keratinocytes linked EMT with cells stemness and implicated novel therapeutic targets for keloids. PMID:27596120

  12. Quantitative cerebral H215O perfusion PET without arterial blood sampling, a method based on washout rate

    International Nuclear Information System (INIS)

    The quantitative determination of regional cerebral blood flow (rCBF) is important in certain clinical and research applications. The disadvantage of most quantitative methods using H215O positron emission tomography (PET) is the need for arterial blood sampling. In this study a new non-invasive method for rCBF quantification was evaluated. The method is based on the washout rate of H215O following intravenous injection. All results were obtained with Alpert's method, which yields maps of the washin parameter K1 (rCBFK1) and the washout parameter k2 (rCBFk2). Maps of rCBFK1 were computed with measured arterial input curves. Maps of rCBFk2* were calculated with a standard input curve which was the mean of eight individual input curves. The mean of grey matter rCBFk2* (CBFk2*) was then compared with the mean of rCBFK1 (CBFK1) in ten healthy volunteer smokers who underwent two PET sessions on day 1 and day 3. Each session consisted of three serial H215O scans. Reproducibility was analysed using the rCBF difference scan 3-scan 2 in each session. The perfusion reserve (PR = rCBFacetazolamide-rCBFbaseline) following acetazolamide challenge was calculated with rCBFk2* (PRk2*) and rCBFK1 (PRK1) in ten patients with cerebrovascular disease. The difference CBFk2*-CBFK1 was 5.90±8.12 ml/min/100 ml (mean±SD, n=55). The SD of the scan 3-scan 1 difference was 6.1% for rCBFk2* and rCBFK1, demonstrating a high reproducibility. Perfusion reserve values determined with rCBFK1 and rCBFk2* were in high agreement (difference PRk2*-PRK1=-6.5±10.4%, PR expressed in percentage increase from baseline). In conclusion, a new non-invasive method for the quantitative determination of rCBF is presented. The method is in good agreement with Alpert's original method and the reproducibility is high. It does not require arterial blood sampling, yields quantitative voxel-by-voxel maps of rCBF, and is computationally efficient and easy to implement. (orig.)

  13. Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

    International Nuclear Information System (INIS)

    Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215Fr and propose a decay scheme up to Iπ = (47/2+) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model

  14. Further investigations at the Naigani Lapita site (VL 21/5), Fiji : excavation, radiocarbon dating and palaeofaunal extinction

    International Nuclear Information System (INIS)

    This paper brings up-to-date a report by S. Best of initial excavations at Naigani in 1981. The results of subsequent fieldwork in 2000 include the excavation and dating of Lapita-age ovens associated with early settlement and extinct palaeofauna. These include the giant megapode (Megavitiornis altirostris), a species of Ducula pigeon, the giant iguana (Lapitiguana impensa), and probably the endemic crocodile (Volia athollandersoni). The Lapita site of VL 21/5 dates from 900 BC and represents an initial colonising settlement within the Fiji Islands. The period of occupation ended around 750 BC. The significance of Naigani is considered in terms of chronology, ceramic history, economy, extinctions, origins and interactions. (author). 33 refs., 10 figs., 2 tabs.

  15. Optimization of protein production by Geotrichum candidum MIUG 2.15 by cultivation on paper residues, using response surface methodology

    Directory of Open Access Journals (Sweden)

    Gigi Coman


    Full Text Available Response surface methodology (RSM based on the 23 factorial central composite design (CCD was used to optimize the biotechnological conditions for growth and protein production by a selected fungal strain Geotrichum candidum MIUG 2.15, by solid-state cultivation on a semisolid medium based on a mixture of paper residues, i.e. office paper, newspaper, and cardboard, mixed in a ratio of 1:1:1(w/w, supplemented with cheese whey waste and complex manure. Three independent variables, the solid:liquid ratio, the concentration of complex manure, and cultivation time, were evaluated to determine their correlative effect on biomass production and protein biosynthesis. The optimal conditions for obtaining a maximum protein yield of 9.53% w/w dry mass were the following: the complex manure concentration of 0.5%, the solid:liquid ratio of 1:5, and the growth time of 10 days.

  16. Crystal structure of spinel-type Li0.64Fe2.15Ge0.21O4. (United States)

    Redhammer, Günther J; Tippelt, Gerold


    Spinel-type Li0.64Fe2.15Ge0.21O4, lithium diiron(III) germanium tetra-oxide, has been formed as a by-product during flux growth of an Li-Fe-Ge pyroxene-type material. In the title compound, lithium is ordered on the octa-hedral B sites, while Ge(4+) orders onto the tetra-hedral A sites, and iron distributes over both the octa-hedral and tetra-hedral sites, and is in the trivalent state as determined from Mössbauer spectroscopy. The oxygen parameter u is 0.2543; thus, the spinel is close to having an ideal cubic closed packing of the O atoms. The title spinel is compared with other Li- and Ge-containing spinels. PMID:27375876

  17. A diagnostic method for suspected Alzheimer's disease using H215O positron emission tomography perfusion Z score

    International Nuclear Information System (INIS)

    We developed cerebral perfusion Z score map (Z map) images using H215O and positron emission tomography (PET), and examined their use in diagnosing Alzheimer's disease (AD). Cerebral blood flow (CBF) images were obtained using the PET and H215O autoradiographic method. The best region for normalising the CBF value to remove individual variation was determined. Then CBF images were transformed to Talairach's standard space, and each pixel value of an individual's image set was normalized to the mean value of the sensorimotor area. Based on the CBF images of 20 normal volunteers, normative mean and standard deviation (SD) CBF images were constructed. Then, each pixel value of the axial CBF images in 28 patients with probable AD and 10 further normal volunteers was converted to a Z score (Z = [normal mean - individual value]/normal SD). A Z map, showing pixels exceeding a threshold of Z score > 2 on MRI of standardised anatomical space was demonstrated. These 38 Z maps were interpreted by four radiologists. When regions in the temporoparietal area were found with Z scores > 2, the subject was diagnosed as having AD. A receiver operating characteristic (ROC) analysis was performed to compare the conventional CBF images and Z maps. The diagnostic performance of the Z map was superior to that of visual inspection of conventional CBF images (mean areas under the ROC curve of the four radiologists were 0.946 and 0.584, respectively). These results indicate that a Z map obtained in this way is superior to conventional PET for diagnosing AD. (orig.)

  18. Remote processing, delivery and injection of H2[15O] produced from a N2/H2 gas target using a simple and compact apparatus. (United States)

    Ferrieri, R A; Alexoff, D L; Schlyer, D J; Wolf, A P


    We report here a simple apparatus for remote trapping and processing of H2[15O] produced from the N2/H2 target. The system performs a three step operation for H2[15O] delivery at the PET imaging facility which includes the following: (i) collecting the radiotracer in sterile water; (ii) adjusting preparation pH through removal of radiolytically produced ammonia, while at the same time adjusting solution isotonicity; and (iii) delivery of the radiotracer preparation to the injection syringe in a sterile and pyrogen-free form suitable for human studies. The processing apparatus is simple, can be remotely operated and fits inside a Capintec Dose Monitoring Chamber for direct measurement of accumulated radioactivity. Using this system, 300 mCi of H2[15O] (15 microA of 8 MeV D+ on target) is transferred from target through 120 m x 3.18 mm o.d. Impolene tubing to yield 100 mCi of H2[15O] which is isotonic, neutral and suitable for human studies. A remote hydraulically driven system for i.v. injection of the H2[15O] is also described. The device allows for direct measurement of syringe dose while filling, and for easy, as well as safe transport of the injection syringe assembly to the patient's bedside via a shielded delivery cart. This cart houses a hydraulic piston that allows the physician to "manually" inject the radiotracer without directly handling the syringe. PMID:7894394

  19. Evaluation of endothelium-dependent myocardial perfusion reserve in healthy smokers; cold pressor test using H215O PET

    International Nuclear Information System (INIS)

    Much evidence suggests long-term cigarette smoking alters coronary vascular endothelial response. In this study, we applied nonnegative matrix factorization (NMF), an unsupervised learning algorithm, to CO-less H215O-PET to investigate coronary endothelial dysfunction caused by smoking noninvasively. This study enrolled eighteen young male volunteers consisting of 9 smokers (23.8±1.1 yr; 6.6±2.5 pack-years) and 9 nonsmokers (23.8±2.9 yr). They do not have any cardiovascular risk factor or disease history. Myocardial H215O-PET was performed at rest, during cold (5.deg.C) pressor stimulation and during adenosine infusion. Left ventricular blood pool and myocardium were segmented on dynamic PET data by NMF method. Myocardial blood flow (MBF) was calculated from input and tissue functions by a single compartmental model with correction of partial volume and spillover effects. There were no significant difference in resting MBF between the two groups (Smokers: 1.43 0.41ml/g/min and non-smokers: 1.37±0.41 ml/g/min; p = NS). during cold pressor stimulation, MBF in smokers was significantly lower than that in non-smokers (1.25±0.34 ml/g/min vs 1.59±0.29 ml/g/min ; p = 0.019). The difference in the ratio of cold pressor MBF to resting MBF between the two groups was also significant (p=0.024; 90±24% in smokers and 122±28% in non-smokers.). During adenosine infusion, however, hyperemic MBF did not differ significantly between smokers and non-smokers (5.81±1.99 ml/g/min vs 5.11±1.31 ml/g/min ; p=NS). In smokers, MBF during cold pressor stimulation was significantly lower compared with nonsmokers, reflecting smoking-induced endothelial dysfunction. However, there was no significant difference in MBF during adenosine-induced hyperemia between the two groups

  20. X-ray Lβ215 emission spectrum of Ru in Ru(NH3)6Cl3

    International Nuclear Information System (INIS)

    One of the broader applications of synchrotron radiation has been to EXAFS studies for material structure determination, i.e., for an analysis of x-ray absorption over an extended energy region beyond a core ionization limit. Studies of the near edge structure (XANES) give a different type of information, characteristic of the local symmetry and electronic configuration of the absorbing atom. This type of information is reflected also in the x-ray emission spectra, in particular for transitions involving the valence levels. Examination of the near edge absorption or the emission spectrum does not require an instrument capable of scanning a wide energy range with high counting statistics, as does EXAFS; the needs are rather for good resolution and a reliable calibration of the energy scale. Some of the problems of near edge spectra were particularly evident in our investigation of Ru-Lβ215 emission from Ru(NH3)6Cl3. The Ru-Lβ215 emission was measured with a laboratory Rowland circle x-ray spectrometer with a curved quartz (1010) crystal (radius = 22 inches) in a fixed position appropriate to the energy range, and a position sensitive detector which can be positioned along the Rowland circle. The Ru spectrum was excited mainly by Sn-L/sub α/ primary radiation from a Sn anode in a demountable x-ray tube operating at 13 kV and 120 mA. The resolution of the instrument in this region is 1.5 eV. An accurate calibration of the energy scale was conveniently obtained by measuring a reference x-ray emission line in the same instrumental configuration. In the present case the Pd-L/sub α/ emission line at 2838 eV was used to establish the energy scale. The energy dispersion of the instrument was determined from the Cl-K/sub β/ emission spectrum of CH3Cl between 2810 eV and 2830 eV and Pd-Lα12 and extrapolated to the energy region of the recorded emission spectrum. 6 references, 1 figure

  1. Characteristics of Distribution of 215 Acinetobacter Pneumonia and Drug Susceptibility Analysis in Respiratory Ward%215株致肺炎不动杆菌的分布特点与药敏分析

    Institute of Scientific and Technical Information of China (English)

    周煦; 李文朴; 李榜龙


    [Objective] To investigate the distribution of Acinetobacter pneumonia,drug susceptibility and its relationship with diseases of pneumonia. [Methods] All the Acinetobacter isolated from sputum from January 2000 to December 2007 were analyzed retrospectively. [Results] All 215 Acinetobacter isolates were collected, which contained 132 baumanii(61.4%), accounting to 14.3% of the total of sputum culture positive and 16.4% of negative bacilli. The number of Acinetobacter isolated from patients with lung underlying diseases was 177(82.3%). The result of drug susceptibility suggested that sensitive antibacterials were Cefoperazone/ sulbactam ,Meropenem,Cefepime and Levofloxacin, and resistant antibacterials were Aztreonam, Mezlocillin and Amphemycin. The drug susceptibility between 132 baumanii and 83 other Acinetobacter had significant difference(P<0.05). The results of Acinetobacter strain sensitivity whether or not isolated from the patients using respirator had significant differences(P<0.05). [Conclusion] Acinetobacter is the fundamental composition of lower respiratory tract bacterial infection,and Acinetobacter baumanii is the main. The drug susceptibility is obviously different between baumanii and other Acinetobacter. Acinetobacter is resistant to antibiotics widely and also related to respirator and lung underlying diseases. The characteristics of Acinetobacter infection is prone to patients with lung underlying diseases and is not only the main pathogenic bacteria of hospital infection,but also can cause the patients with lung underlying diseases to suffer from the community acquired pneumonia.%[目的]了解本院住院患者肺炎不动杆菌的分布、与疾病的关系及药物敏感情况.[方法]对本院2000年1月至2007年12月本院肺炎住院患者痰或支气管分泌物标本不动杆菌培养阳性结果结合病历进行回顾性统计分析.[结果]共分离出不动杆菌215株,占总分离菌株的14.3%(215/1503),革兰阴性杆菌的16.4%(215

  2. Demonstration of decreased posterior cingulate perfusion in mild Alzheimer's disease by means of H215O positron emission tomography

    International Nuclear Information System (INIS)

    Although decreased posterior cingulate metabolism in Alzheimer's disease (AD) has been previously reported, there have been no reports on posterior cingulate perfusion. In this study we evaluated posterior cingulate perfusion as a relative value using statistical parametric maps (SPMs) and as an absolute value using conventional region of interest (ROI) settings. Twenty-eight subjects, including 14 patients with mild AD (mean age: 66.4±12.1 years) and 14 normal controls (65.9±7.3 years) were studied. Regional cerebral blood flow (CBF) was measured with H215O and positron emission tomography (PET). In the SPM analysis, the left posterior cingulate and left parietotemporal CBFs were significantly decreased in the patients with mild AD (P<0.001). At a lower statistical threshold (P<0.05), the right posterior cingulate and right parietotemporal CBFs were also significantly decreased in the AD patients. In the ROI studies, the left parietal and posterior cingulate CBFs in the patients with mild AD were significantly lower than those of the normal controls by analysis of variance and post-hoc Scheffe's test (P<0.001). We conclude that posterior cingulate perfusion is decreased in mild AD, reflecting the pathological changes and metabolic reduction in the posterior cingulate gyrus that have previously been reported to occur in mild AD. (orig.). With 1 fig., 2 tabs

  3. Comparison of rCBF between patients with medial temporal lobe epilepsy and normal controls using H215O PET

    International Nuclear Information System (INIS)

    The aim of this study was to identify the brain areas whose regional cerebral blood flow (rCBF) was changed in medial temporal lobe epilepsy (mTLE) using H215O-PET. 12 patients with mTLE (6 left, 6 right mTLE) and 6 normal controls were scanned during a fixation baseline period and a sensory-motor condition where subjects pressed a button to an upward arrow. A voxel-based analysis using SPM99 software was performed to compare the patient groups with the normal controls for the rCBF during fixation baseline period and for relative changes of rCBF during the sensory-motor task relative to fixation. Duirng the fixation baseline, a significant reduction of rCBF was found posterior insula bilaterally and right frontopolar regions in right mTLE patients compared to the normal controls. In left mTLE patients, the reduction was found in left frontopolar and temporal regions. During the sensory-motor task, rCBF increase over the fixation period, was reduced in left frontal and superior temporal regions in the right mTLE patients whereas in various areas of right hemisphere in left mTLE patients, relative to normal controls. However, the increased rCBF was also found in the left inferior parietal and anterior thalamic/fornix regions in both right and left mTLE patients compared to normal controls. Epilepsy induced changes were found not only in relative increase/ decrease of rCBF during a simple sensory-motor control condition relative to a fixation rest condition but also in the relative rCBF distribution during the rest period

  4. Clinical outcome of 215 transmucosal implants with a conical connection: a retrospective study after 5-year follow-up. (United States)

    Lopez, M A; Andreasi Bassi, M; Confalone, L; Gaudio, R M; Lombardo, L; Lauritano, D


    The purpose of this retrospective clinical study was to evaluate the survival rate (i.e. SVR – fixtures still in place at the end of the observation period) and success rate (i.e. SCR - bone resorption around implant neck) of an implant system characterized by cylindrical and tapered implants, both types of implant being equipped with a conical connection with an internal octagon (COC), both implant types having a 1.8 mm smooth neck, positioned above the bone crest level. A total of 65 subjects received 215 COCs between January 1996 and October 2011. All COCs were placed and restored by three experienced dental surgeons. The mean follow-up was 84±44 months. The patients involved in the study were both male (30) and female (35), of whom 30 were smokers (less than 20 cigarettes/day) and none was diabetic. The implants differed in terms of diameter and length, and were inserted both in the mandible (97) and in the maxilla (118). Sixty-seven implants were single tooth rehabilitations, and 148 prosthetic bridges. Fourteen had guided bone regeneration (GBR), and 10 were placed in post-extractive sites. Forty of the implants were provided with passing-screw abutments and 175 with full-screw abutments. The data were analyzed using descriptive statistics. None of the implants failed before prosthetic restoration, resulting in an SVR=100% after loading. The radiographic and clinical data revealed well-maintained, hard and soft tissue around the COCs, with an SCR=92.6%. Cox regression analyses did not detect any variables with statistical impact on the clinical outcome. In conclusion, Shiner XT implants are reliable tools for oral rehabilitation. PMID:27469549

  5. p53 nuclear accumulation and ERα expression in ductal hyperplasia of breast in a cohort of 215 Chinese women

    Directory of Open Access Journals (Sweden)

    Mao Xiao-yun


    Full Text Available Abstract Introduction Women with ductal hyperplasia including usual ductal hyperplasia (UDH and atypical ductal hyperplasia (ADH have an increased risk of developing invasive ductal carcinoma (IDC of breast. The importance of several molecular markers in breast cancer has been of considerable interest during recent years such as p53 and estrogen receptor alpha (ERα. However, p53 nuclear accumulation and ERα expression have not been assessed in ductal hyperplasia co-existing with ductal carcinoma in situ (DCIS or IDC versus pure ductal hyperplasia without DCIS or IDC. Materials and methods We investigated p53 nuclear accumulation and ERα expression in breast ductal hyperplasia in a cohort of 215 Chinese women by immunohistochemistry (IHC, which included 129 cases of pure ductal hyperplasia, 86 cases of ductal hyperplasia co-existing with DCIS (41 cases or IDC (45 cases. Results Nuclear p53 accumulation was identified in 22.8% of ADH (31/136, 41.5% of DCIS (17/41 and 42.2% of IDC (19/45, and no case of UDH (0/79. No difference in nuclear p53 accumulation was observed between pure ADH and ADH co-existing with DCIS (ADH/DCIS or IDC (ADH/IDC (P > 0.05. The positive rate of ERα expression was lower in ADH (118/136, 86.8% than that in UDH (79/79, 100% (P P P P Conclusions Different pathological types of ductal hyperplasia of breast are accompanied by diversity in patterns of nuclear p53 accumulation and ERα expression. At least some pure ADH is molecularly distinct from ADH/CIS or ADH/IDC which indicated the two types of ADH are molecularly distinct entities although they have the same morphological appearance.

