WorldWideScience

Sample records for actinium 215

  1. Actinium radioisotope products of enhanced purity

    Science.gov (United States)

    Meikrantz, David Herbert; Todd, Terry Allen; Tranter, Troy Joseph; Horwitz, E. Philip

    2010-06-15

    A product includes actinium-225 (.sup.225Ac) and less than about 1 microgram (.mu.g) of iron (Fe) per millicurie (mCi) of actinium-225. The product may have a radioisotopic purity of greater than about 99.99 atomic percent (at %) actinium-225 and daughter isotopes of actinium-225, and may be formed by a method that includes providing a radioisotope mixture solution comprising at least one of uranium-233 (.sup.233U) and thorium-229 (.sup.229Th), extracting the at least one of uranium-233 and thorium-229 into an organic phase, substantially continuously contacting the organic phase with an aqueous phase, substantially continuously extracting actinium-225 into the aqueous phase, and purifying the actinium-225 from the aqueous phase. In some embodiments, the product may include less than about 1 nanogram (ng) of iron per millicurie (mCi) of actinium-225, and may include less than about 1 microgram (.mu.g) each of magnesium (Mg), Chromium (Cr), and manganese (Mn) per millicurie (mCi) of actinium-225.

  2. Actinium extraction with di(2-ethylhexyl)phosphoric acid

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Rodionova, L.M.; Pyzhova, Z.I.; Myasoedov, B.F.

    1978-01-01

    The extraction of actinium with hdehp from HNO 3 and HClO 4 solutions has been studied in a wide range of acid concentrations. Radioactive Ac 228 has been used as a tracer. Benzene and n-octane have been used as solvents. It has been established that Ac is extracted quantitatively with 0.5 mhdehp in n-octane at HNO 3 concentration -2 M and HClO 4 ( -2 M. Actinium extraction from 8.5 M HClO 4 is 94.7%. The mechanism of actinium extraction has been considered. The composition of the extracted compounds was established, the extraction constant was determined. The most probable form of actinium existance in an organic phase upon extraction from weakly acid solutions is a Asub(c)Xsub(3)x2HX complex and from strongly acid solutions - a solvated complex acid of the HAc(ClO 4 ) 4 x2HX type (where HX - is hdehp)

  3. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  5. Radioactive disequilibrium of uranium and actinium series nuclides in soil

    International Nuclear Information System (INIS)

    Megumi, K.

    1979-01-01

    The concentration of uranium series nuclides ( 238 U, 234 U, 230 Th, 226 Ra, and 210 Pb) and actinium series nuclides ( 235 U and 227 Ac) were determined by γ ray spectrometry for size-separated soil samples collected in Murho and originating from the weathering of granite rock. Each activity ratio of a descendant to 238 U or 235 U is found to be larger than unity. Extraction tests show that approximately 50% of the uranium series nuclides reside on the surface of soil particles and approximately 80% of the 230 Th is surface correlated. Because of the anomalously high radioactivity levels, it was possible to obtain sufficient data to estimate the age of weathering of the soil. A weathering age of >10 3 years was estimated from the 230 Th and 226 Ra surface-correlated activities

  6. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  7. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  8. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  9. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  10. Comment: 215 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 215.png Taxonomy icon (c) Database Center for Life Science licensed under CC Attribution2.1 Japan アイコン:電子顕微鏡バージョン bando 2010/02/15 15:30:03 2010/02/15 15:30:03 ...

  11. 49 CFR 21.5 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Discrimination prohibited. 21.5 Section 21.5... DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.5 Discrimination... discrimination under, any program to which this part applies. (b) Specific discriminatory actions prohibited: (1...

  12. 6 CFR 21.5 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Discrimination prohibited. 21.5 Section 21.5... FROM THE DEPARTMENT OF HOMELAND SECURITY § 21.5 Discrimination prohibited. (a) General. No person in... participation in, be denied the benefits of, or be otherwise subjected to discrimination under, any program to...

  13. 32 CFR 215.7 - Command relationships.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Command relationships. 215.7 Section 215.7 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.7 Command relationships...

  14. 27 CFR 555.215 - Housekeeping.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Housekeeping. 555.215 Section 555.215 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.215 Housekeeping. Magazines...

  15. 12 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.2 Definitions. For... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Definitions. 215.2 Section 215.2 Banks and... company of which a member bank is a subsidiary or any other subsidiary of that company. (b) Company means...

  16. 12 CFR 215.11 - Civil penalties.

    Science.gov (United States)

    2010-01-01

    ... OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.11 Civil penalties. Any member bank, or any officer, director, employee, agent, or other person participating in the... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Civil penalties. 215.11 Section 215.11 Banks...

  17. 2 CFR 215.46 - Procurement records.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Procurement records. 215.46 Section 215.46... NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Procurement Standards § 215.46 Procurement records. Procurement records and files for purchases in excess of the small purchase threshold...

  18. 33 CFR 117.215 - Niantic River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niantic River. 117.215 Section 117.215 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.215 Niantic River. (a) The draw of...

  19. 2 CFR 215.43 - Competition.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Competition. 215.43 Section 215.43 Grants... ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Procurement Standards § 215.43 Competition. All... free competition. The recipient shall be alert to organizational conflicts of interest as well as...

  20. 49 CFR 199.215 - Alcohol concentration.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY DRUG AND ALCOHOL TESTING Alcohol Misuse Prevention Program § 199.215 Alcohol concentration. Each operator shall prohibit a covered employee from... 49 Transportation 3 2010-10-01 2010-10-01 false Alcohol concentration. 199.215 Section 199.215...

  1. 48 CFR 833.215 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 833.215 Section 833.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 833.215 Contract clause. The contracting...

  2. 25 CFR 215.12 - Advertising costs.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertising costs. 215.12 Section 215.12 Indians BUREAU... LEASES, QUAPAW AGENCY § 215.12 Advertising costs. All advertising costs, publication fees, expenses incurred for abstracts of lease title, and other expenses incurred in connection with the advertising and...

  3. 47 CFR 80.215 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 80.215 Section 80.215... MARITIME SERVICES General Technical Standards § 80.215 Transmitter power. (a) Transmitter power shown on the radio station authorization is the maximum power the licensee is authorized to use. Power is...

  4. 2 CFR 215.27 - Allowable costs.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Allowable costs. 215.27 Section 215.27... § 215.27 Allowable costs. For each kind of recipient, there is a set of Federal principles for determining allowable costs. Allowability of costs shall be determined in accordance with the cost principles...

  5. 46 CFR 108.215 - Insect screens.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Insect screens. 108.215 Section 108.215 Shipping COAST... Construction and Arrangement Accommodation Spaces § 108.215 Insect screens. (a) Accommodation spaces must be protected against the admission of insects. (b) Insect screens must be installed when natural ventilation is...

  6. 32 CFR 724.215 - Military representation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Military representation. 724.215 Section 724.215... BOARD Authority/Policy for Departmental Discharge Review § 724.215 Military representation. Military... consult legal counsel before undertaking such representation. Such representation may be prohibited by 18...

  7. 49 CFR 215.203 - Restricted cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Restricted cars. 215.203 Section 215.203..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Restricted Equipment § 215.203 Restricted cars. (a) This section restricts the operation of any railroad freight car that is— (1) More than 50...

  8. 7 CFR 215.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 215.3 Section 215.3 Agriculture... CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, CND...

  9. 49 CFR 215.103 - Defective wheel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective wheel. 215.103 Section 215.103... § 215.103 Defective wheel. A railroad may not place or continue in service a car, if— (a) A wheel flange... tread of the wheel; (b) The height of a wheel flange on the car, from the tread to the top of the flange...

  10. 2 CFR 215.52 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Financial reporting. 215.52 Section 215.52... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status Report...

  11. 36 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... cumulatively have a significant effect on the human environment and for which neither an environmental impact... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Definitions. 215.2 Section 215.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE NOTICE, COMMENT...

  12. 2 CFR 215.34 - Equipment.

    Science.gov (United States)

    2010-01-01

    ...) When acquiring replacement equipment, the recipient may use the equipment to be replaced as trade-in or sell the equipment and use the proceeds to offset the costs of the replacement equipment subject to the... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Equipment. 215.34 Section 215.34 Grants and...

  13. 42 CFR 93.215 - Investigation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Investigation. 93.215 Section 93.215 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

  14. 48 CFR 215.404-1 - Proposal analysis techniques.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Proposal analysis techniques. 215.404-1 Section 215.404-1 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-1 Proposal analysis techniques. (1) Follow the procedures at PGI 215.404-1 for...

  15. 2 CFR 215.50 - Purpose of reports and records.

    Science.gov (United States)

    2010-01-01

    ... Records § 215.50 Purpose of reports and records. Sections 215.51 through 215.53 set forth the procedures for monitoring and reporting on the recipient's financial and program performance and the necessary... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of reports and records. 215.50...

  16. 48 CFR 215.406-3 - Documenting the negotiation.

    Science.gov (United States)

    2010-10-01

    ... negotiation. 215.406-3 Section 215.406-3 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.406-3 Documenting the negotiation. Follow the procedures at PGI 215.406-3 for...

  17. 49 CFR 215.303 - Stenciling of restricted cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Stenciling of restricted cars. 215.303 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Stenciling § 215.303 Stenciling of restricted cars. (a) Each restricted railroad freight car that is described in § 215.205(a) of...

  18. 20 CFR 627.215 - Relocation.

    Science.gov (United States)

    2010-04-01

    ...' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR GENERAL PROVISIONS GOVERNING PROGRAMS UNDER TITLES I, II, AND III OF THE ACT Program Requirements § 627.215 Relocation. (a) No funds provided... skill training, on-the-job training, or company-specific assessments of job applicants or employees, for...

  19. 33 CFR 136.215 - Proof.

    Science.gov (United States)

    2010-07-01

    ... FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.215 Proof. (a) In addition to the... each claim for economic loss resulting from destruction of real or personal property, the claimant must...

  20. 48 CFR 215.305 - Proposal evaluation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Source Selection 215... Business Concerns, the evaluation factors shall include the past performance of offerors in complying with... includes the clause at FAR 52.219-9, Small Business Subcontracting Plan, the evaluation factors shall...

  1. 8 CFR 215.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... departure from the United States. (i) The term departure-control officer means any immigration officer as... UNITED STATES § 215.1 Definitions. For the purpose of this part: (a) The term alien means any person who is not a citizen or national of the United States. (b) The term Commissioner means the Commissioner...

  2. 2 CFR 1.215 - Relationship to previous issuances.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Relationship to previous issuances. 1.215 Section 1.215 Grants and Agreements ABOUT TITLE 2 OF THE CODE OF FEDERAL REGULATIONS AND SUBTITLE A Introduction toSubtitle A § 1.215 Relationship to previous issuances. Although some of the guidance was...

  3. 49 CFR 215.121 - Defective car body.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective car body. 215.121 Section 215.121..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Car Bodies § 215.121 Defective car body. A railroad may not place or continue in service a car, if: (a) Any portion of...

  4. 12 CFR 215.3 - Extension of credit.

    Science.gov (United States)

    2010-01-01

    ... OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.3 Extension of credit... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Extension of credit. 215.3 Section 215.3 Banks... bank for its own protection for: (i) Accrued interest; or (ii) Taxes, insurance, or other expenses...

  5. 49 CFR 215.115 - Defective roller bearing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing. 215.115 Section 215.115... § 215.115 Defective roller bearing. (a) A railroad may not place or continue in service a car, if the car has— (1) A roller bearing that shows signs of having been overheated as evidenced by— (i...

  6. 49 CFR 215.111 - Defective plain bearing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing. 215.111 Section 215.111... § 215.111 Defective plain bearing. A railroad may not place or continue in service a car, if the car has a plain bearing— (a) That is missing, cracked, or broken; (b) On which the bearing liner— (1) Is...

  7. 7 CFR 215.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 215.1 Section 215.1... AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.1 General purpose and scope. This part announces the policies and prescribes the general regulations with respect to the Special Milk...

  8. 21 CFR 1311.215 - Internal audit trail.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Internal audit trail. 1311.215 Section 1311.215... ORDERS AND PRESCRIPTIONS (Eff. 6-1-10) Electronic Prescriptions § 1311.215 Internal audit trail. (a) The... with audit trail functions. (6) For application service providers, attempted or successful annotation...

  9. 7 CFR 58.215 - Pre-heaters.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pre-heaters. 58.215 Section 58.215 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards....215 Pre-heaters. The pre-heaters shall be of stainless steel or other equally corrosion resistant...

  10. 25 CFR 215.24 - Books and accounts.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Books and accounts. 215.24 Section 215.24 Indians BUREAU... LEASES, QUAPAW AGENCY § 215.24 Books and accounts. (a) The lessee shall maintain books in which shall be... land. (b) An audit of the lessee's accounts and books shall be made semiannually, or at such other...

  11. 48 CFR 253.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation. ...

  12. 48 CFR 53.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contracting by negotiation. 53.215 Section 53.215 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.215 Contracting by negotiation. ...

  13. 48 CFR 853.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contracting by negotiation. 853.215 Section 853.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS FORMS Prescription of Forms 853.215 Contracting by negotiation. ...

  14. 48 CFR 2453.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracting by negotiation. 2453.215 Section 2453.215 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.215 Contracting by negotiation. ...

  15. 23 CFR 668.215 - Programming and project procedures.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Programming and project procedures. 668.215 Section 668.215 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS EMERGENCY RELIEF PROGRAM Procedures for Federal Agencies for Federal Roads § 668.215 Programming...

  16. 24 CFR 1710.215 - Subdivision characteristics and climate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Subdivision characteristics and climate. 1710.215 Section 1710.215 Housing and Urban Development Regulations Relating to Housing and Urban... Requirements § 1710.215 Subdivision characteristics and climate. (a) Submit two copies of a current geological...