  6. EST data: 215 [RED

    Lifescience Database Archive (English)

    Full Text Available CB0966 D22402 AU102142 DPlate 003 G03 5' AAG GTA CCG AAT TAT CAA TC 3' 5' TCA TTC TGG ACT GAA TG ... A AC 3' >AB019327_1(AB019327|pid:g3811007) Daucus ... carota mRNA for NADP specific isocitrate dehydroge ...

  7. CFTR depletion results in changes in fatty acid composition and promotes lipogenesis in intestinal Caco 2/15 cells.

    Directory of Open Access Journals (Sweden)

    Geneviève Mailhot

    Full Text Available BACKGROUND: Abnormal fatty acid composition (FA in plasma and tissue lipids frequently occurs in homozygous and even in heterozygous carriers of cystic fibrosis transmembrane conductance regulator (CFTR mutations. The mechanism(s underlying these abnormalities remained, however, poorly understood despite the potentially CFTR contributing role. METHODOLOGY/PRINCIPAL FINDINGS: The aim of the present study was to investigate the impact of CFTR depletion on FA uptake, composition and metabolism using the intestinal Caco-2/15 cell line. shRNA-mediated cftr gene silencing induced qualitative and quantitative modifications in FA composition in differentiated enterocytes as determined by gas-liquid chromatography. With the cftr gene disruption, there was a 1,5 fold increase in the total FA amount, largely attributable to monounsaturated and saturated FA compared to controls. The activity of delta-7 desaturase, estimated by the 16:1(n-7/16:0, was significantly higher in knockdown cells and consistent with the striking elevation of the n-7 FA family. When incubated with [14C]-oleic acid, CFTR-depleted cells were capable of quick incorporation and export to the medium concomitantly with the high protein expression of L-FABP known to promote intracellular FA trafficking. Accordingly, lipoprotein vehicles (CM, VLDL, LDL and HDL, isolated from CFTR knockdown cells, exhibited higher levels of radiolabeled FA. Moreover, in the presence of [14C]-acetate, knockdown cells exhibited enhanced secretion of newly synthesized phospholipids, triglycerides, cholesteryl esters and free FA, thereby suggesting a stimulation of the lipogenic pathway. Conformably, gene expression of SREBP-1c, a key lipogenic transcription factor, was increased while protein expression of the phosphorylated and inactive form of acetylCoA carboxylase was reduced, confirming lipogenesis induction. Finally, CFTR-depleted cells exhibited lower gene expression of transcription factors (PPARalpha

  8. [Characteristics and influence of different clinical forms on the development and prognosis of carotid sinus syndrome. Apropos of 215 cases]. (United States)

    Graux, P; Carlioz, R; Guyomar, Y; Lemaire, N; Rihani, R; Cornaert, P; Dutoit, A; Croccel, L


    The carotid sinus syndrome is a well-known cause of syncope: the cardio-inhibitory forms are the easiest to diagnose and probably the easiest to treat. However, the vasodepressive forms are as common but their outcome is mainly unknown. Eight hundred and fifty-three patients underwent endocavitary electrophysiological studies with invasive blood pressure measurement for unexplained syncope between October 1984 and January 1990. A carotid sinus syndrome was diagnosed in 215 cases. Fifty-two patients (24.2%) had a cardio-inhibitory form (ventricular standstill > or = 3 s during carotid sinus massage), 40 (18.6%) had a pure vasodepressive form (isolated fall of systolic blood pressure > 50 mmHg during massage) and 123 patients (57.2%) had a mixed form. The average age was 74.1 +/- 9.7 years with no difference between the different forms. A number of parameters was different on the cardio-inhibitory and vasodepressive forms: the number of men (75.6 vas 24.4%; p < 0.05) and the number of syncopes (83.3 vs 60%; p < 0.02) were greater in the cardio-inhibitory form; the vasodepressive forms were more often associated with a history of transient ischaemic attacks (15 vs 0%), a poor cardiovascular status (hypertension: 47.5 vs 15.7%; p < 0.01), coronary artery disease (47.5 vs 25.5%; p < 0.05), cardiac failure (27.5 vs 11.7%; p < 0.05), induction of sustained supraventricular tachycardia (50 vs 23.5%; p < 0.05) and a greater pacemaker effect (53.6 vs 34.8 mmHg; p < 0.01); of the 191 patients (84.9% of the population) followed up for an average of 21.2 months, 168 received treatment: implantation of a cardiac pacemaker in 108 patients, reduction of antihypertensive and/or potentially bradycardia-inducing drugs in 30 patients, prescription of antiarrhythmic therapy, in 30 patients.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:7487332

  9. Drug-resistance mutations number and K70R or T215Y/F substitutions predict treatment resumption during guided treatment interruptions. (United States)

    Darwich, Laila; Esteve, Anna; Ruiz, Lidia; Paredes, Roger; Bellido, Rocio; Cabrera, Cecilia; Romeu, Joan; Bofill, Margarita; Clotet, Bonaventura; Martinez-Picado, Javier


    The role of antiretroviral history and genotypic resistance information as predictors of the first treatment interruption (TI) length in a CD4(+) cell count and plasma viremia-guided TI study (GTI) was assessed. Drug-resistance mutations (DRMs) were monitored in chronically HIV-1-infected subjects who underwent GTI. Patients were retrospectively classified into those who received monotherapy or dual therapy prior to HAART (pre-HAART group, n = 44) or directly initiated HAART (HAART group, n = 43). DRMs were assessed by population-based sequencing of proviral DNA at baseline and plasma RNA monthly during TI up to 180 weeks. Univariate and multivariate Cox's proportional hazard models were used to determine time off therapy predictors. The emergence of viruses with DRMs during TI was 5.1-fold more likely in pre-HAART than in HAART patients. The presence of DRMs in proviral DNA or plasma RNA was associated with shorter time off therapy. An accumulation of three or more DRMs duplicated the risk of restarting therapy with respect to having one or two mutations. Regardless of the number of DRMs, the presence of K70R or T215F/Y predicted the shortest TI time. Multivariate analyses adjusted by nadir CD4(+) counts supported the presence of DRMs in plasma HIV-1 RNA, and specifically the K70R or T215F/Y, as potent predictors of time off therapy. A history of monotherapy or dual therapy, accumulation of three or more key DRMs in the HIV-1 polymerase, and/or the presence of substitutions K70R or T215F/Y were associated with shorter time off therapy during GTI. A genotypic profile could provide clinicians with a predictive tool for time off therapy when TI is required in patients with suppressed viremia in whom nadir CD4(+) count is not available. PMID:18462084

  10. Non-motor symptoms in a Flanders-Belgian population of 215 Parkinson’s disease patients as assessed by the Non-Motor Symptoms Questionnaire


    Crosiers, David; Pickut, Barbara; Theuns, Jessie; De Deyn, Peter Paul; Van Broeckhoven, Christine; Martinez-Martin, Pablo; Chaudhuri, K. Ray; Cras, Patrick


    Background: Non-motor symptoms (NMS) in Parkinson’s disease (PD) are frequent, increase the patients’ disability and have an important negative impact on their quality of life. Methods: We used a Dutch translation of the Non-Motor Symptoms Questionnaire (NMSQuest) to identify NMS in a population of 215 Belgian PD patients. Results: A median number of 8 NMS was reported per patient. Urinary urgency (59.2 %), nocturia (56.9 %), insomnia (45.8 %), attention problems (45.5 %) and orthostatism (41...

  11. Impactos de atropelamentos de animais silvestres no trecho da rodovia SP-215 confrontante ao Parque Estadual de Porto Ferreira – Porto Ferreira, SP (Nota Científica. Impacts roadkills mortality of wild animals in the area of SP-215 highway alongside Porto Ferreira State Park – Porto Ferreira, SP (Scientific Note.

    Directory of Open Access Journals (Sweden)

    Sonia Aparecida de SOUZA


    Full Text Available No presente trabalho foi realizado o monitoramento dos atropelamentos de animais silvestres na rodovia SP–215 no trecho confrontante ao Parque Estadual de Porto Ferreira. Em seis anos foram registrados 72 indivíduos, sendo 17 espécies de mamíferos, 10 de aves, quatro de répteis, uma de anfíbio e três indivíduos não identificados. Dentre esses, lobo-guará Chrysocyon brachyurus, jaguatirica Leopardus pardalis e cuíca-lanosa Caluromys lanatus se encontram na lista das espécies ameaçadas de extinção do Estado de São Paulo. A partir do conhecimento das espécies atingidas, faz-se necessário o desenvolvimento de estudos e propostas de implantação de medidas mitigadoras à presença da rodovia SP–215 para a conservação da fauna.This paper presents the data collected through the monitoring of roadkills on SP–215 highway in the area alongside Porto Ferreira State Park. During six years, 72 roadkills were recorded, including 17 species of mammals, 10 of birds, five of reptiles, one of amphibians and three unidentified individuals. Among those species, maned wolf Chrysocyon brachyurus, ocelot Leopardus pardalis, and Western woolly opossum Caluromys lanatus are included in the threatened species list of the state of São Paulo. After finding out which species are affected, it is necessary to develop studies and proposals for implementing effective mitigation measures for the presence of SP–215 highway in the area in order to preserve the local fauna.

  12. Die sogenaamde Bybelse kultuurmandaat (Gen. 1:28 en 2:15 en ontwikkeling ’n Ou-Testamentiese perspektief

    Directory of Open Access Journals (Sweden)

    H.F. van Rooy


    Full Text Available The so-called Biblical cultural mandate (Gen. 1:28 and 2:15 and development - a perspective from the Old TestamentIn the Reformed tradition Genesis 1:28 and 2:15 are combined and regarded as the so-called "cultural mandate", This so-called mandate is seen in traditional Reformed circles as the basis of man's responsibility to cultivate nature thus transforming nature into culture. This traditional view of the "cultural mandate ”is questioned in some circles, while other scholars link the present ecological crisis to this traditional view of the "cultural mandate". After a discussion of different evaluations of the "cultural mandate" the hermeneutical problem relating to the interpretation of the relevant material from Genesis 1 and 2 is discussed. This is followed by a discussion of different readings of the texts, viz., traditional Reformed readings, historical critical readings, an anti-cultural reading and an ecological reading. The texts are then interpreted from the perspective of a contemporary South Africa. In conclusion some implications of the discussion which could be developed within the South Africa n context are indicated. Human development and job creation receive the main emphasis.

  13. Heating induced structural and chemical behavior of KD2PO4 in the 25 °C–215 °C temperature range

    International Nuclear Information System (INIS)

    We have used powder x-ray diffraction (XRD) to investigate the structural and chemical modifications undergone by KD2PO4 (DKDP) upon heating from room temperature to 215 °C. Full-profile (Le Bail) analysis of our temperature-resolved data shows no evidence of polymorphic structural transitions or deuterium–hydrogen isotope exchange occurring below Ts = 185 °C. The lattice parameters of DKDP vary smoothly upon heating to Ts and are 0.2% to 0.6% greater than those of its isostructural hydrogenated counterpart KH2PO4 (KDP). In addition, XRD isotherms collected at Ts demonstrate the structural and chemical stability of the title compound at this temperature over a 10.5 h time period. Upon further heating, however, the tetragonal DKDP phase becomes unstable, as evidenced by its transition to a monoclinic DKDP modification and eventual chemical decomposition via dehydration. - Highlights: • Structural and chemical behavior of KD2PO4 is investigated upon heating to 215 °C • No polymorphic transitions or deuterium-hydrogen isotope exchange below Ts = 185 °C • KD2PO4 is structurally and chemically stable at Ts over a 10.5 h time period • KD2PO4 chemically decomposes via dehydration upon heating above Td = 195 °C

  14. Up- and down-conversion luminescence in the oxyfluoride glass ceramics containing Ba2+1.5xYb1−xF7:Tb3+ nanocrystals

    International Nuclear Information System (INIS)

    Transparent oxyfluoride borosilicate glass ceramics containing Ba2+1.5xYb1−xF7:Tb3+ nanocrystals were successfully prepared by a melt-quenching method with subsequent heat treatment. The precipitated crystalline phase in the glass matrix changed gradually from BaF2 to Ba2+1.5xYb1−xF7 with the increase of YbF3 content, which was confirmed by the results of XRD, HRTEM and EDX measurements. The ultraviolet and visible up-conversion and near-infrared quantum cutting down-conversion emissions were observed and interpreted. These materials could be used to modify the solar spectrum and enhance the silicon solar cell efficiency by the up-conversion and down-conversion luminescence of Tb3+–Yb3+ couples in the oxyfluoride borosilicate glass ceramics. -- Highlights: ► Oxyfluoride glass ceramics containing Ba2+1.5xYb1−xF7:Tb nanocrystals were prepared. ► The precipitated crystal phase changed from BaF2 to Ba2+1.5xYb1−xF7. ► Strong up-conversion and down-conversion emissions were observed and interpreted.

  15. Up- and down-conversion luminescence in the oxyfluoride glass ceramics containing Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}:Tb{sup 3+} nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Xin, Fengxia [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Zhao, Shilong, E-mail: [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Jia, Guohua; Huang, Lihui; Deng, Degang; Wang, Huanping [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Xu, Shiqing, E-mail: [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China)


    Transparent oxyfluoride borosilicate glass ceramics containing Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}:Tb{sup 3+} nanocrystals were successfully prepared by a melt-quenching method with subsequent heat treatment. The precipitated crystalline phase in the glass matrix changed gradually from BaF{sub 2} to Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7} with the increase of YbF{sub 3} content, which was confirmed by the results of XRD, HRTEM and EDX measurements. The ultraviolet and visible up-conversion and near-infrared quantum cutting down-conversion emissions were observed and interpreted. These materials could be used to modify the solar spectrum and enhance the silicon solar cell efficiency by the up-conversion and down-conversion luminescence of Tb{sup 3+}-Yb{sup 3+} couples in the oxyfluoride borosilicate glass ceramics. -- Highlights: Black-Right-Pointing-Pointer Oxyfluoride glass ceramics containing Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}:Tb nanocrystals were prepared. Black-Right-Pointing-Pointer The precipitated crystal phase changed from BaF{sub 2} to Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}. Black-Right-Pointing-Pointer Strong up-conversion and down-conversion emissions were observed and interpreted.

  16. Atomic and electronic structures of neutral and charged Pbn clusters (n=2-15): Theoretical investigation based on density functional theory (United States)

    Rajesh, Chinagandham; Majumder, Chiranjib


    The geometric and electronic structures of the Pbn+ clusters (n=2-15) have been investigated and compared with neutral clusters. The search for several low-lying isomers was carried out under the framework of the density functional theory formalism using the generalized gradient approximation for the exchange correlation energy. The wave functions were expanded using a plane wave basis set and the electron-ion interactions have been described by the projector augmented wave method. The ground state geometries of the singly positively charged Pbn+ clusters showed compact growth pattern as those observed for neutrals with small local distortions. Based on the total energy of the lowest energy isomers, a systematic analysis was carried out to obtain the physicochemical properties, viz., binding energy, second order difference in energy, and fragmentation behavior. It is found that n =4, 7, 10, and 13 clusters are more stable than their neighbors, reflecting good agreement with experimental observation. The chemical stability of these clusters was analyzed by evaluating their energy gap between the highest occupied and lowest unoccupied molecular orbitals and adiabatic ionization potentials. The results revealed that, although Pb13 showed higher stability from the total energy analysis, its energy gap and ionization potential do not follow the trend. Albeit of higher stability in terms of binding energy, the lower ionization potential of Pb13 is interesting which has been explained based on its electronic structure through the density of states and electron shell filling model of spherical clusters.

  17. Exploring the dust content of SDSS DR7 damped Lyman alpha systems at 2.15$\\le z_{ab}< $5.2

    CERN Document Server

    Khare, Pushpa; York, Donald G; Lundgren, Britt; Kulkarni, Varsha P


    We have studied a sample of 1084 intervening absorption systems with 2.15$\\le z_{ab}\\le$5.2, having log(N$_{\\rm HI}$) $>$ 20.0 in the spectra of QSOs in Sloan Digital Sky Survey (SDSS) data release 7 (DR7), with the aim of understanding the nature and abundance of the dust and the chemical abundances in the DLA absorbers. Composite spectra were constructed for the full sample and several subsamples, chosen on the basis of absorber and QSO properties. Average extinction curves were obtained for the samples by comparing their geometric mean composite spectra with those of two samples of QSOs, matching in z$_{em}$ and i magnitude with the DLA sample, one sample without any absorbers along their lines of sight and the other without any DLAs along their lines of sight irrespective of the presence of other absorption systems. While the average reddening in the DLA sample is small, we find definite evidence for the presence of dust in subsamples based on absorber properties, in particular the strength of metal absor...


    Directory of Open Access Journals (Sweden)



    Full Text Available BACKGROUND AND OBJEC TIVE: Cancer of the cervix is a leading cause of morbidity and mortality among women W orld W ide. Therefore to curb the disease there is need of awareness of this disease. This study is aimed to categorize the premalignant and malignant lesions at the earliest, to reduce the mortality and morbidity. It also aimed to know the incidence of malignancies at our set up and to calculate distribution of patient in relation to parity and symptoms. DESIGN AND SETTING: Study included 215 patients with complain of white dis charge per vagina, per vaginal bleeding and backache attending the gynecology OPD over a period of 05 years. PATIENT AND METHODS: Patients were subjected to cervical biopsy and biopsies were sent to pathology department. Detailed clinical history, age, age at marriage, parity and socio - economic status was obtained. RESULT: Result were classified histopathological l y as inflammatory lesions 70 cases, polypoidal lesion were 30, LSIL accounted for 32 cases and HSIL were 20 cases and 30 were malignant lesions. U nder malignant category moderately differentiated squamous cell carcinoma was the commonest. Maximum numbers of patients were subjected to cervical biopsies in 3 rd decade of life. Malignancies were common in 3 rd & 4 th decade of life. Most of the cases were of parity 4. CONCLUSION : Tissue biopsy is a valuable diagnostic procedure on which surgeons and radiologists still rely.

  19. Wavelength stabilized 785 nm DBR-ridge waveguide lasers with an output power of up to 215 mW

    International Nuclear Information System (INIS)

    Wavelength stabilized distributed Bragg reflector (DBR) diode lasers at an emission wavelength of 785 nm will be presented. The devices have a 14 nm thick GaAsP single quantum well as active layer, which is embedded in Al0.65Ga0.35As waveguide layers and Al0.7Ga0.3As cladding layers. The DBR structures are realized as deeply etched tenth order gratings using I-line wafer stepper lithography. The devices have a stripe width of 2.2 µm and a cavity length of 3 mm including a DBR grating with a length of 500 µm. The devices are mounted p-side up on C-mounts. At a temperature of 25 °C a continuous wave output power of 215 mW and a conversion efficiency of 28% are measured. Up to 140 mW single mode operation with a small tuning range below 190 pm is observed. At 50 mW an aging test was performed showing reliable operation over 1000 h. (paper)

  20. Surgical skill experience of 215 cases of pterygium treated by autologous corneal limbal stem cell transplantation%215例自体角膜缘干细胞移植治疗翼状胬肉手术技巧体会

    Institute of Scientific and Technical Information of China (English)

    潘勇; 葛军


    目的:探讨自体角膜缘干细胞移植治疗翼状胬肉手术技巧。方法回顾我院2006年8月至2013年8月采用自体角膜缘干细胞移植治疗翼状胬肉手术215例(267眼),对手术效果进行临床分析。结果术后随访1~3年,212例(264眼)治愈无复发,占98.9%,3例(3眼)复发,占1.1%。结论自体角膜缘干细胞移植治疗翼状胬肉手术疗效显著,复发率低,非常适合在各级医院推广。%Objective To investigate the surgical skill of autologous corneal limbal stem cell transplantation for the treatment of pterygium. Methods The medical records of 267 eyes of 215 patients who underwent autologous corneal limbal stem cell transplantation for pterygium in our hospital during Aug 2006 and Aug 2013 was reviewed. A clinical analysis was made on the effect of the treatment. Results Patients were followed up for 1-3 years. 264 eyes of 212 patients (98.9%) were cured without recurrence, while only 3 eyes of 3 patients (1.1%) recurred. Conclusion Autologous corneal limbal stem cell transplantation is an effective treatment for pterygium and has a low recurrence rate. It is very suitable for being popularized in varied levels of hospitals.

  1. Postoperative treatment of glioblastoma multiforme with radiation therapy plus concomitant and adjuvant temozolomide : A mono-institutional experience of 215 patients

    Directory of Open Access Journals (Sweden)

    Pramod Kumar Julka


    Full Text Available Objective: To study the clinical results and prognostic factors of patients with glioblastoma multiforme (GBM treated by postoperative radiation therapy (PORT and concomitant temozolomide followed by adjuvant temozolomide. Methods: From 2005 to 2008, 215 patients (median age 48 years with GBM were treated with PORT plus temozolomide chemotherapy. Radiation therapy (RT was employed with a dose of 60 Gy in 30 fractions over 6 weeks by conventional fractionation with concomitant temozolomide (75 mg/m 2 /day. Adjuvant therapy consisted of 6 cycles of temozolomide (150 mg/m 2 for 5 days, 28 days cycle. The primary end point of the study was overall survival (OS, and the secondary end points were progression free survival (PFS and toxicity. OS was determined with respect to different variables to study the prognostic significance. Results: Median follow up was 11 months (range 2-50 months. Median OS and PFS were 13 months and 11 months respectively. The 1-year and 2-year OS was 44% and 18% respectively. There was no statistical significant impact of age, sex, KP score, anatomical location and extent of surgery. Presentation without seizures (on univariate analysis and 6 cycles of adjuvant temozolomide therapy (on univariate as well as multivariate analysis were found significant prognostic factors. Sixteen patients developed grade III-IV neutropenia/thrombocytopenia during the course of RT. Conclusion: Our results authenticate the role of concomitant and adjuvant temozolomide chemotherapy in combination with PORT for the management of GBM patients. We strongly recommend complete 6 cycle of adjuvant temozolomide since it significantly improved the survival in our study.

  2. No association between exposure to perfluorinated compounds and congenital cryptorchidism: a nested case-control study among 215 boys from Denmark and Finland. (United States)

    Vesterholm Jensen, Dorte; Christensen, Jeppe; Virtanen, Helena E; Skakkebæk, Niels E; Main, Katharina M; Toppari, Jorma; Veje, Christine W; Andersson, Anna-Maria; Nielsen, Flemming; Grandjean, Philippe; Jensen, Tina Kold


    Geographical differences in the occurrence of diseases in male reproductive organs, including malformation in reproductive tract, between Denmark and Finland have been reported. The reason for these differences is unknown, but differences in exposure to chemicals with endocrine-disrupting abilities have been suggested. Among these chemicals are perfluoro-alkylated substances (PFASs), a group of water- and grease-repellent chemicals used in outdoor clothes, cookware, food packaging, and textiles. In this study, we, therefore, investigated differences in PFAS exposure levels between Denmark and Finland and the association between cord blood PFAS levels and congenital cryptorchidism. Boys from a joint ongoing prospective birth cohort study were included. We analyzed PFAS levels in cord blood serum samples collected from 29 Danish boys with congenital cryptorchidism, 30 healthy Danish matched controls recruited from 1997 to 2001, 30 Finnish cases, and 78 Finnish healthy matched controls recruited from 1997 to 1999. Additionally, 48 Finnish cases recruited from 2000 to 2002 were included. Perfluorooctanoic acid (PFOA) and perfluorooctanesulfonic acid (PFOS) were detected in all the 215 Danish and Finnish cord blood samples with significantly higher levels being observed in the Danish samples (medians: PFOA, 2.6 ng/ml and PFOS, 9.1 ng/ml) than in the Finnish samples (medians: PFOA, 2.1 ng/ml and PFOS, 5.2 ng/ml). We found no associations between cord blood PFOA and PFOS levels and congenital cryptorchidism after adjustment for confounders. Our data indicate that women in Denmark and Finland are generally exposed to PFOA and PFOS but there are differences in exposure levels between countries. We found no statistically significant association between cord blood PFOA and PFOS levels and congenital cryptorchidism; however, our study was small and larger studies are warranted. PMID:24218628

  3. Pollen stratigraphy, vegetation and climate history of the last 215 ka in the Azzano Decimo core (plain of Friuli, north-eastern Italy) (United States)

    Pini, R.; Ravazzi, C.; Donegana, M.


    The pollen record of the long succession of marine and continental deposits filling the subsident north-Adriatic foredeep basin (NE Italy) documents the history of vegetation, the landscape evolution and the climate forcing during the last 215 ka at the south-eastern Alpine foreland. The chronology relies on several 14C determinations as well as on estimated ages of pollen-stratigraphical and sea-level event tie-points derived from comparison with high-resolution marine records, speleothemes and ice cores. Mixed temperate rainforests persisted throughout MIS 7a-7c, being replaced by conifer forests after the local glacioeustatic regression during early MIS 6. The Alpine piedmont facing the Adriatic foredeeep was glaciated at the culmination of the penultimate glaciation, as directly testified by in situ fluvioglacial aggradation related to the building of a large morainic amphitheatre. The pollen record allows correlation with other European records and with the IRD from N-Atlantic and off Iberia, thus the duration of the penultimate glacial culmination at the southalpine fringe is estimated less than 13 ka between 148 ± 1 and >135 ka. The site was not reached by the Last Interglacial maximum sea transgression and enregistered a typical, though incomplete, Eemian forest record, lacking Mediterranean evergreen trees. A complex sequence of stadial-interstadial episodes is reconstructed during the Early and Middle Würm: major xerophyte peaks match IRD maxima occurred during Heinrich events in deep-sea cores offshore Iberia and in the N-Atlantic and allows to frame lumps of interstadial phases, marked by Picea peaks, each one including several DO warm events. Broad-leaved thermophilous forests disappeared from the north-eastern plain of Italy at the end of the Early Würm, whereas reduced populations of Abies and Fagus probably sheltered even during the Last Glacial Maximum. A renewed fluvioglacial in situ deposition between 30.4 ± 0.4 and 21.6 ± 0.5 ka cal BP sets

  4. Mimicry of a 21.5 kDa myelin basic protein peptide by a Maedi Visna virus polymerase peptide does not contribute to the pathogenesis of encephalitis in sheep. (United States)

    Davies, J M; Watt, N J; Torsteinsdottir, S; Carnegie, P R


    Epitope mimicry is the theory that an infectious agent such as a virus causes pathological effects via mimicry of host proteins and thus elicits a cross-reactive immune response to host tissues. Weise and Carnegie (1988) found a region of sequence similarity between the pol gene of the Maedi Visna virus (MVV), which induces demyelinating encephalitis in sheep, and myelin basic protein (MBP), which is known to induce experimental allergic encephalitis (EAE) in laboratory animals. In this study, cross-reactions between sera raised in sheep against synthetic peptides of MVV (TGKIPWILLPGR) and 21.5 kDa MBP (SGKVPWLKPGR) were demonstrated using enzyme-linked immunosorbant assay (ELISA) and thin layer chromatography (TLC) immunoprobing. The antibody responses of MVV-infected sheep were investigated using ELISA against the peptides, and MBP protein, immunoprobing of the peptides on TLC plates and Western blotting against MBP. Slight significant reactions to the 21.5 kDa MBP peptide (P plates. On the Western blots, eight of the 23 sheep with Visna had serum reactivity to MBP. This slight reaction to MBP in MVV-infected sheep is of interest because of the immune responses to MBP evident in multiple sclerosis and EAE, but its relevance in Visna is limited since no correlation with disease severity was observed. The cell-mediated immune responses of MVV-infected sheep against similar peptides was assessed. The peptides did not stimulate proliferation of peripheral blood lymphocytes of MVV-infected sheep. Since the MVV peptide was not recognised by antibodies or T lymphocytes from MVV-infected and encephalic sheep, it was concluded that epitope mimicry of this 21.5 kDa MBP peptide by the similar MVV pol peptide was not contributing to the immunopathogensis of Visna. The slight antibody response to MBP and the MBP peptide can be attributed to by-stander effects of the immunopathology of MVV-induced encephalitis. PMID:9014312



    Martha Luisa Puente Esparza; J. Humberto González Álvarez


    El objetivo de esta investigación fue determinar si las disposiciones fiscales del artículo 215 de la Ley del Impuesto sobre la Renta (LISR), sobre precios de transferencia a las empresas partes relacionadas, a las cuales les indica que deberán apegarse a la Guía de la Organización para la Cooperación y el Desarrollo Económico (OCDE), violentan los principios de constitucionalidad, legalidad y seguridad. Es un estudio documental, descriptivo, analizando el aspecto jurídico.

  6. The Generalization of the Kinetic Equations and the Spectral Conductivity Function to Anisotropic Systems: Case T-Al72.5Mn21.5Fe6 Complex Metallic Alloy


    Popčević, Petar; Batistić, Ivo; Tutiš, Eduard; Velebit, Kristijan; Heggen, Marc; Feuerbacher, Michael


    Electrical conductivity, σ, and thermoelectric power, S, of the monocrystalline T-Al72.5Mn21.5Fe6 complex metallic alloy have been investigated in the temperature range from 2 to 300 K. The crystallographic-direction-dependent measurements were performed along the [0 0 1], [0 1 0] and [1 0 0] directions of the orthorhombic unit cell, where the stacking direction is along the [0 1 0] direction. The electrical conductivity exhibits a very small anisotropy, and in all directions shows the non-me...

  7. Muon-Spin Rotation Measurements of an Unusual Vortex-Glass Phase in the Layered Superconductor Bi2.15Sr1.85CaCu2O8+δ


    Heron, David Owen Goudie; Ray, Soumya Jyoti; Lister, Stephen Joseph Shelford; Aegerter, C. M.; Keller, H.; Kes, P.H.; Menon, G. I.; Lee, Stephen Leslie


    Muon-spin rotation measurements, performed on the mixed state of the classic anisotropic superconductor Bi2.15Sr1.85CaCu2O8+δ, obtain quantities directly related to two- and three-body correlations of vortices in space. A novel phase diagram emerges from such local probe measurements of the bulk, revealing an unusual glassy state at intermediate fields which appears to freeze continuously from the equilibrium vortex liquid but differs both from the lattice and the conventional high-field vort...

  8. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    International Nuclear Information System (INIS)

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  9. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)


    Waldek, Achim Marcus


    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  10. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    International Nuclear Information System (INIS)

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  11. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  12. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications


    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon


    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  13. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  14. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    International Nuclear Information System (INIS)

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  15. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    International Nuclear Information System (INIS)

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  16. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  17. Angular dependence of the disorder crossover in the vortex lattice of Bi{sub 2.15}Sr{sub 1.85}CaCu{sub 2}O{sub 8+{delta}} by muon spin rotation and torque magnetometry

    Energy Technology Data Exchange (ETDEWEB)

    Aegerter, C.M.; Hofer, J.; Savic, I.M.; Keller, H. [Physik-Institut der Universitaet Zuerich, CH-8057 Zuerich (Switzerland); Lee, S.L.; Ager, C. [School of Physics and Astronomy, University of St. Andrews, St. Andrews, Fife KY169SS (United Kingdom); Lloyd, S.H.; Forgan, E.M. [School of Physics and Space Research, University of Birmingham, Birmingham B15 2TT (United Kingdom)


    Using the techniques of muon spin rotation and torque magnetometry, we investigate the crossover field B{sub cr} in Bi{sub 2.15}Sr{sub 1.85}Ca{sub 1}Cu{sub 2}O{sub 8+{delta}} at which the vortex lattice becomes disordered along the field direction. It is found that B{sub cr} scales as the projection of the applied field along the perpendicular to the superconducting planes. This has the implication that a field large enough to give a disordered lattice when applied perpendicular to the planes, can give a well-ordered vortex-line lattice for angles of the field to the c axis greater than a critical value. {copyright} {ital 1998} {ital The American Physical Society}

  18. Oceanographic profile data collected from sound velocimeter - moving vessel profiler casts aboard BLAKE as part of project OPR-J377-KR2-15 in the Gulf of Mexico from 2015-06-03 to 2015-10-30 (NCEI Accession 0139358) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0139358 includes physical and profile data collected aboard the BLAKE during project OPR-J377-KR2-15 in the Gulf of Mexico from 2015-06-03 to...

  19. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells. (United States)

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok


    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  20. No difference in brain activation during cognitive performance between ecstasy (3,4-methylenedioxymethamphetamine) users and control subjects: a [H2(15)O]-positron emission tomography study. (United States)

    Gamma, A; Buck, A; Berthold, T; Vollenweider, F X


    The long-term use of the serotonin-releaser and uptake-inhibitor 3,4-methylenedioxymethamphetamine (MDMA, "Ecstasy") has been associated with memory impairments and increased liability to depressive mood and anxiety attacks. It is unclear, however, whether these psychologic deviations are reflected in alterations of the underlying neurophysiologic substrate. The authors compared mood and regional cerebral blood flow (rCBF) profiles between regular polytoxic Ecstasy users and Ecstasy-naive controls. Brain activity as indexed by rCBF was measured during cognitive activation by an attentional task using positron emission tomography and [H2(15)O]. Mood was assessed by means of the Hamilton Rating Scale for Depression (HAM-D) and the EWL Mood Rating Scale. Statistical parametric mapping revealed that brain activity did not differ between the two groups. Both groups also performed equally on the cognitive task requiring sustained attention. However, significantly higher levels of depressiveness as determined by the HAM-D and EWL scales were found in Ecstasy-using subjects. These data indicate that, despite differences in mood, polytoxic Ecstasy users do not differ from Ecstasy-naive controls in terms of local brain activity. Heightened depressiveness in the Ecstasy group was consistent with results from previous studies and could be related to serotonergic hypofunction resulting from repeated MDMA consumption. However, this study cannot exclude the possibility that the observed differences are preexisting rather than a result of Ecstasy use. PMID:11199950

  1. Paleomagnetism of Basaltic Lava Flows in Coreholes ICPP 213, ICPP-214, ICPP-215, and USGS 128 Near the Vadose Zone Research Park, Idaho Nuclear Technology and Engineering Center, Idaho National Engineering and Environmental Laboratory, Idaho (United States)

    Champion, Duane E.; Herman, Theodore C.


    A paleomagnetic study was conducted on basalt from 41 lava flows represented in about 2,300 ft of core from coreholes ICPP-213, ICPP-214, ICPP-215, and USGS 128. These wells are in the area of the Idaho Nuclear Technology and Engineering Center (INTEC) Vadose Zone Research Park within the Idaho National Engineering and Environmental Laboratory (INEEL). Paleomagnetic measurements were made on 508 samples from the four coreholes, which are compared to each other, and to surface outcrop paleomagnetic data. In general, subhorizontal lines of correlation exist between sediment layers and between basalt layers in the area of the new percolation ponds. Some of the basalt flows and flow sequences are strongly correlative at different depth intervals and represent important stratigraphic unifying elements. Some units pinch out, or thicken or thin even over short separation distances of about 1,500 ft. A more distant correlation of more than 1 mile to corehole USGS 128 is possible for several of the basalt flows, but at greater depth. This is probably due to the broad subsidence of the eastern Snake River Plain centered along its topographic axis located to the south of INEEL. This study shows this most clearly in the oldest portions of the cored sections that have differentially subsided the greatest amount.

  2. Diffuse phase transition and impedance spectroscopy analysis of Ba2.15- x Na0.7+ x Nb5- x W x O15 ( x = 0.25) ferroelectric ceramic (United States)

    Neqali, A.; Belboukhari, A.; Bensaid, H.; El Bouari, A.; Bih, L.; Alimoussa, A.; Habouti, S.; Mezzane, D.


    A new rare earth ferroelectric tetragonal tungsten bronze compound with general formula Ba2.15- xNa0.7+ xNb5- xWxO15 ( x = 0.25) was elaborated as ceramic and investigated using X-ray diffraction and dielectric measurements. The results show a tetragonal phase with the space group P4bm. Special emphasis was done to characterize diffuse phase transition (DPT) that occurs close to 472 °C. Using dielectric measurements in a frequency range of (10 Hz-1 MHz) and in a temperature range (25-550 °C), we have shown that the real part of the permittivity close to DPT is well described by Santos-Eiras phenomenological model. Space charge polarization, relaxation phenomena and free charges conductivity have been analyzed using dielectric, impedance spectroscopy and Nyquist plots showed non-Debye (polydispersive) type relaxation. In paraelectric phase, the Arrhenius activation energies were determined. Frequency dependence of ac conductivity at different temperatures follows the Jonscher's universal law (Jonscher et al. in J Mater Sci 20:4431, 1985).

  3. Effect of Sol-Gel Ageing Time on Three Dimensionally Ordered Macroporous Structure of 80SiO2-15CaO-5P2O5 Bioactive Glasses

    Directory of Open Access Journals (Sweden)

    Thanida CHAROENSUK


    Full Text Available Three dimensionally ordered macroporous bioactive glasses (3DOM-BGs, namely 80SiO2-15CaO-5P2O5, were synthesized by sol-gel method. PMMA colloidal crystals and non-ionic block copolymers P123 were used as cotemplates. The amorphous 3DOM-BGs had skeletal walls enclosing macropores. Such structure resulted from octahedral and tetrahedral holes of the face-centered cubic (fcc closest packed PMMA templates and windows interconnecting through macropores network. The thicknesses of the walls were around 50 nm – 80 nm and the windows were 90 nm – 110 nm in diameter. These wall thickness is increased by with an increase in ageing time up to 24 h and  then gradually reduced with further increase in aging time. Vibration bands of Si–O–Si and P–O were evident in infrared spectra which are in agreement with EDS spectra indicating Si, P and Ca compositions. After in vitro bioactivity testing by soaking 3DOM-BGs in simulated body fluid at 37 °C, the crystallization of amorphous calcium phosphate layers compatible to the bone component of hydroxyl carbonate apatite were rapidly formed within 3 h. These results indicated that these 3DOM-BGs resembled ideal bone implant materials.DOI:

  4. Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

    International Nuclear Information System (INIS)

    Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

  5. Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

    Energy Technology Data Exchange (ETDEWEB)

    Hohloch, Karin; Lankeit, H.K.; Truemper, L. [Georg August University, Hematology and Oncology, Goettingen (Germany); Zinzani, P.L. [University of Bologna, Institute of Hematology and Medical Oncology ' ' L. e A. Seragnoli' ' , Bologna (Italy); Scholz, C.W. [Charite, University Berlin, Hematology, Oncology and Tumor Immunology, Berlin (Germany); Lorsbach, M.; Windemuth-Kieselbach, C. [Alcedis GmbH, Giessen (Germany)


    Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

  6. 22 CFR 215.14 - Specific exemptions. (United States)


    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF... identity of a source who furnished information to the Government under an express promise that the identity... implied promise that the identity of the source would be held in confidence; (3) Maintained in...