  17. 49 CFR 215.119 - Defective freight car truck.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective freight car truck. 215.119 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.119 Defective freight car truck. A railroad may not place or continue in service a...

  18. 49 CFR 215.113 - Defective plain bearing wedge.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...

  19. 30 CFR 75.215 - Longwall mining systems.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Longwall mining systems. 75.215 Section 75.215... MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.215 Longwall mining systems. For each longwall mining section, the roof control plan shall specify— (a) The methods that will be used to maintain...

  20. 48 CFR 2515.215-70 - NSF negotiation authorities.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Negotiation Authorities 2515.215-70 NSF... entered into through negotiation rather than formal advertising. The Foundation's contracting officer may...

  1. 45 CFR 2555.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-10-01

    .... 2555.215 Section 2555.215 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION... Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy...

  2. 2 CFR 215.37 - Property trust relationship.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Property trust relationship. 215.37 Section 215.37 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... Property trust relationship. Real property, equipment, intangible property and debt instruments that are...

  3. 40 CFR 180.215 - Naled; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Naled; tolerances for residues. 180.215 Section 180.215 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE... commodities, except those otherwise listed in this section, from use of the pesticide for area pest (mosquito...

  4. 29 CFR 553.215 - Ambulance and rescue service employees.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Ambulance and rescue service employees. 553.215 Section 553.215 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE FAIR LABOR STANDARDS ACT TO EMPLOYEES OF STATE AND LOCAL GOVERNMENTS Fire Protection and Law Enforcement Employees of...

  5. 5 CFR 531.215 - Setting pay upon demotion.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay upon demotion. 531.215 Section 531.215 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... termination of a temporary promotion. (1) When an employee is returned to the lower grade from which promoted...

  6. 22 CFR 229.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-04-01

    ...), the active membership of which consists primarily of students in attendance at institutions of higher... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Membership practices of certain organizations. 229.215 Section 229.215 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON...

  7. 14 CFR 21.5 - Airplane or Rotorcraft Flight Manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane or Rotorcraft Flight Manual. 21.5... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.5 Airplane or Rotorcraft Flight Manual. (a) With each airplane or rotorcraft that was not type certificated with an Airplane or Rotorcraft Flight Manual...

  8. 2 CFR 215.42 - Codes of conduct.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Codes of conduct. 215.42 Section 215.42... Codes of conduct. The recipient shall maintain written standards of conduct governing the performance of... interest is not substantial or the gift is an unsolicited item of nominal value. The standards of conduct...

  9. 49 CFR 232.215 - Transfer train brake tests.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Transfer train brake tests. 232.215 Section 232... TRAINS AND EQUIPMENT; END-OF-TRAIN DEVICES Inspection and Testing Requirements § 232.215 Transfer train brake tests. (a) A transfer train, as defined in § 232.5, shall receive a brake test performed by a...

  10. 24 CFR 180.215 - Ex parte communications.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Ex parte communications. 180.215... AND BUSINESS OPPORTUNITY CONSOLIDATED HUD HEARING PROCEDURES FOR CIVIL RIGHTS MATTERS Administrative Law Judge § 180.215 Ex parte communications. (a) An ex parte communication is any direct or indirect...

  11. 14 CFR 417.215 - Straight-up time analysis.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Straight-up time analysis. 417.215 Section..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.215 Straight-up time analysis. A flight safety analysis must establish the straight-up time for a launch for use as a flight...

  12. 48 CFR 252.215-7002 - Cost estimating system requirements.

    Science.gov (United States)

    2010-10-01

    ... historical costs, and other analyses used to generate cost estimates. (b) General. The Contractor shall... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost estimating system... of Provisions And Clauses 252.215-7002 Cost estimating system requirements. As prescribed in 215.408...

  13. 14 CFR 1253.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Membership practices of certain organizations. 1253.215 Section 1253.215 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION... regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the...

  14. 48 CFR 1652.215-71 - Investment Income.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Investment Income. 1652.215... 1652.215-71 Investment Income. As prescribed in 1615.470-1, the following clause shall be inserted in all FEHBP contracts based on cost analysis: Investment Income (JAN 1998) (a) The Carrier shall invest...

  15. 20 CFR 416.215 - You leave the United States.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You leave the United States. 416.215 Section... Eligible § 416.215 You leave the United States. You lose your eligibility for SSI benefits for any month during all of which you are outside of the United States. If you are outside of the United States for 30...

  16. 6 CFR 27.215 - Security vulnerability assessments.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Security vulnerability assessments. 27.215... FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.215 Security vulnerability...-risk, the facility must complete a Security Vulnerability Assessment. A Security Vulnerability...

  17. 47 CFR 97.215 - Telecommand of model craft.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Telecommand of model craft. 97.215 Section 97... AMATEUR RADIO SERVICE Special Operations § 97.215 Telecommand of model craft. An amateur station transmitting signals to control a model craft may be operated as follows: (a) The station identification...

  18. 21 CFR 137.215 - Yellow corn flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn flour. 137.215 Section 137.215 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... standard of identity prescribed by § 137.211 for white corn flour except that cleaned yellow corn is used...

  19. 37 CFR 1.215 - Patent application publication.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application publication. 1.215 Section 1.215 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication...

  20. 36 CFR 215.6 - Comments on proposed actions.

    Science.gov (United States)

    2010-07-01

    .... 215.6 Section 215.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... submit a scanned signature. Otherwise another means of verifying the identity of the individual or... determined as follows: (i) Written comments must be postmarked by the Postal Service, e-mailed, faxed, or...

  1. 49 CFR 215.117 - Defective roller bearing adapter.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing adapter. 215.117 Section... Suspension System § 215.117 Defective roller bearing adapter. A railroad may not place or continue in service a car, if the car has a roller bearing adapter that is— (a) Cracked or broken; (b) Not in its design...

  2. 48 CFR 215.370-2 - Evaluation factor.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Source Selection 215... whether an offeror intends to perform the contract using employees or individual subcontractors who are...

  3. 48 CFR 215.404-71-2 - Performance risk.

    Science.gov (United States)

    2010-10-01

    ... Pricing 215.404-71-2 Performance risk. (a) Description. This profit factor addresses the contractor's... schedule; and (vii) Any other factors that affect the contractor's ability to meet the cost targets (e.g...

  4. 48 CFR 215.404-76 - Reporting profit and fee statistics.

    Science.gov (United States)

    2010-10-01

    ... statistics. 215.404-76 Section 215.404-76 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-76 Reporting profit and fee statistics. Follow the procedures at PGI 215.404-76 for reporting profit and fee statistics. [71 FR 69494, Dec. 1, 2006] ...

  5. 48 CFR 215.404-70 - DD Form 1547, Record of Weighted Guidelines Method Application.

    Science.gov (United States)

    2010-10-01

    ... Weighted Guidelines Method Application. 215.404-70 Section 215.404-70 Federal Acquisition Regulations... TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-70 DD Form 1547, Record of Weighted Guidelines Method Application. Follow the procedures at PGI 215.404-70 for use of DD Form 1547 whenever a structured...

  6. 48 CFR 215.404-73 - Alternate structured approaches.

    Science.gov (United States)

    2010-10-01

    ... an element of contract cost (see FAR 31.205-10) and reductions were made directly to the profit... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-73 Alternate structured approaches. (a) The contracting officer may use an...

  7. 2 CFR 215.21 - Standards for financial management systems.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Standards for financial management systems... Financial and Program Management § 215.21 Standards for financial management systems. (a) Federal awarding... information whenever practical. (b) Recipients' financial management systems shall provide for the following...

  8. 18 CFR 367.2150 - Account 215, Appropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2150 Account 215, Appropriated... ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE PUBLIC UTILITY HOLDING COMPANY...

  9. 7 CFR 215.13 - Management evaluations and audits.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.13 Management evaluations and audits. (a) Unless otherwise exempt, audits at the State and school food authority/child care... opportunity to conduct management evaluations (including visits to schools and child-care institutions) of any...

  10. 7 CFR 215.14a - Procurement standards.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.14a Procurement standards. (a... connection with the Program. This includes but is not limited to: Source evaluation, protests, disputes...

  11. 29 CFR 779.215 - General scope of terms.

    Science.gov (United States)

    2010-07-01

    ... common control within the meaning of the definition of enterprise. The fact the firms are independently... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Unified Operation Or Common Control § 779.215 General scope of terms. (a) Under the definition related activities...

  12. 42 CFR 413.215 - Basis of payment.

    Science.gov (United States)

    2010-10-01

    ... predetermined per treatment payment amount described in § 413.230 of this part, for renal dialysis services... Medicare Part B fee-for-service beneficiaries. (b) In addition to the per-treatment payment amount, as described in § 413.215(a) of this part, the ESRD facility may receive payment for bad debts of Medicare...

  13. 10 CFR 603.215 - Recipient's commitment and cost sharing.

    Science.gov (United States)

    2010-01-01

    ... self-interest in the success of the project and incorporating the technology into products and... proposal, in the recipient's management plan, or through other means. (b) The contracting officer must seek... 603.215 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT...

  14. 48 CFR 215.404-71-1 - General.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215... range provides values based on above normal or below normal conditions. In the price negotiation... normal value. The contracting officer shall exercise sound business judgment in selecting a value when...

  15. 48 CFR 215.404-71-4 - Facilities capital employed.

    Science.gov (United States)

    2010-10-01

    ... Contract Pricing 215.404-71-4 Facilities capital employed. (a) Description. This factor focuses on... field pricing support for preparing DD Form 1861. (1) Purpose. The DD Form 1861 provides a means of... establish a cost objective or the target cost when structuring an incentive type contract. Do not adjust...

  16. 8 CFR 215.9 - Temporary Worker Visa Exit Program.

    Science.gov (United States)

    2010-01-01

    ... Section 215.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF... participating in the program and must present designated biographic and/or biometric information upon departure... participating in the program, which biographical and/or biometric information would be required, and the format...

  17. 48 CFR 215.404-71-5 - Cost efficiency factor.

    Science.gov (United States)

    2010-10-01

    ... loaded labor hours (i.e., cost per labor hour, including all direct and indirect costs) or other... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost efficiency factor... Contract Pricing 215.404-71-5 Cost efficiency factor. (a) This special factor provides an incentive for...

  18. 12 CFR 215.8 - Records of member banks.

    Science.gov (United States)

    2010-01-01

    ... EXECUTIVE OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.8 Records of...) Special rule for non-commercial lenders. A member bank that is prohibited by law or by an express resolution of the board of directors of the bank from making an extension of credit to any company or other...

  19. 20 CFR 628.215 - State Human Resource Investment Council.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false State Human Resource Investment Council. 628... PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Planning § 628.215 State Human Resource..., 702, and 703 of the Act, establish a State Human Resource Investment Council (HRIC). The HRIC's...

  20. 33 CFR 162.215 - Lake Tahoe, Nev.; restricted area adjacent to Nevada Beach.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Lake Tahoe, Nev.; restricted area adjacent to Nevada Beach. 162.215 Section 162.215 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 162.215 Lake Tahoe, Nev.; restricted area adjacent to Nevada Beach. (a) The restricted area. The...

  1. 48 CFR 52.215-17 - Waiver of Facilities Capital Cost of Money.

    Science.gov (United States)

    2010-10-01

    ... Capital Cost of Money. 52.215-17 Section 52.215-17 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-17 Waiver of Facilities Capital Cost of Money. As prescribed in 15.408(i), insert the following clause: Waiver of Facilities Capital Cost of Money (OCT 1997) The Contractor did not...

  2. 48 CFR 52.215-16 - Facilities Capital Cost of Money.

    Science.gov (United States)

    2010-10-01

    ... Money. 52.215-16 Section 52.215-16 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-16 Facilities Capital Cost of Money. As prescribed in 15.408(h), insert the following provision: Facilities Capital Cost of Money (JUN 2003) (a) Facilities capital cost of money will be an allowable cost...

  3. 41 CFR 102-37.215 - When must a SASP make a certification regarding lobbying?

    Science.gov (United States)

    2010-07-01

    ... certification regarding lobbying? 102-37.215 Section 102-37.215 Public Contracts and Property Management Federal... Property § 102-37.215 When must a SASP make a certification regarding lobbying? You are subject to the anti-lobbying certification and disclosure requirements in part 105-69 of this title when all of the following...

  4. 2 CFR 215.20 - Purpose of financial and program management.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of financial and program management... Financial and Program Management § 215.20 Purpose of financial and program management. Sections 215.21 through 215.28 prescribe standards for financial management systems, methods for making payments and rules...

  5. 25 CFR 215.25 - Other minerals and deep-lying lead and zinc minerals.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Other minerals and deep-lying lead and zinc minerals. 215.25 Section 215.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.25 Other minerals and deep-lying lead...

  6. 12 CFR 215.10 - Reporting requirement for credit secured by certain bank stock.

    Science.gov (United States)

    2010-01-01

    ... MEMBER BANKS (REGULATION O) § 215.10 Reporting requirement for credit secured by certain bank stock. Each... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Reporting requirement for credit secured by certain bank stock. 215.10 Section 215.10 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF...

  7. 41 CFR 102-34.215 - May Government contractors use Government motor vehicles?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May Government contractors use Government motor vehicles? 102-34.215 Section 102-34.215 Public Contracts and Property... PROPERTY 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.215 May Government...

  8. 48 CFR 52.215-2 - Audit and Records-Negotiation.

    Science.gov (United States)

    2010-10-01

    ...-Negotiation. 52.215-2 Section 52.215-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-2 Audit and Records—Negotiation. As prescribed in 15.209(b), insert the following clause: Audit and Records—Negotiation (OCT 2010) (a) As used in this clause, records includes books, documents...

  9. 48 CFR 215.404-71-3 - Contract type risk and working capital adjustment.

    Science.gov (United States)

    2010-10-01

    ... working capital adjustment. 215.404-71-3 Section 215.404-71-3 Federal Acquisition Regulations System... CONTRACTING BY NEGOTIATION Contract Pricing 215.404-71-3 Contract type risk and working capital adjustment. (a... varying contract types. The working capital adjustment is an adjustment added to the profit objective for...