  7. 49 CFR 215.103 - Defective wheel. (United States)


    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System..., is 11/2 inches, or more; (c) The thickness of a rim of a wheel on the car is 11/16 of an inch, or less; (d) A wheel rim, flange, plate, or hub area on the car has a crack or break; (e) A wheel on...

  8. 7 CFR 215.14 - Nondiscrimination. (United States)


    .... When different types of milk are served to children, (a) a uniform price for each type of milk served... Department's agreements with State agencies, the State agencies' agreements with School Food Authorities and child-care institutions and the FNSRO agreements with School Food Authorities administering...

  9. 7 CFR 215.2 - Definitions. (United States)


    ... part, the term: 7 CFR part 3015 means the Uniform Federal Assistance Regulations published by the... miscellaneous Department requirements. 7 CFR part 3016 means the Department's Uniform Administrative... purchase price paid by the school or child care institution to the milk supplier for milk delivered to...

  10. 40 CFR 46.215 - Enforcement. (United States)


    ... the cost of the activity or action not in compliance; (3) Wholly or partly terminate the fellowship... will provide you an opportunity for hearing, appeal, or other administrative proceeding to which you... implementing regulations (2 CFR part 1532)....

  11. 24 CFR 91.215 - Strategic plan. (United States)


    ... jurisdiction will provide affordable housing as defined in 24 CFR 92.252 for rental housing and 24 CFR 92.254... public housing agency is designated as “troubled” by HUD under 24 CFR part 902, the jurisdiction must... the use of the CDBG funds in the revitalization area(s) as described in 24 CFR part 570, subpart...

  12. 12 CFR 215.4 - General prohibitions. (United States)


    ... preference to any insider of the member bank over other employees of the member bank and, in the case of extensions of credit to an insider of its affiliates, does not give preference to any insider of its... bank charges the executive officer or director the same fee charged any other customer of the bank...

  13. 2 CFR 215.22 - Payment. (United States)


    ...) Payment methods shall minimize the time elapsing between the transfer of funds from the United States.... Payment methods of State agencies or instrumentalities shall be consistent with Treasury-State CMIA agreements or default procedures codified at 31 CFR part 205. (b) Recipients are to be paid in...

  14. Case 215: voriconazole-induced periostitis. (United States)

    Tailor, Tina D; Richardson, Michael L


    History A 74-year-old woman presented with multifocal bone pain, including pain in multiple ribs, bilateral shoulders, and bilateral hips. The pain began several months before presentation and was quite severe, ultimately necessitating control with narcotics. At examination, strength in both lower extremities was slightly reduced, sensation and reflexes were intact, and range of motion was full, though painful. There were no notable constitutional symptoms of fever or weight loss. Laboratory work-up was remarkable for elevated alkaline phosphatase level (277 U/L [4.6 mkat/L]). The patient had undergone left lung transplantation 8 years prior for pulmonary fibrosis. A thorough pulmonary work-up for the cause of fibrosis, which included gathering an exposure, occupational, allergy, and previous infectious history, and a rheumatoid work-up were negative. The patient's posttransplantation course was complicated by bronchiolitis obliterans from chronic rejection and by recent pulmonary embolism, for which she was undergoing anticoagulation therapy at the time of presentation. Additionally, the patient experienced repeated pulmonary infections with Aspergillus, leading to multiple hospitalizations and long-term antifungal prophylaxis with voriconazole. A bone scan from an outside hospital was reviewed, and further imaging was performed. PMID:25710343

  15. 49 CFR 215.105 - Defective axle. (United States)


    ... plain bearing journal on the axle, or the fillet on the axle, has— (1) A ridge; (2) A depression; (3) A... conjunction with a plain bearing, has an end collar that is broken or cracked; (d) A journal on the car...

  16. 24 CFR 200.215 - Definitions. (United States)


    ... Officer. (See § 200.224) (e) Principal. (1) An individual, joint venture, partnership, corporation, trust... includes: (i) Any affiliates of a principal; (ii) if the principal is a partnership, all general partners, and each limited partner having a 25 percent or more interest in the partnership; (iii) if...

  17. 12 CFR 215.2 - Definitions. (United States)


    ... any corporation, partnership, trust (business or otherwise), association, joint venture, pool syndicate, sole proprietorship, unincorporated organization, or any other form of business entity not... that person or the funds or services of which will benefit that person. (o) Subsidiary has the...

  18. 20 CFR 627.215 - Relocation. (United States)


    ... skill training, on-the-job training, or company-specific assessments of job applicants or employees, for... original location. (c) For the purposes of this section, relocating establishment means a business entity... review should include names under which the establishment does business, including...

  19. 32 CFR 215.4 - Legal considerations. (United States)


    ... national entity under the Federal Constitution—to insure the preservation of public order and the carrying.... (a) Under the Constitution and laws of the United States, the protection of life and property and the... necessary authority to enforce the laws. The Federal Government may assume this responsibility and...

  20. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  1. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  2. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  3. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  4. Effect of LuF3 on Stability and Infrared Property of 20GaF3-15InF3-20CdF2-15ZnF2-20PbF2-10SnF2 Glass%Lu3+掺杂对20GaF3-15InF3-20CdF2-15ZnF2-20PbF2-10SnF2玻璃抗析晶能力和红外吸收边的影响

    Institute of Scientific and Technical Information of China (English)

    朱基千; 李志国; 贺芸芬; 唐高; 白朝颖



  5. 48 CFR 215.404-75 - Fee requirements for FFRDCs. (United States)


    ...) that relates to DoD contracted effort; (2) Facilities capital acquisition plans; (3) Working capital funding as assessed on operating cycle cash needs; and (4) Provision for funding unreimbursed costs...

  6. 49 CFR 25.215 - Membership practices of certain organizations. (United States)


    ... education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary...

  7. 31 CFR 28.215 - Membership practices of certain organizations. (United States)


    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  8. 32 CFR 196.215 - Membership practices of certain organizations. (United States)


    ... students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the...

  9. 45 CFR 2555.215 - Membership practices of certain organizations. (United States)


    ... students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the...

  10. 22 CFR 146.215 - Membership practices of certain organizations. (United States)


    ... education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary...

  11. 43 CFR 41.215 - Membership practices of certain organizations. (United States)


    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  12. 10 CFR 5.215 - Membership practices of certain organizations. (United States)


    ... consists primarily of students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl... practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary youth service organizations....

  13. 10 CFR 1042.215 - Membership practices of certain organizations. (United States)


    ..., YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary youth service...

  14. 28 CFR 54.215 - Membership practices of certain organizations. (United States)


    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  15. 22 CFR 229.215 - Membership practices of certain organizations. (United States)


    ... education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary...

  16. 15 CFR 8a.215 - Membership practices of certain organizations. (United States)


    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  17. 14 CFR 1253.215 - Membership practices of certain organizations. (United States)


    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  18. 6 CFR 17.215 - Membership practices of certain organizations. (United States)


    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  19. 29 CFR 36.215 - Membership practices of certain organizations. (United States)


    ... consists primarily of students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl... practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary youth service organizations....

  20. AB215. Penis transplant: a long way to success


    Li, Jinhong; Yuan, Jiuhong


    Objective Transplant seems to be an ideal and mature treatment for some late-stage diseases. The first penis transplant operation was performed in China about 9 years ago and recently, a piece of news reporting another successful penis transplant in South Africa had spread throughout the world. Overall, penis transplant was seldom reported. Methods PubMed, ISI Web of Science and Google Scholar databases (until January 2016) were searched for relevant publications on penis transplant. Results ...

  1. Dicty_cDB: VFB215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c, DNA sequence. 80 7e-11 1 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersico... 4e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit histolytica Sheared DNA Entamoeba histolytica genomic, DNA sequence. 80 1e-17 3 BI921109 |BI921109.1 EST541012 tomato callus Lyco...ideum calreticulin mRNA, complete cds. 1122 0.0 2 BD248385 |BD248385.1 Gene participating in tolerance again...n esculentum cDNA clone cLEM8G13, mRNA sequence. 74 4e-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lyco

  2. 48 CFR 52.215-14 - Integrity of Unit Prices. (United States)


    ...: acquisitions at or below the simplified acquisition threshold in FAR Part 2; construction or architect-engineer...; commercial items; and petroleum products. (End of clause) Alternate I (OCT 1997). As prescribed in...

  3. 48 CFR 1352.215-75 - Evaluation criteria. (United States)


    ... criteria. As prescribed in 48 CFR 1315.204-570(b)(2) and (3), insert the following provision: Evaluation... customer satisfaction. The Government reserves the right to assess the past performance of...

  4. AB215. Penis transplant: a long way to success (United States)

    Li, Jinhong; Yuan, Jiuhong


    Objective Transplant seems to be an ideal and mature treatment for some late-stage diseases. The first penis transplant operation was performed in China about 9 years ago and recently, a piece of news reporting another successful penis transplant in South Africa had spread throughout the world. Overall, penis transplant was seldom reported. Methods PubMed, ISI Web of Science and Google Scholar databases (until January 2016) were searched for relevant publications on penis transplant. Results Penile defects caused by various reasons and transsexual persons might be an ideal graft recipient for penis transplant. Graft donor might be confined to some volunteer organ donors or male-to-female transsexual persons. Although for patients with penis defects, penis replantation, penis reconstruction and penis lengthening were widely used, those treatments were often accompanied with shortcomings such as multiple operations, nerve/vascular damage and limited ischemic time. In penis transplant, except for anatomical technical skills, functional issues should also be addressed. Penis transplant required not only a successful urination but also a well erectile function. Experience of several penis replantation operations of amputated penis in our hospital showed that the anastomoses of blood vessels (deep/dorsal artery, superficial/deep dorsal vein) with microsurgical technique could ensure its survival. Meanwhile, well dorsal nerves repair could make the erectile function rehabilitation possible. Similarly, penis transplant also required above repair of blood vessels and nerves. Besides, penis transplant needed further care to avoid allograft rejection just like other transplants. However, at present, no guidelines could be referred for the application of immunosuppression drugs in penis transplants. Unlike kidney transplants, which require only anastomoses of vessels, penis transplants need skin and nerve repair. Thus, immunosuppressants should refer to some composite tissue transplants such as face/hand transplants. Penis transplant prompted much ethical discussion and also brought some psychological concerns for recipients and his partners. Ethical/Psychological issues were also a key point for successful transplant operations. Conclusions Penis transplant should be performed in collaboration with surgeons, anesthetists, nurses, psychologists and ethicists. Since some concerns about functional issues, immunosuppression-related problems and ethical/psychological concerns, the application of penis transplant was often limited. However, when all the problems are solved, penis transplant will be a new ideal option and I believe it will come in the near future.

  5. 4 CFR 21.5 - Protest issues not for consideration. (United States)


    ... time limits set forth in § 21.2. (f) Protests which lack a detailed statement of the legal and factual... business size standards and North American Industry Classification System (NAICS) standards. Challenges...

  6. 25 CFR 215.24 - Books and accounts. (United States)


    ... OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND... lead and zinc concentrates produced, and of all ore and concentrates sold and to whom sold, the weight, assay value, moisture content, base price, dates, penalties, and price received, and the percentage...

  7. 24 CFR 572.215 - Implementation grants-eligible activities. (United States)


    ... related to implementing the affirmative fair housing marketing strategy required under § 572.110. (k...) Homebuyer outreach and selection. Reasonable and necessary costs of marketing the program to...

  8. 50 CFR 600.215 - Council nomination and appointment procedures. (United States)


    ... fishing; (iii) Leadership in a state, regional, or national organization whose members participate in a..., journalism, writing, consulting, practicing law, or researching matters related to fisheries,...

  9. 12 CFR 215.3 - Extension of credit. (United States)


    ... bank for its own protection for: (i) Accrued interest; or (ii) Taxes, insurance, or other expenses... to the general public; (6) Indebtedness of $5,000 or less arising by reason of an interest-bearing...-interest-bearing deposits to the credit of a bank are not considered loans, advances, or extensions...

  10. 12 CFR 215.1 - Authority, purpose, and scope. (United States)


    ... executive officer, director, or principal shareholder of the member bank, of any company of which the member... of credit made to an executive officer, director, or principal shareholder of a bank (or to a related interest of such person) by a correspondent bank also are subject to restrictions set forth in 12...

  11. 46 CFR 10.215 - Medical and physical requirements. (United States)


    ... infarctions, psychiatric disorders, and convulsive disorders. (2) Food handlers are not required to submit to... complete annual medical exams and, unless exempt per 46 CFR 16.220, pass annual chemical tests for... conducted by a licensed medical doctor in accordance with the physical exam requirements in 46 CFR...

  12. 48 CFR 1352.215-76 - Cost or pricing data. (United States)


    ... pricing data. As prescribed in 48 CFR 1315.204-570(b)(4), insert the following provision: Cost or Pricing... Statement of Work. A brief definition of the education and experience requirements which qualify an employee....—should be discussed. (3) Overhead Costs. Generally, the offeror's accounting system and...

  13. Dicty_cDB: VSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftrr*lhclwf...GXTXNPXEIGGTSXEXQXKXXLVLQQNGNXERLSXFXPDXGPNKKN Frame B: ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftr

  14. 18 CFR 2.15 - Specified reasonable rate of return. (United States)


    ... calculated annually based on current capital ratios developed from an average of 13 monthly balances of... in the Commission's Uniform System of Accounts. The cost rate for such ratios shall be the weighted average cost of long-term debt and preferred stock for the year, and the cost of common equity shall...

  15. 48 CFR 215.404-71-5 - Cost efficiency factor. (United States)


    ...) Subcontractor cost reduction efforts; (7) The contractor's effective incorporation of commercial items and... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY...

  16. 48 CFR 1552.215-71 - Evaluation factors for award. (United States)


    ... combined are significantly more important than cost or price. (b) Evaluation factors and significant subfactors to determine quality of product or service: (End of provision) Evaluation Factors for Award (AUG... significantly less important than cost or price. (b) Evaluation factors and significant subfactors to...

  17. 20 CFR 725.215 - Determination of dependency; surviving spouse. (United States)


    ... miner's desertion or other reasonable cause; or (d) The individual is the natural parent of the miner's..., and as a direct result of the bodily injuries and independently of all other causes, dies not later.... In no event will the death of an individual resulting from violent and external causes be...

  18. 2 CFR 215.21 - Standards for financial management systems. (United States)


    ... codified at 31 CFR part 205, “Withdrawal of Cash from the Treasury for Advances under Federal Grant and... obtained from companies holding certificates of authority as acceptable sureties, as prescribed in 31 CFR... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Standards for financial management...

  19. 33 CFR 104.215 - Vessel Security Officer (VSO). (United States)


    ... have general knowledge, through training or equivalent job experience, in the following: (1) Those... reporting of accidents; (C) Proper usage of protective equipment and general knowledge of procedures for... regulations specified in 46 CFR Subchapter B; (iv) Successfully complete a Coast Guard-accepted VSO course;...

  20. 34 CFR 682.215 - Income-based repayment plan. (United States)


    ... poverty guideline for the borrower's family size; or (ii) For a married borrower who files a joint Federal... for the borrower's family size. (5) Poverty guideline refers to the income categorized by State and family size in the poverty guidelines published annually by the United States Department of Health...

  1. 48 CFR 215.304 - Evaluation factors and significant subfactors. (United States)


    ... university and minority institution performance of the contract, whether as a joint venture, teaming... U.S.C. 2436, consider the purchase of capital assets (including machine tools) manufactured in the... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY...

  2. 48 CFR 215.404-71-4 - Facilities capital employed. (United States)


    ... Forms CASB-CMF and cost of money factors (48 CFR 9904.414 and FAR 31.205-10); and (2) DD Form 1861... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION...D. Indicators are— (A) Allocations of capital apply predominantly to commercial item lines;...

  3. 48 CFR 252.215-7002 - Cost estimating system requirements. (United States)


    ... applied; (2) Produces verifiable, supportable, and documented cost estimates that are an acceptable basis... the cost estimating system to the ACO on a timely basis. (e) Estimating system deficiencies. (1) The... historical costs, and other analyses used to generate cost estimates. (b) General. The Contractor...

  4. 48 CFR 215.404-71-2 - Performance risk. (United States)


    ... incentive range when contract performance includes the introduction of new, significant technological innovation. Use the technology incentive range only for the most innovative contract efforts. Innovation may... reliability, or reduced costs; or (B) New products or systems that contain significant technological...

  5. Dicty_cDB: SSM215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .002 1 AU176207 |AU176207.1 Penaeus japonicus cDNA forward end of clone:PJV601. 54 0.002 1 BX323881 |BX32388...AU175995.1 Penaeus japonicus cDNA forward end of clone:PJV77. 54 0.002 1 dna update 2003. 8.12 Homology vs P

  6. 48 CFR 2152.215-70 - Contractor records retention. (United States)


    ... MANAGEMENT, FEDERAL EMPLOYEES GROUP LIFE INSURANCE FEDERAL ACQUISITION REGULATION CLAUSES AND FORMS... make available all records applicable to a contract term that support the annual financial report for...

  7. Dicty_cDB: CHI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vflyqmmqih*kqvqevqlfwkilf*e kr*lilimkefqkelfmqeeqelmviffliriivn*qkqis*vnkirkhqfsfvyqqfkd qedqliqfvtfmdll*nsil...f*e kr*lilimkefqkelfmqeeqelmviffliriivn*qkqis*vnkirkhqfsfvyqqfkd qedqliqfvtfmdll*nsil...CAAAAANA sequence update 2002.10.25 Translated Amino Acid sequence y*f*snkk*irn*nnlknskqmiriqfiqqqil...KTIAFGGSVSVIKELLRLPQDRGLLLGNGYKDITEQFFYSLAHHRVWERESKVSKI PAKX Frame B: y*f*snkk*irn*nnlknskqmiriqfiqqqilvflyqmmqih*kqvqevqlfwkil...asvfysrckfiprfctcskdgtte*nanw gevlmilfmisvd*nqrvliayyg*cqivvsqfh--- ---*yvst*keshhrri

  8. Dicty_cDB: VSA215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available osome IV cosmid 9934. 46 0.15 2 AI775835 |AI775835.1 EST256935 tomato resistant, Cornell Lycopersicon escule...21334 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB10G7 5', mRNA seq

  9. A study of the higher excitation levels of 11B via the 10B(n,n)10B and 10B(n,n')10B*(0.72, 1.74, 2.15, 3.59, 4.77 MeV) reactions

    International Nuclear Information System (INIS)

    As part of the study of the higher energy-level structure of 11B, cross sections for elastic and inelastic scattering of neutrons from isotopically enriched 10B samples have been measured for incident neutron energies from 3.03 MeV to 6.45 MeV in 250 keV increments and from 7.02 MeV to 12.01 MeV in 500 keV increments. Inelastic angular distributions for scattering to the states in parentheses in 10B have been measured from the indicated energy up to 12.01 MeV; (0.718) from 3.02 MeV; (1.74) from 3.27 MeV; (2.15) from 3.77 MeV; (3.59) from 5.52 MeV; (4.77) from 7.02 MeV. The measurements at 3.02, 3.51, 4.02, and 4.51 MeV were done at nine laboratory angles from 20/degree/ to 158/degree/ in 17.5/degree/ increments with a sample that is isotopically 95.86% 10B. All other distributions measured scattering at 11 laboratory angles from 18/degree/ to 158/degree/ in 15/degree/ increments from a sample that is isotopically 99.49% 10B. The data are corrected for air scattering, sample attenuation, minor isotope impurity, multiple scattering, and elastic and inelastic scattering from the sample of the neutron source continuum and contaminants. An eight-channel, multilevel R-matrix analysis was performed on the data. Level energies, spins, and parities were deduced for twelve levels above 13 MeV excitation in 11B. Only two definite and three tentative assignments for T = /1/2/ levels had been made previously above 13 MeV. The two definite levels were confirmed. Good agreement between the data and the R-matrix calculation in all analyzed channels was obtained for the proposed structure. 122 refs., 40 figs., 7 tabs

  10. 78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM... (United States)


    ... required periodic retest. In addition, we provided a table to clearly identify the retention requirements... incorporate a special permit with a longstanding history of safety into the HMR, and included a response to a...'' in the Hazardous Materials Table (HMT). SAAMI notes that there was no discussion of this change...

  11. Johannes Bellmann: John Dewey naturalistische Pädagogik. Argumentationskontexte, Traditionslinien. Paderborn u.a.: Schöningh 2007. 215 S., EUR 28,00. Fritz Bohnsack: John Dewey. Ein pädagogisches Portrait. Weinheim/Basel: Beltz 2005. 137 S., EUR 14,90. Martin Hartmann: Die Kreativität der Gewohnheit. Grundzüge einer pragmatistischen Demokratietheorie: Frankfurt a.M./New York: Campus 2003. 338 S., EUR 34,90. Klaus Prange (Hrsg.): Herbart und Dewey. Pädagogische Paradigmen im Vergleich. Jena: IKS Edition Paideia 2006. 165 S., EUR 19,80. Douglas J. Simpson: John Dewey. New York u.a.: Peter Lang Primer 2006. 159 S., EUR 16,80. Robert Wentz: Demokratie am Scheideweg. Die Aktualität der Sozialphilosophie John Deweys für eine kritische Gesellschaftstheorie. Berlin: wvb 2006. 228 S., EUR 27,00. [Sammelrezension


    Brumlik, Micha


    Sammelrezension zu: Johannes Bellmann: John Dewey naturalistische Pädagogik. Argumentationskontexte, Traditionslinien. Paderborn u.a.: Schöningh 2007. 215 S., EUR 28,00. Fritz Bohnsack: John Dewey. Ein pädagogisches Portrait. Weinheim/Basel: Beltz 2005. 137 S., EUR 14,90. Martin Hartmann: Die Kreativität der Gewohnheit. Grundzüge einer pragmatistischen Demokratietheorie: Frankfurt a.M./New York: Campus 2003. 338 S., EUR 34,90. Klaus Prange (Hrsg.): Herbart und Dewey. Pädagogische Paradigmen i...

  12. Study on laser atomic spectroscopy

    International Nuclear Information System (INIS)

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  13. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    International Nuclear Information System (INIS)

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  14. 47 CFR 73.215 - Contour protection for short-spaced assignments. (United States)


    ... station pursuant to 47 CFR 73.211(b)(3): 6 kW ERP/240 meters HAAT—Class A 25 kW ERP/150 meters HAAT—Class B1 50 kW ERP/472 meters HAAT—Class B (b) Applicants requesting short-spaced assignments pursuant to... achieved: (1) The ERP and antenna HAAT of the proposed station in the direction of the contours of...

  15. 48 CFR 52.215-1 - Instructions to Offerors-Competitive Acquisition. (United States)


    ... its proposal. In writing, writing, or written means any worded or numbered expression that can be read... installation, or oral testimony or statements of Government personnel. (iv) If an emergency or unanticipated... before award. Oral proposals in response to oral solicitations may be withdrawn orally. If...

  16. PS2-15: Coding for Obesity in a Health Plan Claims Database


    Shainline, Michael; Carter, Shelley; Von Worley, Ann; Gunter, Margaret


    Background and Aims: The Centers for Disease Control estimated the obesity rate in New Mexico for 2008 to be 25.2%. Sources estimate the following associations between obesity and type 2 diabetes (80%); cardiovascular disease (70%); hypertension (26 %). Yet obesity is infrequently coded as a secondary diagnosis among providers submitting claims. This study examines the frequency with which obesity is documented on claims forms, the relationship between age, gender, and obesity coding, and the...

  17. Towards the ictalurid catfish transcriptome: generation and analysis of 31,215 catfish ESTs


    Dunham Rex; Muir William; Liu Lei; Turan Cemal; Simmons Micah; Serapion Jerry; Somridhivej Benjaporn; Nandi Samiran; Kucuktas Huseyin; Xu Peng; Baoprasertkul Puttharat; He Chongbo; Feng Jinian; Wang Shaolin; Peatman Eric


    Abstract Background EST sequencing is one of the most efficient means for gene discovery and molecular marker development, and can be additionally utilized in both comparative genome analysis and evaluation of gene duplications. While much progress has been made in catfish genomics, large-scale EST resources have been lacking. The objectives of this project were to construct primary cDNA libraries, to conduct initial EST sequencing to generate catfish EST resources, and to obtain baseline inf...

  18. 48 CFR 52.215-15 - Pension adjustments and asset reversions. (United States)


    ... CAS, the amount measured, assigned, and allocated in accordance with 48 CFR 9904.413-50(c)(12), except the numerator of the fraction at 48 CFR 9904.413-50(c)(12)(vi) shall be the sum of the pension plan... regulations (48 CFR Chapter 99), the amount measured, assigned, and allocated in accordance with 48 CFR...

  19. 21 CFR 1404.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  20. 29 CFR 98.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the...

  1. 31 CFR 19.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et...

  2. 5 CFR 919.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  3. 2 CFR 180.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  4. 7 CFR 3017.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the...

  5. 41 CFR 105-68.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  6. 34 CFR 85.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security...: E.O. 12549 (3 CFR, 1986 Comp., p. 189); E.O 12689 (3 CFR, 1989 Comp., p. 235); 20 U.S.C. 1082,...

  7. 29 CFR 1471.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et...

  8. Basic Chemical Precipitation Softening. Training Module (United States)

    McMullen, L. D.

    This document is an instructional module package prepared in objective form for use by an instructor familiar with chemical precipitation softening. Included are objectives, an instructor guide, student handouts and transparency masters. This is the first level of a three module series and is designed for students with little or no operating…

  9. 22 CFR 1006.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... international organization; (3) An entity owned (in whole or in part) or controlled by a foreign government; or... or disaster. (e) A permit, license, certificate, or similar instrument issued as a means to...

  10. 22 CFR 1508.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... international organization; (3) An entity owned (in whole or in part) or controlled by a foreign government; or... emergency or disaster. (e) A permit, license, certificate, or similar instrument issued as a means...

  11. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions? (United States)


    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  12. 48 CFR 1552.215-72 - Instructions for the Preparation of Proposals. (United States)


    ... to reflect the Government's estimate of the offeror's probable costs. Any inconsistency, whether real... include the effective date of the base rates and the policy on salary reviews (e.g. anniversary date of employee or salary reviews for all employees on a specific date). (vi) State whether any additional...

  13. Self-biased 215 MHz magnetoelectric NEMS resonator for ultra-sensitive DC magnetic field detection. (United States)

    Nan, Tianxiang; Hui, Yu; Rinaldi, Matteo; Sun, Nian X


    High sensitivity magnetoelectric sensors with their electromechanical resonance frequencies DC magnetic fields. This magnetoelectric NEMS resonator showed a high quality factor of 735, and strong magnetoelectric coupling with a large voltage tunable sensitivity. The admittance of the magnetoelectric NEMS resonator was very sensitive to DC magnetic fields at its electromechanical resonance, which led to a new detection mechanism for ultra-sensitive self-biased RF NEMS magnetoelectric sensor with a low limit of detection of DC magnetic fields of ~300 picoTelsa. The magnetic/piezoelectric heterostructure based RF NEMS magnetoelectric sensor is compact, power efficient and readily integrated with CMOS technology, which represents a new class of ultra-sensitive magnetometers for DC and low frequency AC magnetic fields. PMID:23760520

  14. 40 CFR 92.215 - Maintenance of records; submittal of information; right of entry. (United States)


    ... procedures, and to verify correlation or calibration of test equipment; (ii) To inspect and make copies of..., copying, interpretation and translation services, the making available on request of personnel of...

  15. 14 CFR 1274.215 - Federal and federally funded construction projects. (United States)


    ... Administrator for Procurement may exempt a construction project from this policy if, as of February 17, 2001— (1... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Federal and federally funded construction... construction projects. (a) In accordance with E.O. 13202 of February 17, 2001, “Preservation of...

  16. 48 CFR 2052.215-79 - Contract award and evaluation of proposals. (United States)


    ... specified in paragraph * below. These factors are listed in their relative order of importance. (b) The... completeness, reasonableness, and as a measure of effective management of the effort. * To be incorporated into... risk to the Government. (i) If a cost realism analysis is performed, cost realism may be considered...

  17. TRANSX-2.15, Neutron Gamma Particle Transport Tables from MATXS Format Cross-Sections

    International Nuclear Information System (INIS)

    1 - Description of program or function: TRANSX is a computer code that reads nuclear data from a library in MATXS format and produces transport tables compatible with many discrete-ordinates (SN) and diffusion codes. Tables can be produced for neutron, photon, charged-particle, or coupled transport. Options include adjoint tables, mixtures, homogeneous or heterogeneous self-shielding, group collapse, homogenization, thermal up-scatter, prompt or steady-state fission, transport corrections, elastic removal corrections, and flexible response function edits. 2 - Method of solution: TRANSX reads through the materials in a MATXS library and accumulates the cross sections into a transport table using the user's mix instructions. At the same time, response function edit cross sections are accumulated using the user's edit instructions. They can thus be any linear combination of the cross sections available in the library. When the table is complete, it is written out in the desired format. Output options include DTF-style card images, FIDO, ISOTXS, and the binary group-ordered GOXS format. Self-shielding is handled using the background cross section method. Heterogeneity options include homogeneous mixtures, escape using mean chord, lattices of cylinders by the Bell or Sauer approximations, and reflected or periodic slab cell by the bell or E3 approximations. 3 - Restrictions on the complexity of the problem: Only narrow- resonance self-shielding is available in this version. This may affect accuracy for thermal problems

  18. 48 CFR 215.407-5-70 - Disclosure, maintenance, and review requirements. (United States)


    ..., apply the disclosure, maintenance, and review requirements to large business contractors meeting the..., maintenance, and review requirements to large business contractors under paragraph (b)(2)(ii) of this... systems, where appropriate; (xii) Requires management review including verification that the...

  19. Synthesis and NMR characterization of (15N)taurine [2-(15N)aminoethanesulfonic acid

    International Nuclear Information System (INIS)

    The title compound was prepared in three steps with 55% overall yield starting from potassium (15N)phthalimide. The synthetic route involved reaction with 1,2-dibromoethane, hydrolysis of the resulting N-(2-bromoethyl) (15N)phthalimide with HBr and treatment of the 2-bromoethyl(15N)amine thus formed with sodium sulphite. The product was characterized by 13C, 1H and 15N NMR spectroscopy. The absolute coupling constants of 15N with the 13C nuclei and the non-exchanging protons were determined and an unambiguous assignment of the proton signals obtained. (author)

  20. 24 CFR 598.215 - What are the purpose and content of the strategic plan? (United States)


    ... segments of the community, including the political and governmental leadership, community groups, local..., technical, human, cultural, educational, leadership, volunteerism, communications, transportation and..., Environmental Cleanup Cost Deduction (i.e., “Brownfields Tax Incentive”), and the Work Opportunity Tax...

  1. 40 CFR 94.215 - Maintenance of records; submittal of information; right of entry. (United States)


    ... family for which the manufacturer fails to retain the records required in this section or to provide such... material not translated into the English language need not be submitted unless specifically requested by... influence exhaust emissions will be representative of production engines and that either: all components...

  2. 29 CFR 215.3 - Employees represented by a labor organization. (United States)


    ... to a state administrative agency or designated recipient that will pass assistance through to subrecipients, the Department will refer and process each subrecipient's respective portion of the project in accordance with this section. If a state administrative agency or designated recipient has...

  3. 31 CFR 215.3 - Procedures for entering into a Withholding Agreement. (United States)


    ... Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE WITHHOLDING OF..., Federal Finance, Financial Management Service, Department of the Treasury, 401 14th Street, SW... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Procedures for entering into...

  4. 48 CFR 1552.215-73 - General financial and organizational information. (United States)


    ... Number: (d) Individual(s) to contact re. this proposal: (e) Cognizant Government: Audit Agency: Address...-reimbursement type prime contracts and subcontracts $____ Government fixed-price prime contracts and... prime contracts, subcontractors under Government prime contracts, and modifications (except when...

  5. 7 CFR 215.13a - Determining eligibility for free milk in child-care institutions. (United States)


    ... to prevent the overt identification of children receiving free milk. (4) A hearing procedure... at or below 185 percent of the Federal poverty level); or (iv) A third party contractor assisting in... 7 Agriculture 4 2010-01-01 2010-01-01 false Determining eligibility for free milk in...

  6. 48 CFR 2052.215-78 - Travel approvals and reimbursement-Alternate 1. (United States)


    ... expenditure for travel may not exceed ___ * ___ without the prior approval of the contracting officer. (b) All... institutional policy to the degree that the limitations of Office of Management and Budget (OMB) guidance are... Local Governments; OMB Circular A-122, Cost Principles for Nonprofit Organizations; and OMB Circular...

  7. 32 CFR 215.9 - Providing military resources to civil authorities. (United States)


    ... renewal of outstanding loans, may be denied at any level in the chain of command down to and including... the General Counsel of the DoD, the Assistant Secretary of Defense (Installations and Logistics), and... the handling of requests for DoD facilities, personnel, equipment, or supplies, received...

  8. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (215-0611-272217) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  9. SU-E-T-215: Interactive Dose Shaping: Proof of Concept Study for Six Prostate Patients

    International Nuclear Information System (INIS)

    Purpose: To provide a proof of concept study for IMRT treatment planning through interactive dose shaping (IDS) by utilising the respective tools to create IMRT treatment plans for six prostate patients. Methods: The IDS planning paradigm aims to perform interactive local dose adaptations of an IMRT plan without compromising already established valuable dose features in real-time. Various IDS tools are available in our in-house treatment planning software Dynaplan and were utilised to create IMRT treatment plans for six patients with an adeno-carcinoma of the prostate. The sequenced IDS treatment plans were compared to conventionally optimised clinically approved plans (9 beams, co-planar). The starting point consisted of open fields. The IDS tools were utilised to sculpt dose out of the rectum and bladder. For each patient, several IDS plans were created, with different trade-offs between organ sparing and target coverage. The reference dose distributions were imported into Dynaplan. For each patient, the IDS treatment plan with a similar or better trade-off between target coverage and OAR sparing was selected for plan evaluation, guided by a physician. Pencil beam dose calculation was performed on a grid with a voxel size of 1.95×1.95×2.0 mm3. D98%, D2%, mean dose and dose-volume indicators as specified by Quantec were calculated for plan evaluation. Results: It was possible to utilise the software prototype to generate treatment plans for prostate patient geometries in 15–45 minutes. Individual local dose adaptations could be performed in less than one second. The average differences compared to the reference plans were for the mean dose: 0.0 Gy (boost) and 1.2 Gy (CTV), for D98%: −1.1 Gy and for D2%: 1.1 Gy (both target volumes). The dose-volume quality indicators were well below the Quantec constraints. Conclusion: Real-time treatment planning utilising IDS is feasible and has the potential to be implemented clinically. Research at The Institute of Cancer Research is supported by Cancer Research UK under Programme C46/A10588

  10. XTACC3-XMAP215 association reveals an asymmetric interaction promoting microtubule elongation

    DEFF Research Database (Denmark)

    Mortuza, Gulnahar B.; Cavazza, Tommaso; Garcia-Mayoral, Maria Flor;


    chTOG is a conserved microtubule polymerase that catalyses the addition of tubulin dimers to promote microtubule growth. chTOG interacts with TACC3, a member of the transforming acidic coiled-coil (TACC) family. Here we analyse their association using the Xenopus homologues, XTACC3 (TACC3) and XM...

  11. 42 CFR 405.215 - Confidential commercial and trade secret information. (United States)


    ... 42 Public Health 2 2010-10-01 2010-10-01 false Confidential commercial and trade secret... trade secret information. To the extent that CMS relies on confidential commercial or trade secret... with Federal law....

  12. Generator method of 225Ac production without a carrier for nuclear medicine

    International Nuclear Information System (INIS)

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  13. 48 CFR 1452.215-71 - Use and Disclosure of Proposal Information-Department of the Interior. (United States)


    ...) “Trade Secret” means an unpatented, secret, commercially valuable plan, appliance, formula, or process... trade commodities. (2) “Confidential commercial or financial information” means any business information... Information Act, 5 U.S.C. 552. Exemptions from mandatory disclosure which may be applicable to...

  14. The Arizona Radio Observatory 1 mm Spectral Survey of IRC (plus)10216 and VY Canis Majoris (215-285 GHz) (United States)

    Tenenbaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.


    A low noise (1(sigma) rms approx. 3 mK) 1. nun spectral survey (214.5-285.5 GHz) of the oxygen-rich supergiant VY Canis Majoris and the carbon-rich asymptotic giant branch star IRC +10216 has been conducted using the Arizona Radio Observatory's 10 m Submillimeter Telescope. Here the complete data set is presented. This study, carried out with a new ALMA-type receiver, marks the first continuous band scan of an O-rich circumstellar envelope, and the most sensitive survey to date of IRC +10216. In VY CMa, 130 distinct molecular lines were detected, 14 of which cannot be identified; in IRC +10216, 717 lines were observed, with 126 features remaining unidentified. In the 1 mm bands of VY CMa and IRC +10216, emission is present from 18 and 32 different chemical compounds, respectively, with 10 species common to both sources. Many narrow emission lines were observed in both circumstellar shells, arising from vibrationally excited molecules and from refractory-containing species. Line profiles in VY CMa also exhibit a variety of different shapes, caused by the complex, asymmetric outflow of this object. The survey highlights the fact that C-rich and O-rich circumstellar envelopes are chemically interesting, and both are sources of new interstellar molecules. The high number of unidentified lines and the unreliable, rest frequencies for known species such as NaCN indicate the need for additional laboratory spectroscopy studies.

  15. 20 CFR 645.215 - What must a WtW operating entity that serves noncustodial parent participants do? (United States)


    ... and children who may be at risk of domestic violence, the operating entity must consult with domestic violence prevention and intervention organizations in the development of its WtW project serving... that good cause exists to extend this period. This extension may not extend to a date more than...

  16. “Remotion” Total Wrist Arthroplasty: Preliminary Results of a Prospective International Multicenter Study of 215 Cases

    DEFF Research Database (Denmark)

    Herzberg, Guillaume; Boeckstyns, Michel Ernest Henri; Sorensen, Allan Ibsen;


    This study reports the current results of an international multicenter study of one last generation total wrist arthroplasty (TWA) ("ReMotion," Small Bone Innovation, Morristown, PA). The two first authors (G.H. and M.B.) built a Web-based prospective database including clinical and radiological ...

  17. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon;


    there was a relative flow increase in the occipital lobes and a relative flow decrease in the bilateral cerebellum, thebilateral posterior parietal cortex, the right premotor cortex and the left thalamus. Hypnagogic experiences seemed not to be associated with any relative flow changes. The topography...... of the occipital activation during stage-1 sleep supports a hypothesis of this state being a state of imagery. The rCBF decreases in premotor cortex, thalamus and cerebellum could be indicative of a general decline in preparedness for goal directed action during stage-1 sleep. Stage-1 sleep seems...