  10. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of Weighted Guidelines Application. 253.215-70 Section 253.215-70 Federal Acquisition Regulations System...

  11. XTACC3-XMAP215 association reveals an asymmetric interaction promoting microtubule elongation

    DEFF Research Database (Denmark)

    Mortuza, Gulnahar B; Cavazza, Tommaso; Garcia-Mayoral, Maria Flor

    2014-01-01

    215 (chTOG), dissecting the mechanism by which their interaction promotes microtubule elongation during spindle assembly. Using SAXS, we show that the TACC domain (TD) is an elongated structure that mediates the interaction with the C terminus of XMAP215. Our data suggest that one TD and two XMAP215...... molecules associate to form a four-helix coiled-coil complex. A hybrid methods approach was used to define the precise regions of the TACC heptad repeat and the XMAP215 C terminus required for assembly and functioning of the complex. We show that XTACC3 can induce the recruitment of larger amounts of XMAP...

  12. 41 CFR 102-36.215 - How do we report excess personal property?

    Science.gov (United States)

    2010-07-01

    ...) Electronically submit the data elements required on the Standard Form 120 (SF 120), Report of Excess Personal... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How do we report excess personal property? 102-36.215 Section 102-36.215 Public Contracts and Property Management Federal Property...

  13. 25 CFR 215.21 - Payment of gross production tax on lead and zinc.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Payment of gross production tax on lead and zinc. 215.21... ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.21 Payment of gross production tax on lead and zinc. The superintendent of the Quapaw Indian Agency is hereby authorized and directed to pay at the...

  14. 30 CFR 285.215 - What areas will MMS offer in a lease sale?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What areas will MMS offer in a lease sale? 285.215 Section 285.215 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Issuance of OCS...

  15. 12 CFR 215.7 - Extensions of credit outstanding on March 10, 1979.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Extensions of credit outstanding on March 10... (REGULATION O) § 215.7 Extensions of credit outstanding on March 10, 1979. (a) Any extension of credit that was outstanding on March 10, 1979, and that would, if made on or after March 10, 1979, violate § 215.4...

  16. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Which nonprocurement transactions are not covered transactions? 208.215 Section 208.215 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT... to regulate public health, safety, or the environment, unless the U.S. Agency for International...

  17. 22 CFR 1203.735-215 - General conduct prejudicial to the Government.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true General conduct prejudicial to the Government. 1203.735-215 Section 1203.735-215 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION... promptness in dealing with or serving the public. ...

  18. 42 CFR 405.215 - Confidential commercial and trade secret information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Confidential commercial and trade secret information. 405.215 Section 405.215 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF... trade secret information. To the extent that CMS relies on confidential commercial or trade secret...

  19. 47 CFR 25.215 - Technical requirements for space stations in the Direct Broadcast Satellite Service.

    Science.gov (United States)

    2010-10-01

    ... the Direct Broadcast Satellite Service. 25.215 Section 25.215 Telecommunication FEDERAL COMMUNICATIONS... Technical requirements for space stations in the Direct Broadcast Satellite Service. In addition to § 25.148(f), space station antennas operating in the Direct Broadcast Satellite Service must be designed to...

  20. 20 CFR 664.215 - Must youth participants be registered to participate in the youth program?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Must youth participants be registered to participate in the youth program? 664.215 Section 664.215 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR YOUTH ACTIVITIES UNDER TITLE I OF THE WORKFORCE INVESTMENT ACT Eligibility...

  1. 31 CFR 215.4 - Relationship of Withholding Agreement to prior agreements.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Relationship of Withholding Agreement to prior agreements. 215.4 Section 215.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE...

  2. 8 CFR 215.7 - Instructions from the Administrator required in certain cases.

    Science.gov (United States)

    2010-01-01

    ... IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.7 Instructions from the... authority conferred by § 215.2 in the case of any alien who seeks to depart from the United States in the... United Nations and the United States of America regarding the Headquarters of the United Nations (61 Stat...

  3. 25 CFR 215.23a - Suspension of operations and production on leases for minerals other than oil and gas.

    Science.gov (United States)

    2010-04-01

    ... minerals other than oil and gas. 215.23a Section 215.23a Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.23a Suspension of operations and production on leases for minerals other than oil and gas. The provisions of...

  4. 25 CFR 171.215 - What if the elevation of my farm unit is too high to receive irrigation water?

    Science.gov (United States)

    2010-04-01

    ... receive irrigation water? 171.215 Section 171.215 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER IRRIGATION OPERATION AND MAINTENANCE Irrigation Service § 171.215 What if the elevation of my farm unit is too high to receive irrigation water? (a) We will not change our service ditch...

  5. 49 CFR 40.215 - What information about the DER do employers have to provide to BATs and STTs?

    Science.gov (United States)

    2010-10-01

    ... to provide to BATs and STTs? 40.215 Section 40.215 Transportation Office of the Secretary of... Personnel § 40.215 What information about the DER do employers have to provide to BATs and STTs? As an employer, you must provide to the STTs and BATs the name and telephone number of the appropriate DER (and C...

  6. 47 CFR 95.215 - (R/C Rule 15) Do I have to limit the length of my communications?

    Science.gov (United States)

    2010-10-01

    ... my communications? 95.215 Section 95.215 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... to Operate An R/c Station § 95.215 (R/C Rule 15) Do I have to limit the length of my communications? (a) You must limit your R/C communications to the minimum practical time. (b) The only time your R/C...

  7. 8 CFR 215.3 - Alien whose departure is deemed prejudicial to the interests of the United States.

    Science.gov (United States)

    2010-01-01

    ... to the interests of the United States. 215.3 Section 215.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.3 Alien whose departure is deemed prejudicial to the interests of the United States. The departure from the...

  8. 8 CFR 215.4 - Procedure in case of alien prevented from departing from the United States.

    Science.gov (United States)

    2010-01-01

    ... departing from the United States. 215.4 Section 215.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.4 Procedure in case of alien prevented from departing from the United States. (a) Any alien, other than an enemy alien, whose departure...

  9. 8 CFR 215.2 - Authority of departure-control officer to prevent alien's departure from the United States.

    Science.gov (United States)

    2010-01-01

    ... prevent alien's departure from the United States. 215.2 Section 215.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.2 Authority of departure-control officer to prevent alien's departure from the United States. (a) No alien...