  18. Oahu Hyperspectral Imagery 2000 (215-0611-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  19. SU-E-J-215: Onboard Split PET Including the Effects of Attenuation, Scatter, and Random Events

    International Nuclear Information System (INIS)

    Purpose: Positron emission tomography (PET) using split PET geometry was investigated as an on-board system for functional imaging and PET marker tracking, specifically with tomotherapy. The open dual ring PET would allow measurement of both inter and intra-fractional variation, improving the delineation of tumor volume at any stage in the radiation treatment delivery process. We present results from data obtained using Monte Carlo simulations including the effects of attenuation, random events, and scatter. Methods: PET design was accomplished via Monte Carlo simulations with GATE, the Geant4 Application for Emission Tomography. Images were reconstructed using Software for Image Reconstruction (STIR) with a fully 3D ordered subset expectation maximization (OSEM) image reconstruction technique. Results: Monte Carlo simulations of the split PET geometry indicate that including physical factors that degrade image quality such as attenuation, random events, and scatter still prove the feasibility of near real-time PET for both inter and intra-fractional radiation delivery. The image quality of scan times under 1 minute reveals that it is possible to utilize PET scanning and reconstruction during the treatment session intrafractionally. GATE also simulates the depth information but does not correct obliqueness of the path of line of response so the data is much more realistic than the data obtained with ray tracing. Conclusion: Onboard split PET with TomoTherapy can generate quality images under 1 minute scan times without the need to correct for attenuation, scatter, random events, or depth information of the interaction

  20. 8 CFR 215.8 - Requirements for biometric identifiers from aliens on departure from the United States. (United States)


    ... attendants, servants, or personal employees of accredited officials), G-1, G-2, G-3, G-4, NATO-1, NATO-2, NATO-3, NATO-4, NATO-5, or NATO-6 visas, and certain Taiwan officials who hold E-1 visas and members...

  1. Structure and torsional dynamics of the water octamer from THz laser spectroscopy near 215 μm. (United States)

    Cole, William T S; Farrell, James D; Wales, David J; Saykally, Richard J


    Clusters of eight water molecules play an important role in theoretical analysis of aqueous structure and dynamics but have proven to be challenging experimental targets. Here we report the high-resolution spectroscopic characterization of the water octamer. Terahertz (THz) vibration-rotation-tunneling (VRT) spectroscopy resolved 99 transitions with 1 part per million precision in a narrow range near 46.5 wave numbers, which were assigned to the h16 octamer via detailed isotope dilution experiments. Fitting to a semi-rigid symmetric top model supports predictions of two coexisting cuboidal structures and provides precise values for the changes in their rotational constants. Comparison with theory and previous spectroscopic data provides a characterization of the two structures and the observed torsional vibration and supports the prediction that the D2d symmetry structure is lower in energy than the S4 isomer. PMID:27257252

  2. 12 CFR 215.9 - Disclosure of credit from member banks to executive officers and principal shareholders. (United States)


    ... individual for the purposes of determining principal shareholder status. (2) Related interest means: (i) Any... definitions apply: (1) Principal shareholder of a member bank means any person other than an insured bank, or... includes a person that controls a principal shareholder (e.g., a person that controls a bank...

  3. 16 CFR 2.15 - Orders requiring witnesses to testify or provide other information and granting immunity. (United States)


    ... Bureaus of Competition and Economics, the Bureau Director, Deputy Directors and Associate Directors of the... essential to serve the interests of justice. Such appeals shall be made on the record and shall be in...

  4. 19 Urban Questions: Teaching in the City. Second Edition. Counterpoints: Studies in Postmodern Theory of Education, Vol. 215 (United States)

    Steinberg, Shirley R., Ed


    The second edition of "19 Urban Questions: Teaching in the City" adds new questions to those in the original volume. Continuing the developing conversation in urban education, the book is provocative in style and rich in detail. Emphasizing the complexity of urban education, Shirley R. Steinberg and the authors ask direct questions about what…

  5. Oahu Hyperspectral Imagery 2000 (215-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  6. U.S. comments on co-chairmen WG.2/15, chapter 7-A assurance of supply

    International Nuclear Information System (INIS)

    The U.S. delegation proposes revision in chapter 7 regarding assurance of supply, to reflect that alternative suppliers now exist to provide an assured supply, and that for most countries national enrichment facilities would not be practical or economic. The paper also argues that the spread of national facilities could increase proliferation risks. The revised text also argues that, because enrichment is highly capital-intensive, consumers should not expect significant surplus capacity at any given time, and should not interpret the absence of surplus capacity as an indication of lack of assurance in supply. Options which increase a consumer's flexibility in meeting enrichment needs are reviewed

  7. Use of gamma-ray spectrometry for analysis of Uranium isotopic composition in soil of Iran

    International Nuclear Information System (INIS)

    The use of depleted uranium (DU) in various weaponry and ammunition during the Iraq war in April, 2003 caused serious concern in Iran over possible uranium contamination of the Iran environment and consequently long health effect. After a shell explosion, uranium is discharged by the fire in the air in the form of oxidized particles and can be dispersed within a radius of several kilometers. Gamma-ray spectrometry was used to determine uranium concentration in soil samples collected from 8 sites in Iranian sectors of Iraq border. All soil samples were dried ,gently grounded and passed through a 2 mm sieve. Three hundred grams of each sample were placed in plastic container and sealed for at least 20 days to allow equilibrium in uranium, thorium and actinium series. Gamma-ray intensities were measured with 40% HPGe (CANBERRA) detector. The detector was shielded by 10 cm lead on all sides with cadmium-copper in inner sides. The system is equipped with software for data acquisition and analyzing. The counting time was 6x104 seconds and background spectra were also collected for the same period of time. The concentrations of 238U assessed from 63.3 keV and 92.4 keV emission of its first daughter nuclide, 234Th. To assess the isotopic ratio of 238U/235 U, secular equilibrium was ensured and the concentration of 235U under the 186 keV was deduced. The 226Ra was determined through the 295 keV and 352 keV gamma-rays of 214Pb. The concentrations of 238U and activity ratio of 238U/235U is given. The average of measurement activity ratio is 21,very close to the value of 21.5 for natural uranium, while the activity ratio of DU can be as high as 76.9. The 238U activity ranges within typically accepted levels from 14-33 Bq kg-1, while the typical range given by UNSCEAR (1988) for different soil samples is 10 to 50 Bq kg-1. The analysis of eight surface soil samples of Iranian sites of Iraq border, showed that uranium isotopes are in their natural abundances

  8. NOAA GeoTIFF - 9m Multibeam Bathymetry (Sun Illuminated - Azimuth 215 degrees), Puerto Rico (Tourmaline Bank) - Project NF-08-04, UTM 19N NAD83 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This georeferenced RGB image represents 9 meter resolution bathymetry of a selected portion of seafloor around Tourmaline Bank, Puerto Rico. This image is also...

  9. Differentiation of peptide molecular recognition by phospholipase C gamma-1 Src homology-2 domain and a mutant Tyr phosphatase PTP1bC215S.


    Maclean, D; Sefler, A. M.; Zhu, G.; Decker, S J; Saltiel, A R; J. Singh; McNamara, D.; Dobrusin, E M; Sawyer, T K


    Activated epidermal growth factor receptor (EGFR) undergoes autophosphorylation on several cytoplasmic tyrosine residues, which may then associate with the src homology-2 (SH2) domains of effector proteins such as phospholipase C gamma-1 (PLC gamma-1). Specific phosphotyrosine (pTyr)-modified EGFR fragment peptides can inhibit this intermolecular binding between activated EGFR and a tandem amino- and carboxy-terminal (N/C) SH2 protein construct derived from PLC gamma-1. In this study, we furt...

  10. Systemic Delivery of Small Interfering RNA Targeting the Interleukin-2/15 Receptor β Chain Prevents Disease Progression in Experimental Arthritis


    Tiantian Zhang; Xuehua Bai; Xiaohua Mao


    The role of interleukin (IL)-15 in the pathogenesis of rheumatoid arthritis (RA) is well established; however, systemic knockdown of IL-15 receptor (IL-15R) for reduction in inflammation at local sites has not been demonstrated. In this study, the therapeutic effect of intravenously administered siRNA targeting the β chain of IL-15R which is shared by the receptor for IL-2 was examined in rats with adjuvant-induced arthritis (AA). Polyethylenimine (PEI)-complexed siRNA nanoparticles could eas...

  11. The plant cytoskeleton: recent advances in the study of the plant microtubule-associated proteins MAP-65, MAP-190 and the Xenopus MAP215-like protein, MOR1. (United States)

    Hussey, Patrick J; Hawkins, Timothy J; Igarashi, Hisako; Kaloriti, Despina; Smertenko, Andrei


    The microtubule cytoskeleton is a dynamic filamentous structure involved in many key processes in plant cell morphogenesis including nuclear and cell division, deposition of cell wall, cell expansion, organelle movement and secretion. The principal microtubule protein is tubulin, which associates to form the wall of the tubule. In addition, various associated proteins bind microtubules either to anchor, cross-link or regulate the microtubule network within cells. Biochemical, molecular biological and genetic approaches are being successfully used to identify these microtubule-associated proteins (MAPs) in plants, and we describe recent progress on three of these proteins. PMID:12516862

  12. 77 FR 20408 - [FWS-R9-MB-2011-N215; 91400-5110-0000-7B; 91400-9410-0000-7B (United States)


    ... nongovernmental organizations that represent conservation organizations, sportsmen's and women's organizations... Partnerships to Increase Board. Capacity. 12-021........ Trailblazer Adventure U.S. Sportsman 40,000.00...


    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.


    SRNL received two sets of SHT samples (MCU-14-135-136 in February 2014 and MCU-14-214-216 in March 2014) for analysis. The samples were analyzed for composition. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar® L trimming at this time. However, the addition of TiDG (suppressor) to the blended solvent is recommended. Evidence of possible (slight) isomerization of the solvent, probably Isopar®L or TiDG degradation products, was observed.

  14. Immunohistochemical changes in the expression of HSP27 in exercised human vastus lateralis muscle”. Acta Physiologica (Oxf). 194(3): 215-22, 2008

    DEFF Research Database (Denmark)

    Folkesson, Mattias; Mackey, A L; Holm, Lars;


    27 protein in muscle fibres from five of nine subjects. The number of fibres with accumulation of HSP27 in RE ranged from 0% to 32% with a mean of 6.3% of the total number of fibres. CONCLUSION: We conclude that this rapid HSP27 protein relocation after RE is an important player in the cellular...... remodelling of human muscle fibres in response to exercise involving high-force contractions, but not in response to endurance exercises....

  15. Comparative Spectra of Oxygen-Rich Versus Carbon-Rich Circumstellar Shells: VY Canis Majoris and IRC(plus)10216 at 215-285 GHz (United States)

    Tenebaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.


    A sensitive (1sigma rms at 1 MHz resolution approx.3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC +10216 has been conducted to compare the chemistries of oxygen- and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope of the Arizona Radio Observatory with a new Atacama Large Millimeter Array type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules; and in IRC +10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO, and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO(+). Sulfur plays an important role in VY CMa, but saturated/ unsaturated carbon dominates the molecular content of IRC +102.16, producing CH2NH, for example. Although the molecular complexity of IRC +10216 is greater, VY CMa supports a unique "inorganic" chemistry leading to the oxides PO, AlO, and AlOH. Only diatomic and triatomic compounds were observed in VY CMa, while species with four or more atoms are common in IRC +10216, reflecting carbon's ability to form multiple strong bonds, unlike oxygen. In VY CMa, a new water maser (v2 = 2) has been found, as well as vibrationally excited NaCl. Toward IRC +10216, vibrationally excited CCH was detected for the first time.

  16. SU-E-J-215: Towards MR-Only Image Guided Identification of Calcifications and Brachytherapy Seeds: Application to Prostate and Breast LDR Implant Dosimetry

    International Nuclear Information System (INIS)

    Purpose: To identify and analyze the appearance of calcifications and brachytherapy seeds on magnitude and phase MRI images and to investigate whether they can be distinguished from each other on corrected phase images for application to prostate and breast low dose rate (LDR) implant dosimetry. Methods: An agar-based gel phantom containing two LDR brachytherapy seeds (Advantage Pd-103, IsoAid, 0.8mm diameter, 4.5mm length) and two spherical calcifications (large: 7mm diameter and small: 4mm diameter) was constructed and imaged on a 3T Philips MR scanner using a 16-channel head coil and a susceptibility weighted imaging (SWI) sequence (2mm slices, 320mm FOV, TR/ TE= 26.5/5.3ms, 15 degree flip angle). The phase images were unwrapped and corrected using a 32×32, 2D Hanning high pass filter to remove background phase noise. Appearance of the seeds and calcifications was assessed visually and quantitatively using Osirix ( Results: As expected, calcifications and brachytherapy seeds appeared dark (hypointense) relative to the surrounding gel on the magnitude MRI images. The diameter of each seed without the surrounding artifact was measured to be 0.1 cm on the magnitude image, while diameters of 0.79 and 0.37 cm were measured for the larger and smaller calcifications, respectively. On the corrected phase images, the brachytherapy seeds and the calcifications appeared bright (hyperintense). The diameter of the seeds was larger on the phase images (0.17 cm) likely due to the dipole effect. Conclusion: MRI has the best soft tissue contrast for accurate organ delineation leading to most accurate implant dosimetry. This work demonstrated that phase images can potentially be useful in identifying brachytherapy seeds and calcifications in the prostate and breast due to their bright appearance, which helps in their visualization and quantification for accurate dosimetry using MR-only. Future work includes optimizing phase filters to best identify and delineate seeds and calcifications

  17. 47 CFR 68.215 - Installation of other than “fully protected” system premises wiring that serves more than four... (United States)


    ... supervisor's full name, business address and business telephone number. (2) The name of the registrant(s) (or...) when placement and connection of the wiring will take place. (5) The business affiliation of the... instrument may be associated directly or indirectly with the line or loop to perform this test if one is...

  18. Extension of the Liège Intranuclear Cascade Model to the 2-15 GeV Incident Energy Range


    Pedoux, Sophie


    The Liège Intra-Nuclear Cascade model (INCL4) has been shown to be quite successful for the description of spallation reactions. However its validity domain is limited to an upper incident energy of ~2 GeV, because inelastic elementary processes are restricted to the excitation and de-excitation of the Delta resonance. In this thesis, the INCL4 model is extended to higher incident energy. This is realised by including other inelastic elementary collisions, direct multipion production in ele...

  19. Influence of channeling on scattering of 2-15 GeV/c protons, π+, and π- incident on Si and Ge crystals

    International Nuclear Information System (INIS)

    The channeling effect has a dramatic influence on scattering phenomena for GeV particles. Multiple scattering for positive particles is strongly reduced for incident directions close to the crystal axes and planes, resulting in a very high transmitivity along such directions, whereas negative particles experience increased multiple scattering along these directions. Correlated scattering from the atoms in atomic rows results in ring-shaped intensity distributions ('dough-nuts') on the exit side which exist even for incident angles far beyond the critical angle for channeling. For such angles, we find a strongly increased multiple scattering for both positive and negative particles. The yield from close-encounter processes such as wide-angle scattering and nuclear reactions is reduced to below 10% of normal yield for positive, channeled particles, whereas the yield is increased for negative particles. The measured dechanneling is found to be small even for a 4 mm thick Ge crystal. These results seem to agree fairly well with theoretical calculations based on a diffusion model. Computer calculations from a binary-collision model are in good agreement with experimental results. Also, blocking effects are measured and agree fairly well with the dips obtained for close-encounter processes. (orig.)

  20. Comparative Spectra of Oxygen-Rich vs. Carbon-Rich Circumstellar Shells: VY Canis Majoris and IRC+10216 at 215-285 GHz

    CERN Document Server

    Tenenbaum, E D; Milam, S N; Woolf, N J; Ziurys, L M


    A sensitive (1{\\sigma} rms at 1 MHz resolution ~3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC+10216 has been conducted to compare the chemistries of oxygen and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope (SMT) of the Arizona Radio Observatory (ARO) with a new ALMA-type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules, and in IRC+10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO2 and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO+. Sulfur plays an important role in VY CMa, but saturated/unsaturated carbon dominates the molecular content of IRC+10216, producing CH2NH, for example. Although the mol...

  1. Paramêtros cinéticos do pico termoluminescente em 215ºC do espodumênio lilás


    Oliveira, Raquel Aline Pessoa; Lima, Leonardo Lelis de; Lalic, Susana de Souza; Lima, Adilmo Francisco de


    O uso da termoluminescência (TL) na dosimetria da radiação ou da datação geológica requer o conhecimento das propriedades TL do material. Além dos cuidados necessários durante os experimentos, é de suma importância o conhecimento da forma da curva de emissão e da resposta em função da dose, conhecimento esse que pode ser apresentado na forma de modelo teórico capaz de prever resultados e também fornecer explicações no que tange a estrutura interna do material e tempo de vida do mesmo. E...

  2. Characterization of osteoclasts from patients harboring a G215R mutation in ClC-7 causing autosomal dominant osteopetrosis type II

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Schaller, Sophie;


    , the morphology, and the expression of markers, such as cathepsin K and tartrate-resistant acid phosphatase. When mature ADOII osteoclasts were investigated on mineralized bone, they degraded the bone material, however only to 10 to 20% of the level in controls. We show by acridine orange, that the...

  3. SU-E-J-215: Towards MR-Only Image Guided Identification of Calcifications and Brachytherapy Seeds: Application to Prostate and Breast LDR Implant Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Elzibak, A; Fatemi-Ardekani, A; Soliman, A; Mashouf, S; Safigholi, H; Ravi, A; Morton, G; Song, WY [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Han, D [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); University of California, San Diego, La Jolla, CA (United States)


    Purpose: To identify and analyze the appearance of calcifications and brachytherapy seeds on magnitude and phase MRI images and to investigate whether they can be distinguished from each other on corrected phase images for application to prostate and breast low dose rate (LDR) implant dosimetry. Methods: An agar-based gel phantom containing two LDR brachytherapy seeds (Advantage Pd-103, IsoAid, 0.8mm diameter, 4.5mm length) and two spherical calcifications (large: 7mm diameter and small: 4mm diameter) was constructed and imaged on a 3T Philips MR scanner using a 16-channel head coil and a susceptibility weighted imaging (SWI) sequence (2mm slices, 320mm FOV, TR/ TE= 26.5/5.3ms, 15 degree flip angle). The phase images were unwrapped and corrected using a 32×32, 2D Hanning high pass filter to remove background phase noise. Appearance of the seeds and calcifications was assessed visually and quantitatively using Osirix ( Results: As expected, calcifications and brachytherapy seeds appeared dark (hypointense) relative to the surrounding gel on the magnitude MRI images. The diameter of each seed without the surrounding artifact was measured to be 0.1 cm on the magnitude image, while diameters of 0.79 and 0.37 cm were measured for the larger and smaller calcifications, respectively. On the corrected phase images, the brachytherapy seeds and the calcifications appeared bright (hyperintense). The diameter of the seeds was larger on the phase images (0.17 cm) likely due to the dipole effect. Conclusion: MRI has the best soft tissue contrast for accurate organ delineation leading to most accurate implant dosimetry. This work demonstrated that phase images can potentially be useful in identifying brachytherapy seeds and calcifications in the prostate and breast due to their bright appearance, which helps in their visualization and quantification for accurate dosimetry using MR-only. Future work includes optimizing phase filters to best identify and delineate seeds and calcifications.

  4. 31 CFR 535.215 - Direction involving other properties in which Iran or an Iranian entity has an interest held by... (United States)


    ... based upon the International Emergency Economic Powers Act. (b) Any properties subject to a valid... possessors of the properties were required to pay such costs by contract or applicable law on January...

  5. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.


    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  6. Efeito da implantação de rodovias no cerrado brasileiro sobre a fauna de vertebrados - DOI: 10.4025/actascibiolsci.v28i3.215 Effect of the implantation of roads in the brazilian cerrado on the fauna of vertebrates - DOI: 10.4025/actascibiolsci.v28i3.215

    Directory of Open Access Journals (Sweden)

    Zara Faria Sobrinha Guimarães


    Full Text Available A fragmentação de hábitat causada pela ação humana vem sendo um dos grandes desafios para a biologia da conservação. A construção de estradas é um mecanismo de fragmentação de alto impacto, removendo a cobertura vegetal original, gerando efeito de borda e alterando a função e estrutura da paisagem, em contraste com a necessidade e o alto valor econômico imposto pela sociedade humana. Neste sentido, este estudo teve como objetivo avaliar o impacto da estrada na comunidade de fauna silvestre do Parque Altamiro de Moura Pacheco associada à presença da rodovia (BR-153/GO-060. Durante um ano de pesquisa, foram registrados 141 animais mortos por atropelamento. Os resultados do presente estudo, conduzido de Agosto/2003 a Julho/2004, foram comparados e analisados com estudo feito entre os anos de 1996 e 1997, tanto ao nível de carcaças encontradas quanto ao nível de ambiente. De acordo com os dados apresentados, reforça-se a necessidade de haver um melhor planejamento ao construir estradas, principalmente próximos a ambientes preservados ou unidades de conservação.The fragmentation of habitat caused by the action human being is comes one of the great challenges for the biology of the conservation. The construction of roads is a mechanism of the fragmentation of high impact, removing the original vegetablel covering, generating edge effect and modifying the function and structure of the landscape, in contrast with the necessity and the high economic value tax for the society human being. In this direction, this study it had as objective to evaluate the impact of the road in the community of wild fauna of the Park Altamiro de Moura Pacheco associated with the presence of the road (BR-153/GO-060. During one year of research, they had been registered 141 animals died for running over The results of the present study, lead of Agosto/2003 the Julho/2004, had been compared and analyzed with made study it enters the years of 1996 and 1997, as much the level of finded species how much the environment level. In accordance with the presented data, it is strengthened necessity to have one better planning when constructing roads, mainly next the preserved environments or units to conservation.

  7. Neutron Flux Depression in the UO{sub 2}-PuO{sub 2}(15 to 30%) Fuel Rods from IVO-FR2-Vg7-Irradiation Experiment; Depresion de flujo neutronico en las barras combustibles de UO2-PuO2(15 al 30%) del experimento de irradiacion IVO-FR2-Vg7

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, J.; Fernandez, J. L.


    The thermal-neutron flux depression within a fuel rod has a great influence in the radial temperature profile of the rod, especially for high enrichment fuel. For this reason, a study was made about the UO{sub 2}-PUO{sub 2} (15 to 30% PUO{sub 2}) fuel pins for the KfK-JEN joint irradiation program IVO, in the FR2 reactor. Different methods (diffusion, Bonalumi, successive generations) were compared and a new approach (parabolic approximation) was developed. (Author) 22 refs.

  8. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  9. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    International Nuclear Information System (INIS)

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  10. Sorption studies of radioelements on geological materials


    Berry, J. A; 油井 三和; 北村 暁


    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  11. Purification of cerium, neodymium and gadolinium for low background experiments


    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  12. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  13. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)



    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  14. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura


    IKEDA, Nagao


    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  15. History of the unraveling of the natural decay series

    International Nuclear Information System (INIS)

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  16. History of the unraveling of the natural decay series

    International Nuclear Information System (INIS)

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  17. System for recovery of daughter isotopes from a source material (United States)

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID


    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  18. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  19. Comment on "Stoll H. et al. (2015): Interpretation of orbital scale variability in mid-latitude speleothem δ18O: Significance of growth rate controlled kinetic fractionation effects. Quat. Sci. Rev. 127, 215-228" (United States)

    Dreybrodt, Wolfgang


    Stoll et al. (2015) have recently proposed that kinetic growth rate dependence of the oxygen isotope fractionation factor imprints an 18O isotope signal into the calcite precipitated to stalagmites. In their work growth rates of five stalagmites are related to negative offsets of δ18O from its equilibrium value. They report: "In the stalagmites contemplated here, growth rates of 4 - 80 μm year-1are equivalent to deposition rates of 3.4·10-9to 6.9·10-8 mol m-2 s-1assuming a density of calcite of 2.71 g/cm3."

  20. Report made on the behalf of the Commission of foreign affairs, defence and armed forces on the bill project authorizing the ratification of the international convention for the repression of acts of nuclear terrorism - Nr 215

    International Nuclear Information System (INIS)

    In a first part, this report recalls that the terrorist threat has already been addressed by texts which have been negotiated within the United Nations. It describes how the content of the convention has been elaborated while taking into account existing conventions related to nuclear issues. It outlines that this text is the fruit of the efforts made by a special committee created by the U N, and by the Lyons-Rome group within the G8. The second part comments how this convention is based on other conventions already ratified by France, notably the conventions of 1980 and 1997 on the physical protection of nuclear material. It outlines the important progress contained by this convention regarding incriminations of acts of nuclear terrorism and their crackdown

  1. From Soft Power to Economic Diplomacy? A Comparison of the Changing Rationales and Roles of the U. S. and Canadian Federal Governments in International Education. Research & Occasional Paper Series: CSHE.2.15 (United States)

    Trilokekar, Roopa Desai


    Through a historical and comparative analysis of international education policy development in Canada and the U.S., this paper will map the similarities and differences in the two countries. It will highlight the contributions and challenges of the government's involvement in international education (IE) in the two federal states and in…

  2. No evidence of a higher 10 year period prevalence of diabetes among 77,885 twins compared with 215,264 singletons from the Danish birth cohorts 1910-1989

    DEFF Research Database (Denmark)

    Petersen, Inge; Nielsen, Morten Frost; Beck-Nielsen, Henning; Christensen, Kaare


    AIMS/HYPOTHESIS: Previous Danish twin studies have found a highly increased risk of precursors of type 2 diabetes as well as a higher prevalence of type 2 diabetes among twins compared with singletons. Likewise, small-scale studies of Danish twins have shown that monozygotic twins have a higher r...

  3. Study of the Quasielastic {sup 3}He(e,e{prime}p) Reaction at Q{sup 2}=1.5 (GeV/c){sup 2} up to Missing Momenta of 1 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Marat Rvachev


    As a part of the E89044 experiment at Hall A of Jefferson Lab, we have studied the quasielastic {sup 3}He(e,e{prime}p) reaction in perpendicular coplanar kinematics, with energy and momentum transfer by the electron fixed at 837 MeV and 1500 MeV/c respectively, at three beam energies of 1255, 1954 and 4807 MeV. {sup 3}He(e,e{prime}p)D and {sup 3}He(e,e{prime}p)pn cross sections and distorted spectral functions were measured up to missing momenta of 1000 MeV/c, and, for the three-body breakup channel, up to missing energy of 30 MeV. The A{sub TL} asymmetry, R{sub T} and R{sub TL} response functions, and the combination R{sub L} + R{sub TT}V{sub TT}/V{sub L} of response functions were separated for the {sup 3}He(e,e{prime}p)D reaction channel up to missing momenta of 550 MeV/c. In the low missing momentum regime, measured {sup 3}He(e,e{prime}p)D cross sections agree with available calculations based on variational ground state wave functions, and disagree with calculations based on Faddeev-type ground state wave functions. For missing momenta from 100 to 740 MeV/c, strong final state interaction effects, in general consistent with Glauber-type and diagrammatic calculations, are observed. On a finer detail, meson exchange currents, isobaric currents and dynamical relativistic effects might be isolated with further theoretical work, in view of remaining disagreements between available calculations and the measurements. For missing momenta from 740 to 1000 MeV/c, measured {sup 3}He(e,e{prime}p)D cross sections are more than an order of magnitude greater than predicted by available theories. Further theoretical work is needed for understanding the nature of processes in this region.

  4. Nr 215 - Report made on the behalf of the Foreign affairs, defence and armed forces Commission on the bill project authorizing the approval of the International Convention for the Repression of Acts of Nuclear Terrorism

    International Nuclear Information System (INIS)

    This report first recalls that the suppression of terrorist threat has already been the object of several texts negotiated under the aegis of UNO, that the current convention has been elaborated by taking existing conventions related to nuclear into account, and that this convention is the result of efforts made by the special committee created by the UNO and the G8 'Lyon-Rome' group. In a second part, the author shows that this text is based on conventions already ratified by France. As shown in a table containing the convention articles and the associated obligations for states after ratification, this agreement contains important progresses in terms of incriminations of acts of nuclear terrorism and their suppression

  5. 5 CFR Appendix B to Part 581 - List of Agents Designated To Facilitate the Service of Legal Process on Federal Employees (United States)


    ..., VA Regional Office, 5000 Wissahickon Avenue, P.O. Box 13399, Philadelphia, PA 19101, (215) 951-5534... Liaison, VA Regional Office, 5000 Wissahickon Avenue, P.O. Box 13399, Philadelphia, PA 19101, (215)...


    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot


    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or


    International Nuclear Information System (INIS)

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  8. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State


    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  9. The identification of soil radionuclides in the area of Puspiptek and surrounding

    International Nuclear Information System (INIS)

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  10. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  11. Mixed valency of the RE and Ac ions in solid states

    International Nuclear Information System (INIS)

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  12. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    International Nuclear Information System (INIS)

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  13. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.


    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  14. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller


    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  15. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters (United States)

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration


    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  16. Purification of cerium, neodymium and gadolinium for low background experiments (United States)

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  17. « Communities in Place and Communities in Space. Globalization and Féminism in Iran », in : Parvin Alizadeh, ed., The Economy of Iran: Dilemmas of an Islamic State. London - New York, Tauris, 2002, pp. 215-224.


    Ladier-Fouladi, Marie


    Dans cet article, l’A. propose de montrer en premier lieu qu’en dépit de la politique discriminatoire de la République islamique, le statut de la femme s’est amélioré depuis 1979. En second lieu, il tente de déterminer les facteurs à l’origine de cette évolution. Pour l’A., la diffusion de l’école à une échelle géographique de plus en plus étendue et notamment l’accroissement du niveau d’instruction scolaire des femmes d’une part, et la globalisation, d’autre part, constituent les deux facteu...

  18. « Sexuality, Rights and Islam: Competing Gender Discourses in Postrevolutionary Iran », in : Lois Beck & Guity Nashat, dirs., Women in Iran. From 1800 to the Islamic Republic. Urbana & Chicago, University of Illinois Press, 2004, pp. 204-215.


    Kian-Thiébaut, Azadeh


    L’A. divise les discours religieux existants en Iran sur les femmes en traditionaliste, néo-traditionaliste et moderniste. Les questions de l’égalité entre les sexes et les droits des femmes sont absentes du premier discours centré sur la différence entre les sexes (représenté notamment par l’Ayatollah Meshkini, président de l’Assemblée des Experts). Le deuxième (fondé notamment sur les enseignements de l’Ayatollah Mottahari) est sensible aux débats sur le genre et aux critiques formulées par...

  19. 宁夏城市居民营养素摄入量与代谢综合征相关危险因素调查及分析%Relationship between dietary patterns and metabolic syndrome among urban populations in Ningxia, China . Journal of Zhejiang University (Agric . & Life Sci .), 2013,39(2):215-221

    Institute of Scientific and Technical Information of China (English)

    李宏宇; 张娜; 李琳; 陶秀娟; 杨建军; 张毓洪; 赵燚


    Summary It is well documented that the role of dietary composition in relation to the development of metabolic syndrome ( MS) remains inconclusive . Several studies on the relationship between MS and energy intake have suggested that the macronutrient composition of the diet ( proteins , fats , carbohydrates) may play an important contributing role to MS in adults . So , this study aims to investigate the possible relationship between MS and energy intake , percentage energy intake from macronutrients among urban populations in Ningxia , China . According to different economic levels from 2011 to 2012 , 2 465 subjects ( age:18‐75 years) were selected using stratified cluster random sampling in Yinchuan , Wuzhong , Zhongwei , Guyuan , and Shizuishan in Ningxia , China . Dietary intake was assessed using 24‐h food records and a validated food frequency questionnaire . Body mass , height , waist circumference , blood pressure , triglyceride ( TG ) , high‐density lipoprotein cholesterol ( HDL‐C ) , and blood glucose were measured . Logistic regression models were adjusted for age , smoking , drinking , and physical activity factors . The results showed that there were 647 MS cases in all subjects . According to the diagnosis criteria of MS , the incidence of MS was 26 .2% ( men:281 cases (25% ) ;women:366 cases ( 27 .3% ) ) , no significant difference in sex composition ( P>0 .05) . As a way of lifestyle , there was no significant difference in smoking , drinking , exercise between MS group and control group ( P>0 .05) ;significant difference was found in tertian dietary intake of protein and fat energy percentage between MS group and control group ( P0.05);MS组与对照组间吸烟、饮酒、锻炼等生活方式构成的差异无统计学意义( P>0.05);MS组与对照组间日膳食摄入蛋白质及脂肪能量百分比差异有统计学意义( P<0.05);MS组与对照组间的体质指数、腰围、收缩压、舒张压、空腹血糖、胆固醇、甘油三酯、高密度脂蛋白差异有统计学意义( P<0.05). Logistic多因素分析表明,蛋白质、脂肪及碳水化合物的能量占总摄入能量的百分比过多是城市居民代谢综合征的重要危险因素,其中高蛋白质组:相对危险程度比值比( odds ratio , OR)=1.417;高脂肪组:OR=1.647;高碳水化合物组:OR=1.810;因此,应采取膳食营养干预措施来有效预防MS .

  20. Dicty_cDB: Contig-U08414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gtcgttgnattatctaca 70 Query: 71 acttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaact 130 |||||||||||...||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 71 acttttctttcnccnactgtt...|||||||||||||||||| Sbjct: 275 aaattaggaagtgcacctttgataaatcaattctaaanncngtcgttgnattatctacaa 216 Query: 72 cttttctttcnccna...|||||||||||||| Sbjct: 215 cttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaactc 156 Query: 132 atacca

  1. Protein (Viridiplantae): 357448019 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  2. Protein (Viridiplantae): 356514232 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  3. Barbara Fuchs & Emily Weissbourd (eds., Representing Imperial Rivalry in the Early Modern Mediterranean (Toronto: Toronto University Press, 2015

    Directory of Open Access Journals (Sweden)

    Viviana Tagliaferri


    Full Text Available Book review of: Barbara Fuchs, Emily Weissbourd (eds., Representing Imperial Rivalry in the Early Modern Mediterranean, (Toronto: Toronto University Press, 215, pp. 296, ISBN 9781442619272.

  4. Kinetics of the methylglyoxal scavenging by antidiabetic biguanide drugs investigated using ion transfer voltammetry and capillary electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Langmaier, Jan; Samec, Zdeněk; Tůma, P.; Samcová, E.


    Roč. 61, č. 3 (2015), s. 215-215. ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR(CZ) GA15-03139S Institutional support: RVO:61388955 Keywords : electrochemistry * methylglyoxal * electrophoresis Subject RIV: CG - Electrochemistry

  5. Laparoscopic ventral rectopexy in an elderly population with external rectal prolapse

    DEFF Research Database (Denmark)

    Bjerke, Trine; Mynster, Tommie


    years (range 34-99), median prolapse size was 8 cm (range 2-15), and 30 % had previous prolapse surgery. The median operative time was 135 min (range 90-215), and the median length of stay was 2 days (range 1-14). The 30-day morbidity rate was 15 %, and there were two (4 %) deaths within 30 days. There...

  6. Drug: D07343 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07343 Drug Fencamfamin (INN) C15H21N 215.1674 215.3339 D07343.gif ATC code: N06BA06 Anatomical ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BA Centrally acting sympathomime ...

  7. Thermomechanical processing of 5083 aluminum to increase strength without increasing susceptibility to stress corrosion cracking

    Energy Technology Data Exchange (ETDEWEB)

    Edstrom, C. M.; Blakeslee, J. J.


    5083 aluminium with 25% cold work must be processed above 215/sup 0/C or below 70/sup 0/C to avoid forming continuous precipitate in the grain boundaries which makes the material susceptible to stress corrosion cracking. Time at temperature above 215/sup 0/C should be held to minimum (less than 30 min) to retain some strength from the 25% cold work.

  8. 49 CFR 212.217 - Car inspector. (United States)


    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  9. Drug: D06125 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06125 Drug Tiamenidine (USAN/INN); Symcor base TTS (TN) C8H10ClN3S 215.0284 215.7031 D06125.gif Antihyperte...nsive CAS: 31428-61-2 PubChem: 47207783 LigandBox: D06125 NIKKAJI: J20.515J ATOM 13

  10. EST Table: CK516660 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK516660 rswjb0_004566.y1 11/12/09 n.h 10/09/29 71 %/215 aa ref|XP_968436.2| PREDICTED: similar to best... %/176 aa gnl|Amel|GB16861-PA 10/09/10 71 %/215 aa gi|189235903|ref|XP_968436.2| PREDICTED: similar to bes

  11. Drug: D00901 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00901 Drug Rimantadine hydrochloride (USAN); Flumadine (TN) C12H21N. HCl 215.1441 215.7628 D009 ... TC code: J05AC02 Adamantane derivative Indication: Influenza ... A influenza ... A M2 proton channel blocker [VG:NC_004 ... P drug classification [BR:br08302] Antivirals Anti-influenza ... Agents Rimantadine D00901 Rimantadine hydrochlorid ...

  12. 76 FR 57796 - Petition for Waiver of Compliance (United States)


    ... requirements of 49 CFR part 232, Brake System Safety Standards for Freight and Other Non-Passenger Trains and Equipment; End-of-Train Devices and 49 CFR part 215, Railroad Freight Car Safety Standards. Presently, BRG's... provisions of the Federal railroad safety regulations contained at 49 CFR parts 232 and 215. FRA assigned...

  13. Drug: D06573 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06573 Drug Carisbamate (USAN) C9H10ClNO3 215.0349 215.6336 D06573.gif Novel neuromodulator for ... the treatment of epilepsy ... and other CNS disorders ATC code: N03AX19 Anatomic ...

  14. Drug: D08624 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08624 Drug Tramazoline (INN); Muconasal (TN) C13H17N3 215.1422 215.2942 D08624.gif...970(146+147+148) Salivary secretion Anatomical Therapeutic Chemical (ATC) classification [BR:br08303] R RESPIRATORY SYSTEM R01 NASA...L PREPARATIONS R01A DECONGESTANTS AND OTHER NASAL PREPARATIONS FOR TOPICAL USE R01AA

  15. Purification system of gram-amount neptunium using anion exchange chromatography

    International Nuclear Information System (INIS)

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  16. A francium-223 reservoir source

    International Nuclear Information System (INIS)

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  17. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  18. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    International Nuclear Information System (INIS)

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  19. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  20. Theoretical Study on Properties of New Isotope 265Bh

    Institute of Scientific and Technical Information of China (English)


    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  1. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  2. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)



    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  3. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    International Nuclear Information System (INIS)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  4. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    International Nuclear Information System (INIS)

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)

  5. Where to Go Next?

    Czech Academy of Sciences Publication Activity Database

    Kindlmann, Pavel

    1st ed. Dodrecht : Springer, 2012 - (Kindlmann, P.), s. 215-216 ISBN 978-94-007-1801-2. - (Biomedical and Life Sciences) Institutional research plan: CEZ:AV0Z60870520 Keywords : conservation * Himalayan Subject RIV: EH - Ecology, Behaviour

  6. 50 CFR Table 2d to Part 679 - Species Codes-Non-FMP Species (United States)


    ... 220 Pacific tomcod 250 Poacher (Family Agonidae) 219 Prowfish 215 Ratfish 714 Rockfish, black (GOA) 142 Rockfish, blue (GOA) 167 Rockfish, dark 173 Sardine, Pacific (pilchard) 170 Sea cucumber, red...