  10. Clinical analysis of acute anterior uveitis in 215 cases

    Directory of Open Access Journals (Sweden)

    Xue-Wei Zhou

    2013-11-01

    Full Text Available AIM: To analyze the etiology, therapeutic effects,risk of relapse and prognosis of acute anterior uveitis.MEHTODS: Medical history of 215 patients with acute anterior uveitis who underwent treatment in Department of Ophthalmology, People's Hospital of Fenghua was collected, together with results of clinical examinations and auxiliary examinations. The data were studied in terms of therapeutic effects, etiological factors, prognosis and relapse rate. RESULTS: In 85 cases(39.5%, the cause was identified, and among the among the most frequent causes were traumatic or surgical injury, viral infection and glaucomatocyclitic crisis. After treatment, the best corrected visual acuity was no less than 1.0 in 153 cases(71.2%, between 0.5 and 1.0 in 55 cases(25.6%, between 0.3 and 0.5 in 4 cases(1.9%, between 0.05 and 0.3 in 2 cases(0.9%, and less than 0.05 in 1 case(0.5%. During the follow-up of more than 6 months, relapse occurred in 4 cases(1.9%during 4-6 months, in 7 cases(3.2%during 7-12 months, in 10 cases(4.7%during 13-24 months, and in 3 cases(1.4%during 25-60 months. CONCLUSION: The etiology of acute anterior uveitis is complicated and mostly idiopathic. Vision prognosis is good after treatment, but therelapse rate is high and can cause visual impairment, so better understanding should be gained of its relapse and its prevention and early treatment should be emphasized.

  11. Phenotypic characteristics of the p.Asn215Ser (p.N215S) GLA mutation in male and female patients with Fabry disease: A multicenter Fabry Registry study.

    Science.gov (United States)

    Germain, Dominique P; Brand, Eva; Burlina, Alessandro; Cecchi, Franco; Garman, Scott C; Kempf, Judy; Laney, Dawn A; Linhart, Aleš; Maródi, László; Nicholls, Kathy; Ortiz, Alberto; Pieruzzi, Federico; Shankar, Suma P; Waldek, Stephen; Wanner, Christoph; Jovanovic, Ana

    2018-04-12

    The p.Asn215Ser or p.N215S GLA variant has been associated with late-onset cardiac variant of Fabry disease. To expand on the scarce phenotype data, we analyzed natural history data from 125 p.N215S patients (66 females, 59 males) enrolled in the Fabry Registry (NCT00196742) and compared it with data from 401 patients (237 females, 164 males) harboring mutations associated with classic Fabry disease. We evaluated interventricular septum thickness (IVST), left ventricular posterior wall thickness (LVPWT), estimated glomerular filtration rate and severe clinical events. In p.N215S males, mildly abnormal mean IVST and LVPWT values were observed in patients aged 25-34 years, and values gradually increased with advancing age. Mean values were similar to those of classic males. In p.N215S females, these abnormalities occurred primarily in patients aged 55-64 years. Severe clinical events in p.N215S patients were mainly cardiac (males 31%, females 8%) while renal and cerebrovascular events were rare. Renal impairment occurred in 17% of p.N215S males (mostly in patients aged 65-74 years), and rarely in females (3%). p.N215S is a disease-causing mutation with severe clinical manifestations found primarily in the heart. Cardiac involvement may become as severe as in classic Fabry patients, especially in males. © 2018 The Authors. Molecular Genetics & Genomic Medicine published by Wiley Periodicals, Inc.

  12. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2014. Scientific Opinion on Flavouring Group Evaluation 215 (FGE.215): Seven α,β-Unsaturated Cinnamyl Ketones from subgroup 3.2 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of flavouring substances from subgroup 3.2 of FGE.19 in the Flavouring Group Evaluation 215 (FGE.215). The Flavour Industry has pro...

  13. Identification and comparative expression analysis of interleukin 2/15 receptor B chain in chickens infected with E. tenella

    Science.gov (United States)

    Background: Interleukin (IL) 2 and IL15 receptor beta chain (IL2/15Receptor beta, CD122) play critical roles in signal transduction for the biological activities of IL2 and IL15. Increased knowledge of non-mammalian IL2/15Receptor beta will enhance the understanding of IL2 and IL15 functions. Meth...

  14. 30 CFR 204.215 - Are the information collection requirements in this subpart approved by the Office of Management...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Are the information collection requirements in this subpart approved by the Office of Management and Budget (OMB)? 204.215 Section 204.215 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES...

  15. 27 CFR 24.215 - Wine or wine products not for beverage use.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine or wine products not... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.215 Wine or wine products not for beverage use. (a) General. Wine, or wine products made from wine...

  16. 7 CFR 3021.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-01-01

    ... inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee assistance... WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals § 3021.215 What must I...

  17. 29 CFR 94.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee assistance... WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals § 94.215 What must I...

  18. 22 CFR 312.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee assistance... WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals § 312.215 What must I...

  19. 13 CFR 120.215 - What interest rates apply to smaller loans?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What interest rates apply to... BUSINESS LOANS Policies Specific to 7(a) Loans Maturities; Interest Rates; Loan and Guarantee Amounts § 120.215 What interest rates apply to smaller loans? For a loan over $25,000 but not exceeding $50,000, the...

  20. 48 CFR 52.215-3 - Request for Information or Solicitation for Planning Purposes.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 52.215-3 Request for Information or Solicitation for Planning Purposes. As prescribed... solicitation or to otherwise pay for the information solicited except as an allowable cost under other... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Request for Information or...

  1. Acharyya S see Dutta K 775 Ajith Kumar BP see Kumar Rakesh 215 ...

    Indian Academy of Sciences (India)

    AUTHOR INDEX. Acharyya S see Dutta K. 775. Ajith Kumar B P see Kumar Rakesh. 215. Amita see Jain Ashok Kumar. 611. Anderson D. A variational approach to nonlinear evolution equations in optics. 917. Ansari A. Nuclear structure at high excitation energies. 459. Arima Akito see Dang Nguyen Dinh. 505. Arivuoli D.

  2. 5 CFR 591.215 - Where does OPM collect prices in the COLA and DC areas?

    Science.gov (United States)

    2010-01-01

    ... SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.215 Where does OPM collect prices in the COLA and DC areas? (a... collect survey data onsite, use alternative indicators of relative living costs (e.g., price and cost...

  3. 48 CFR 215.370-3 - Solicitation provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION... using employees or individual subcontractors who are members of the Selected Reserve. (b) Use the clause at 252.215-7006, Use of Employees or Individual Subcontractors Who are Members of the Selected...

  4. 29 CFR 780.215 - Meaning of forestry or lumbering operations.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Meaning of forestry or lumbering operations. 780.215... forestry or lumbering operations. The term forestry or lumbering operations refers to the cultivation and... considers the sec. 13(b)(28) exemption for forestry or logging operations in which not more than eight...

  5. 48 CFR 52.215-15 - Pension adjustments and asset reversions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Pension adjustments and... Clauses 52.215-15 Pension adjustments and asset reversions. As prescribed in 15.408(g), insert the following clause: Pension Adjustments and Asset Reversions (OCT 2010) (a) The Contractor shall promptly...

  6. 49 CFR 215.109 - Defective plain bearing box: Journal lubrication system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing box: Journal lubrication... Freight Car Components Suspension System § 215.109 Defective plain bearing box: Journal lubrication system...) Metal parts contacting the journal; or (e) Is— (1) Missing; or (2) Not in contact with the journal. ...

  7. 48 CFR 1552.215-73 - General financial and organizational information.