  7. Anogenital distance and reproductive parameters in young men

    DEFF Research Database (Denmark)

    Parra, M D; Mendiola, J; Jørgensen, N;


    cephalad insertion of the penis (AGDAP )] were assessed in 215 university students. Semen parameters (semen volume, sperm concentration, total sperm counts, motility and morphology) and serum reproductive hormones (follicle stimulating hormone, luteinising hormone, inhibin B, testosterone, calculated free...

  8. Space debris mitigation and prevention: how to bilt a stronger international regime

    Czech Academy of Sciences Publication Activity Database

    Perek, Luboš


    Roč. 2, č. 2 (2004), s. 215-226. ISSN 1477-7622 Institutional research plan: CEZ:AV0Z1003909 Keywords : space debris * registration * paper satellites Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  9. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  10. Poznámka o náhrobku císaře Friedricha III. a reflexe sepulchrálního sochařství v českých cestopisech 1450 - 1550

    Czech Academy of Sciences Publication Activity Database

    Chlíbec, Jan

    Praha : Arte factum, 2002 - (Prix, D.), s. 207-215 ISBN 80-903230-1-4 Institutional research plan: CEZ:AV0Z8033913 Keywords : Gerhaert van Leyden * Friedrich III Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. Fully nonlinear model of a hydraulic circuit

    Czech Academy of Sciences Publication Activity Database

    Straškraba, Ivan


    Roč. 59, č. 3 (2014), s. 215-220. ISSN 0001-7043 Institutional support: RVO:67985840 Keywords : compressible fluid * Navier-Stokes equations * hydraulic systems Subject RIV: BA - General Mathematics

  12. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  13. Distribution patterns and environmental correlates of Thaumarchaeota abundance in six deep subalpine lakes.

    Czech Academy of Sciences Publication Activity Database

    Callieri, C.; Hernandez-Aviles, S.; Salcher, Michaela M.; Fontaneto, D.; Bertoni, R.


    Roč. 78, č. 2 (2016), s. 215-225. ISSN 1015-1621 Institutional support: RVO:60077344 Keywords : subalpine lakes * Thaumarchaeota vertical profile * CARD FISH * hypolimnion Subject RIV: EE - Microbiology, Virology Impact factor: 2.706, year: 2014

  14. Perissodactyla

    Czech Academy of Sciences Publication Activity Database

    Červený, Jaroslav

    Farmington Hills : Gale, 2003 - (Kleiman, D.; Geist, V.; Hutchins, M.; McDade, M.), s. 215-224 ISBN 0-7876-6573-8 Institutional research plan: CEZ:AV0Z6093917 Keywords : Perissodactyla Subject RIV: EG - Zoology

  15. Institute of Chemical Process Fundamentals of the ASCR: Expectation

    Czech Academy of Sciences Publication Activity Database

    Punčochář, Miroslav


    Roč. 62, 5-6 (2013), s. 214-215. ISSN 0022-9830 Institutional support: RVO:67985858 Keywords : laboratory investigation * large-scale applications * novel instrumentation and technology . Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  16. Jak fyzika zvyšuje užitnou hodnotu polymerních materiálů

    Czech Academy of Sciences Publication Activity Database

    Raab, Miroslav; Kotek, Jiří


    Roč. 57, č. 4 (2007), s. 215-220. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z40500505 Keywords : commodity plastics * polymeric materials * polymer physics Subject RIV: CD - Macromolecular Chemistry

  17. A new graptolite species of .i.Cyrtograptus./i. from the uppermost Llandovery of Ziyang, Shaanxi Province, China

    Czech Academy of Sciences Publication Activity Database

    Wang, J.; Štorch, Petr; Wang, X.; Zhang, J.


    Roč. 24, 1/2 (2015), s. 215-220. ISSN 1871-174X Institutional support: RVO:67985831 Keywords : Silurian * Llandovery * Cyrtograptus fui n. sp. * Ziyang * Graptolites Subject RIV: DB - Geology ; Mineralogy

  18. Popis, vjem, zdůvodnění a identifikace

    Czech Academy of Sciences Publication Activity Database

    Koťátko, Petr

    Bratislava : Infopress, 2010 - (Zouhar, M.), s. 204-215 ISBN 978-80-85402-99-5 Institutional research plan: CEZ:AV0Z90090514 Keywords : description * identification * perception Subject RIV: AA - Philosophy ; Religion

  19. Epidemiological Investigation of Lifestyle Associated Modifiable Risk Factors among Medical Students

    Directory of Open Access Journals (Sweden)

    Anurag Srivastava


    Conclusion: The study shows a high prevalence of NCD related risk factors in medical students. Primary prevention may be one way to lower the risk burden of NCDs. [Natl J Med Res 2013; 3(3.000: 210-215

  20. 75 FR 52957 - Supplemental Funding Under the Food and Drug Administration's Food Emergency Response Laboratory... (United States)


    ... HUMAN SERVICES Food and Drug Administration Supplemental Funding Under the Food and Drug Administration's Food Emergency Response Laboratory Network Microbiological Cooperative Agreement Program (U18) PAR-09-215; Request for Supplemental Applications AGENCY: Food and Drug Administration, HHS....

  1. 78 FR 22225 - Meeting: African Development Foundation, Board of Directors Executive Session Meeting (United States)


    ...; ] AFRICAN DEVELOPMENT FOUNDATION Board of Directors Executive Session Meeting Meeting: African Development Foundation, Board of Directors Executive Session Meeting Time: Tuesday, April 23, 2013 11:15 a.m. to 2:15...

  2. A Possible Scenario of Energy Transport in the 17th May 2002 Flare

    Czech Academy of Sciences Publication Activity Database

    Kotrč, Pavel; Kashapova, L. K.; Frolova, A.S.; Kupryjakov, Ju. A.


    Roč. 33, č. 1 (2009), s. 207-215. ISSN 1845-8319 Institutional research plan: CEZ:AV0Z10030501 Keywords : solar flare * accelerated particles * chromosphere and corona Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  3. 78 FR 11881 - Notice of Receipt of Requests To Voluntarily Cancel Certain Pesticide Registrations (United States)


    .... 64014 Florida Silvics, Inc., d/b/a Tree Tech Microinjection Systems, 950 S.E. 215th Ave., Morriston, FL... Environmental protection, Pesticides and pests. Dated: February 12, 2013. Richard P. Keigwin, Jr.,...

  4. USA terrorismivastane seadus ja jälitustegevuse erivolitused / Piibe Jõgi

    Index Scriptorium Estoniae

    Jõgi, Piibe, 1969-


    24. okt. 2001 Ameerika Ühendriikides vastu võetud terrorismivastase seaduse (nn USA Patriot Act) paragrahvist 215, mis käsitleb andmete salajast kogumist ja paragrahvist 213 salajaste läbiotsimisite kohta

  5. Go-go, 40 miljonit krooni! / Kadri Paas, Laura Birkin

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-


    Majandus- ja kommunikatsiooniminister Juhan Parts tegi valitsusele ettepaneku anda maabussiliinide toetuseks veel 20 miljonit ja Edelaraudteele 21,5 miljonit krooni, Eesti Reformierakond ootab ministri selgitusi. Vt. samas: GoBus: mei ei saa bussisõidule peale maksta

  6. Nearshore marine fish assemblages in southern California (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish benthic trawls were completed by the Southern California Coastal Water Research Project (SCCWRP). Data from 425 fisheries independent trawls ranging from 2-215...

  7. Historické nahrávky autentických forem chodské lidové hudby

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    Plzeň : Západočeská univerzita v Plzni, 2013, s. 215-224. ISBN 978-80-261-0328-8 Institutional support: RVO:68378076 Keywords : Chodsko * ethnomusicology * historical recordings Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. 78 FR 45592 - Reporting and Recordkeeping Requirements Under OMB Review (United States)


    ...: Small Business Lending Companies. Responses: 215. Annual Burden: 107.50. Curtis Rich, Management Analyst... From the Federal Register Online via the Government Publishing Office SMALL BUSINESS ADMINISTRATION Reporting and Recordkeeping Requirements Under OMB Review AGENCY: Small Business...

  9. Research and Explication of the Quantitative Characteristic of Legislation, Using the Example of the Legislation of the CR

    Czech Academy of Sciences Publication Activity Database

    Novák, František

    151/2, 9/3 TLQ (2012), s. 206-215. ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : quantitative description of legislation * analyses of legislation of the Czech Republic * possibilities and methodology Subject RIV: AG - Legal Sciences

  10. Drug: D09967 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ide bridge: 23-89; 135-195; H230-L215, Dimer) Peptide Uveitis, rheumatoid arthritis, psoriasis ATC code: L04...teraction hsa05323(3605) Rheumatoid arthritis map07050 Antirheumatics - DMARDs and biological agents Anatomi

  11. Sociální inteligence, sociální kompetence

    Czech Academy of Sciences Publication Activity Database

    Baumgartner, František; Orosová, O.; Výrost, J.

    Praha : Grada Publishing, 2008, s. 199-215 ISBN 978-80-247-1428-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : social intelligence * social competence * emotional intelligence Subject RIV: AN - Psychology

  12. 75 FR 25238 - Environmental Impacts Statements; Notice of Availability (United States)


    ..., Brunswick, ME, Comment Period Ends: 06/28/2010, Contact: Thomas H. Stephan, 215-897-4916. EIS No. 20100163.... EIS No. 20100164, Draft EIS, BLM, 00, Southern California Edison's Eldorado-Ivanpah Transmission...

  13. Financial conditions and investment during the transition: evidence from Czech firms

    Czech Academy of Sciences Publication Activity Database

    Lízal, Lubomír; Švejnar, Jan

    Cambridge : MIT Press, 2002 - (Meyendorff, A.; Thakor, A.), s. 215-260 ISBN 0-262-13391-1 Institutional research plan: CEZ:AV0Z7085904 Keywords : Czech Republic * transition * investment Subject RIV: AH - Economics

  14. 48 CFR 825.1001 - Waiver of right to examination of records. (United States)


    ..., Contract Terms and Conditions Required to Implement Statutes or Executive Orders—Commercial Items. (2) Alternate III of the FAR clause at 52.215-2, Audit and Records—Negotiation. (b) The contracting officer...

  15. IDaphnia galeata/I life history response to heterogeneous food conditions and dissolved chemicals in the Římov Reservoir

    Czech Academy of Sciences Publication Activity Database

    Macháček, Jiří

    č. 442 (2001), s. 215-222. ISSN 0018-8158 R&D Projects: GA AV ČR IAA6017802 Keywords : Daphnia * life history * food resources Subject RIV: DA - Hydrology ; Limnology Impact factor: 0.659, year: 2001

  16. 48 CFR 1315.204-570 - Part IV representations and instructions. (United States)


    ... officer shall insert the provision similar to 1352.215-74, Best Value Evaluation, for competitive, best..., Cost or Pricing Data, in all solicitations when cost or pricing data is required under FAR subpart 15.4....

  17. 75 FR 69397 - Minnkota Power Cooperative, Inc.: Notice of Availability of an Environmental Assessment (United States)


    ... Independence Ave., SW., Room 2244-S, Stop 1571, Washington, DC 20250-1571, fax: (202) 690-0649, or e-mail... Auditor......... 115 West Main, 701-794-8777 Hensler, ND 58530. Sheridan County Auditor....... 215...

  18. AcEST: BP917458 [AcEST

    Lifescience Database Archive (English)


  19. AcEST: BP920703 [AcEST

    Lifescience Database Archive (English)


  20. Evaluation scheme for Blatta orientalis and Blattella germanica in food units with HACCP implementation




    Blattella germanica and Blatta orientalis are the most common insects found in food industry, houses, offices, hotels, schools, etc. The aim of this study is the evaluation of gel baits efficiency (2.15% imidacloprid) against Blatta orientalis and Blattella germanica in albanian food units. The study was carried out in Tirana from June 2012 to June 2013 in 14 infested supermarkets, 13 of which were treated with 2.15% imidacloprid while 1 served as control unit. Monitor traps and visual inspec...

  1. Monitoring of onboard aircraft exposure level in the Czech republic; Overview of results acquired since 2001

    Czech Academy of Sciences Publication Activity Database

    Spurný, František; Ploc, Ondřej; Jadrníčková, Iva

    Busan: AOGS, 2008. s. 215-215. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] R&D Projects: GA ČR(CZ) GD202/05/H031 Institutional research plan: CEZ:AV0Z10480505 Keywords : aircraft exposure * monitoring * radiation dosimetry Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  2. Transformation of Actinomyces spp. by a gram-negative broad-host-range plasmid.


    Yeung, M K; Kozelsky, C S


    The gram-negative broad-host-range vector pJRD215 was transferred by electroporation into strains of Actinomyces viscosus or Actinomyces naeslundii at efficiencies which ranged from 10(2) to 10(7) transformants per microgram of plasmid DNA. The Actinomyces transformants expressed pJRD215-encoded resistance to kanamycin and streptomycin. Moreover, the transforming plasmid DNA had not undergone any deletions or rearrangements, nor had it integrated into the genomes of these strains.

  3. Exploratory experimental investigation of a wave propeller


    Dane, Carl W.


    Approved for public release; distribution is unlimited A low-speed wind tunnel investigation was conducted to determine if a small secondary airfoil or wave propeller, oscillating in a rotary plunging motion, could significantly affect the airflow over a lifting airfoil surface to delay the onset of stall. The lifting airfoil shape was a NACA 66(215)-216, chosen for its chordwise pressure port instrumentation. Testing consisted of measuring the pressure distribution of the NACA 66(215)-2...

  4. Comparison of the Space Radiation Environments at Foton M3 Satellite Altitudes and on Aircraft Altitudes for Minimum of Solar Activity in 2007

    Czech Academy of Sciences Publication Activity Database

    Dachev, T. P.; Spurný, František; Ploc, Ondřej; Tomov, B.; Dimitrov, P.; Matviichuk, Y.; Bankov, N.

    Busan: AOGS, 2008. s. 215-215. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] Grant ostatní: ESA(XE) ILSRA - 2004 - 248 Institutional research plan: CEZ:AV0Z10480505 Keywords : aircraft exposure * monitoring * radiation dosimetry * space radiation * space dosimetry * measurements Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  5. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for


    International Nuclear Information System (INIS)

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and


    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.


    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and


    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  9. Formerly utilized MED/AEC sites remedial action program. Radiological survey of the E. I. Du Pont de Nemours and Co. , Deepwater, New Jersey. Final report

    Energy Technology Data Exchange (ETDEWEB)



    The results of a radiological survey of the E. I. Du Pont Company, Deepwater, New Jersey, are presented in this report. During the 1940's this site was used for development of a process for the conversion of uranium oxide to produce uranium tetrafluoride and small quantities of uranium metal. The survey included measurements of the following: residual alpha and beta--gamma contamination levels, both fixed and transferable, in the one remaining uranium tetrafluoride operations building; external gamma radiation levels at 1 m above the surface inside this building and at outdoor locations where radioactive materials were handled; radon and radon daughter concentrations in the air in the operations building; uranium, radium, actinium, and thorium concentrations in soil and water on and near the site; and the airborne concentrations of uranium, thorium, and radium in the operations building. Elevated concentrations of uranium were found in residues from the operations building and in some surface and subsurface soil samples. Alpha and beta--gamma contamination levels in some areas of the operations building were above the limits of current federal guidelines set for the release of property for unrestricted use. 18 figures, 11 tables.

  10. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    International Nuclear Information System (INIS)

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  11. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO{sub 2} and TBP Complex

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)


    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO{sub 3} Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO{sub 3} Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO{sub 3} Complex.

  12. Tumor immunotargeting using innovative radionuclides. (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques


    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  13. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré


    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  14. Purification of lanthanides for double beta decay experiments (United States)

    Polischuk, O. G.; Barabash, A. S.; Belli, P.; Bernabei, R.; Boiko, R. S.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Tretyak, V. I.


    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain 238U, 226Ra and 232,228Th typically on the level of ˜ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO2, Nd2O3 and Gd2O3. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R&D of the methods to remove the pollutions with improved efficiency is in progress.

  15. Radionuclides in coastal swampland soils in South Australia - An unusual distribution?

    International Nuclear Information System (INIS)

    A plant processing uranium ore was constructed during the 1950's on coastal swamplands at Port Pirie, South Australia, with tailings and chemical residues stored in clay-lined dams on site. Environmental soil samples collected recently from this area showed an unusual radionuclide distribution which suggested possible contamination from the former uranium plant nearby. On subsequent investigation it appears this distribution is a general property of swampland soils. The concentration of uranium in these soils is significantly greater (2-10 times) than that of its decay products, with an observed range of uranium concentrations from 50 to 300 Bq/kg. In contrast, 'normal' soils in South Australia contain between 5 and 60 Bq/kg, with decay products close to secular equilibrium. In addition, actinium (and its parent, protactinium) occur in sediments in greater concentration than expected - 6 to 36 Bq/kg compared with a 'normal soil' range of 0.2 to 3 Bq/kg. Results obtained suggest: organic residues in the sediments play a major part in the concentration of radionuclides; and the probable source of radionuclides is sea-water. These observations are consistent with results of other workers who examined the incorporation of stable trace metals into coastal swampland sediments in South Australia. Representative data are presented and discussed

  16. Study of Thorium Utilization in a Large Scale Sodium Cooled Fast Reactor

    International Nuclear Information System (INIS)

    The breeding performance of 232Th in fast reactor is better than 238U, since the capture cross section of 232Th is slightly higher than 238U under the fast neutron spectrum. There are much less fission neutrons in the blanket, so the proportion of neutron with energy above 6MeV (the threshold energy of (n,2n) reaction of 232Th) is very small. Therefore, the 233U produced in fast reactor blanket would have high purity. In this paper, an large scale fast reactor core was taken as the reference core for 232Th utilization study. In the calculation results, the whole capability of 233U production is about 443kg/(GWe•a) in the blanket; at the end of the first cycle (160EFPD), the 233U production per unit mass of 232Th is about 10.71g/(kgTh), and the weight fraction of 232U in actinium is less than 0.019%. It is an attractive technology option to produce 233U in the blanket. (author)

  17. A Critical Review of Alpha Radionuclide Therapy-How to Deal with Recoiling Daughters? (United States)

    de Kruijff, Robin M; Wolterbeek, Hubert T; Denkova, Antonia G


    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  18. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters? (United States)

    de Kruijff, Robin M.; Wolterbeek, Hubert T.; Denkova, Antonia G.


    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  19. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    Directory of Open Access Journals (Sweden)

    Robin M. de Kruijff


    Full Text Available This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET. Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium, 223Ra, and 225Ac (actinium can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue.

  20. Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

    International Nuclear Information System (INIS)

    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y-1. From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g-1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y-1 ranging from 2.79 to 14.17 mSv y-1. (authors)