    Science.gov (United States)

    2010-10-01

    ... Clauses 1552.215-73 General financial and organizational information. As prescribed in 1515.408(a)(2), insert the following provision: General Financial and Organizational Information: (AUG 1999) Offerors or... update all outdated information on file. (a) Contractor's Name: (b) Address (If financial records are...

  8. 28 CFR 2.15 - Petition for consideration of parole prior to date set at hearing.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Petition for consideration of parole... States Code Prisoners and Parolees § 2.15 Petition for consideration of parole prior to date set at hearing. When a prisoner has served the minimum term of imprisonment required by law, the Bureau of...

  9. 48 CFR 215.203-70 - Requests for proposals-tiered evaluation of offers.

    Science.gov (United States)

    2010-10-01

    ... NEGOTIATION Solicitation and Receipt of Proposals and Information 215.203-70 Requests for proposals—tiered... shall be consistent with FAR part 19. (b) Consideration shall be given to the tiers of small businesses (e.g., 8(a), HUBZone small business, service-disabled veteran-owned small business, small business...

  10. 48 CFR 215.407-5-70 - Disclosure, maintenance, and review requirements.

    Science.gov (United States)

    2010-10-01

    ... basis for negotiation of fair and reasonable prices. (2) A large business contractor is subject to... CONTRACTING BY NEGOTIATION Contract Pricing 215.407-5-70 Disclosure, maintenance, and review requirements. (a... Requirements. (2) Contractor means a business unit as defined in FAR 2.101. (3) Estimating system is as defined...

  11. 9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed... REQUIREMENTS Killed Virus Vaccines § 113.215 Bovine Virus Diarrhea Vaccine, Killed Virus. Bovine Virus Diarrhea... paragraph. (i) Eight bovine virus diarrhea susceptible calves (five vaccinates and three controls) shall be...

  12. 49 CFR 215.9 - Movement of defective cars for repair.

    Science.gov (United States)

    2010-10-01

    ... following: (1) A person designated under § 215.11 shall determine: (i) That it is safe to move the car; and... the following information, shall be securely attached to each side of the car— (i) The reporting mark... for a destination on the line of haul between the point where the car was found defective and the...

  13. 48 CFR 853.215-70 - VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA.

    Science.gov (United States)

    2010-10-01

    ..., Application for Furnishing Nursing Home Care to Beneficiaries of VA. 853.215-70 Section 853.215-70 Federal... 853.215-70 VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA. VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA, will be used for...

  14. Downregulation of Plasma miR-215 in Chronic Myeloid Leukemia Patients with Successful Discontinuation of Imatinib

    Directory of Open Access Journals (Sweden)

    Kazuma Ohyashiki

    2016-04-01

    Full Text Available Approximately 40% of chronic myeloid leukemia (CML patients who discontinue imatinib (IM therapy maintain undetectable minimal residual disease (UMRD for more than one year (stopping IM (STOP-IM. To determine a possible biomarker for STOP-IM CML, we examined plasma miRNA expression in CML patients who were able to discontinue IM. We first screened candidate miRNAs in unselected STOP-IM patients, who had sustained UMRD after discontinuing IM for more than six months, in comparison with healthy volunteers, by using a TaqMan low-density array for plasma or exosomes. Exosomal miR-215 and plasma miR-215 were downregulated in the STOP-IM group compared to the control, indicating that the biological relevance of the plasma miR-215 level is equivalent to that of the exosomal level. Next, we performed real-time quantitative RT-PCR in 20 STOP-IM patients, 32 patients with UMRD on continued IM therapy (IM group and 28 healthy volunteers. The plasma miRNA-215 level was significantly downregulated in the STOP-IM group (p < 0.0001; we determined the cut-off level and divided the IM group patients into two groups according to whether the plasma miR-215 was downregulated or not. The IM group patients with a low plasma miR-215 level had a significantly higher total IM intake, compared to the patients with elevated miR-215 levels (p = 0.0229. Functional annotation of miR-215 target genes estimated by the Database for Annotation, Visualization and Integrated Discovery (DAVID bioinformatic tools involved cell cycle, mitosis, DNA repair and cell cycle checkpoint. Our study suggests a possible role of miR-215 in successful IM discontinuation.

  15. In-beam alpha, electron, and gamma-ray spectroscopy of 215Fr

    International Nuclear Information System (INIS)

    Decman, D.J.; Grawe, H.; Kluge, H.; Maier, K.H.; Maj, A.; Menningen, M.; Roy, N.; Wiegner, W.

    1983-01-01

    The nucleus 215 Fr was studied using the 208 Pb( 11 B, 4n) and 204 Hg( 15 N, 4n) reactions. The measurements included α-γ, γ-γ, and e-e coincidence experiments as well as γ-ray and α-particle DPAD studies. The decay scheme gives levels up to a 3068 keV 39/2 - isomer with tsub(1/2)=(33 +- 5) ns as well as 3 shorter-lived isomers (tsub(1/2) approx.= 4 ns); g-factors have been measured for these isomers. The alpha-particle spectroscopy showed the existence of 4 longrange alphas which could be assigned to excited states in 215 Fr. tsub(1/2)( 215 Frsup(gs)) = (86+-5) ns has been remeasured. The negative parity states up to 1680 keV seem to be members of the π(h9/2) 5 9/2sup(ν)(g9/2) 2 configuration; a strong hindrance of M1 transitions is found. The higher lying states are compared with the DIPM model. (orig.)

  16. The XMAP215-family protein DdCP224 is required for cortical interactions of microtubules

    Directory of Open Access Journals (Sweden)

    Hestermann Andrea

    2004-06-01

    Full Text Available Abstract Background Interactions of peripheral microtubule tips with the cell cortex are of crucial importance for nuclear migration, spindle orientation, centrosome positioning and directional cell movement. Microtubule plus end binding proteins are thought to mediate interactions of microtubule tips with cortical actin and membrane proteins in a dynein-dependent manner. XMAP215-family proteins are main regulators of microtubule plus end dynamics but so far they have not been implicated in the interactions of microtubule tips with the cell cortex. Results Here we show that overexpression of an N-terminal fragment of DdCP224, the Dictyostelium XMAP215 homologue, caused a collapse of the radial microtubule cytoskeleton, whereby microtubules lost contact with the cell cortex and were dragged behind like a comet tail of an unusually motile centrosome. This phenotype was indistinguishable from mutants overexpressing fragments of the dynein heavy chain or intermediate chain. Moreover, it was accompanied by dispersal of the Golgi apparatus and reduced cortical localization of the dynein heavy chain indicating a disrupted dynein/dynactin interaction. The interference of DdCP224 with cortical dynein function is strongly supported by the observations that DdCP224 and its N-terminal fragment colocalize with dynein and coimmunoprecipitate with dynein and dynactin. Conclusions Our data show that XMAP215-like proteins are required for the interaction of microtubule plus ends with the cell cortex in interphase cells and strongly suggest that this function is mediated by dynein.

  17. Analysis of ~21.5 d Period in Ionospheric and Solar Indices during 2011

    Directory of Open Access Journals (Sweden)

    YAO Yibin

    2017-01-01

    Full Text Available By using Fourier transform, the spectrum of total electron content(TEC data, relative sunspot number(RSSN, solar extreme ultraviolet(EUV flux in 0.1~50 nm and 26~34 nm were performed to study the ~27 d period in solar-terrestrial environment. A~21.5 d period was found in TEC and solar indices, while geomagnetic indices showed no sign of this period. We infer that the ~21.5 d period could combined effects of solar rotation and active region evolution. Results of the past few solar cycles show that 21~23 d of quasi-periodic signal will appear in the rising phase of a solar cycle. Using the solar active regions located in the[-10°, 10°] slice, it is further confirmed that the ~21.5 d period observed in 2011 may be caused by the joint effects of solar active region complex and solar rotation. GIM data were used to study the global distribution of the ~27 d period oscillation.

  18. 75 FR 17156 - Gulf of Mexico, Outer Continental Shelf, Western Planning Area, Oil and Gas Lease Sale 215 (2010...

    Science.gov (United States)

    2010-04-05

    ... Area (WPA) (Lease Sale 215) scheduled for August 2010. The preparation of this EA is an important step.../nepa/nepaprocess.html . Dated: March 31, 2010. Chris C. Oynes, Associate Director for Offshore Minerals...

  19. Oxidative stress and mitochondrial functions in the intestinal Caco-2/15 cell line.

    Directory of Open Access Journals (Sweden)

    Rame Taha

    2010-07-01

    Full Text Available Although mitochondrial dysfunction and oxidative stress are central mechanisms in various pathological conditions, they have not been extensively studied in the gastrointestinal tract, which is known to be constantly exposed to luminal oxidants from ingested foods. Key among these is the simultaneous consumption of iron salts and ascorbic acid, which can cause oxidative damage to biomolecules.The objective of the present work was to evaluate how iron-ascorbate (FE/ASC-mediated lipid peroxidation affects mitochondrion functioning in Caco-2/15 cells. Our results show that treatment of Caco-2/15 cells with FE/ASC (0.2 mM/2 mM (1 increased malondialdehyde levels assessed by HPLC; (2 reduced ATP production noted by luminescence assay; (3 provoked dysregulation of mitochondrial calcium homeostasis as evidenced by confocal fluorescence microscopy; (4 upregulated the protein expression of cytochrome C and apoptotic inducing factor, indicating exaggerated apoptosis; (5 affected mitochondrial respiratory chain complexes I, II, III and IV; (6 elicited mtDNA lesions as illustrated by the raised levels of 8-OHdG; (7 lowered DNA glycosylase, one of the first lines of defense against 8-OHdG mutagenicity; and (8 altered the gene expression and protein mass of mitochondrial transcription factors (mtTFA, mtTFB1, mtTFB2 without any effects on RNA Polymerase. The presence of the powerful antioxidant BHT (50 microM prevented the occurrence of oxidative stress and most of the mitochondrial abnormalities.Collectively, our findings indicate that acute exposure of Caco-2/15 cells to FE/ASC-catalyzed peroxidation produces harmful effects on mitochondrial functions and DNA integrity, which are abrogated by the powerful exogenous BHT antioxidant. Functional derangements of mitochondria may have implications in oxidative stress-related disorders such as inflammatory bowel diseases.

  20. Stem cell factor and interleukin-2/15 combine to enhance MAPK-mediated proliferation of human natural killer cells

    Science.gov (United States)

    Benson, Don M.; Yu, Jianhua; Becknell, Brian; Wei, Min; Freud, Aharon G.; Ferketich, Amy K.; Trotta, Rossana; Perrotti, Danilo; Briesewitz, Roger

    2009-01-01

    Stem cell factor (SCF) promotes synergistic cellular proliferation in combination with several growth factors, and appears important for normal natural killer (NK)–cell development. CD34+ hematopoietic precursor cells (HPCs) require interleukin-15 (IL-15) for differentiation into human NK cells, and this effect can be mimicked by IL-2. Culture of CD34+ HPCs or some primary human NK cells in IL-2/15 and SCF results in enhanced growth compared with either cytokine alone. The molecular mechanisms responsible for this are unknown and were investigated in the present work. Activation of NK cells by IL-2/15 increases expression of c-kit whose kinase activity is required for synergy with IL-2/15 signaling. Mitogen-activated protein kinase (MAPK) signaling intermediaries that are activated both by SCF and IL-2/15 are enhanced in combination to facilitate earlier cell-cycle entry. The effect results at least in part via enhanced MAPK-mediated modulation of p27 and CDK4. Collectively the data reveal a novel mechanism by which SCF enhances cellular proliferation in combination with IL-2/15 in primary human NK cells. PMID:19060242

  1. Towards the ictalurid catfish transcriptome: generation and analysis of 31,215 catfish ESTs

    Directory of Open Access Journals (Sweden)

    Dunham Rex

    2007-06-01

    Full Text Available Abstract Background EST sequencing is one of the most efficient means for gene discovery and molecular marker development, and can be additionally utilized in both comparative genome analysis and evaluation of gene duplications. While much progress has been made in catfish genomics, large-scale EST resources have been lacking. The objectives of this project were to construct primary cDNA libraries, to conduct initial EST sequencing to generate catfish EST resources, and to obtain baseline information about highly expressed genes in various catfish organs to provide a guide for the production of normalized and subtracted cDNA libraries for large-scale transcriptome analysis in catfish. Results A total of 17 cDNA libraries were constructed including 12 from channel catfish (Ictalurus punctatus and 5 from blue catfish (I. furcatus. A total of 31,215 ESTs, with average length of 778 bp, were generated including 20,451 from the channel catfish and 10,764 from blue catfish. Cluster analysis indicated that 73% of channel catfish and 67% of blue catfish ESTs were unique within the project. Over 53% and 50% of the channel catfish and blue catfish ESTs, respectively, had significant similarities to known genes. All ESTs have been deposited in GenBank. Evaluation of the catfish EST resources demonstrated their potential for molecular marker development, comparative genome analysis, and evaluation of ancient and recent gene duplications. Subtraction of abundantly expressed genes in a variety of catfish tissues, identified here, will allow the production of low-redundancy libraries for in-depth sequencing. Conclusion The sequencing of 31,215 ESTs from channel catfish and blue catfish has significantly increased the EST resources in catfish. The EST resources should provide the potential for microarray development, polymorphic marker identification, mapping, and comparative genome analysis.

  2. 47 CFR 68.215 - Installation of other than “fully protected” system premises wiring that serves more than four...

    Science.gov (United States)

    2010-10-01

    ... system premises wiring that serves more than four subscriber access lines. 68.215 Section 68.215... other than “fully protected” system premises wiring that serves more than four subscriber access lines. (a) Types of wiring authorized—(1) Between equipment entities. Unprotected premises wiring, and...

  3. Temporal dynamics of cortical and subcortical responses to apomorphine in Parkinson disease: an H2(15)O PET study

    NARCIS (Netherlands)

    Hosey, Lara A.; Thompson, Jennifer L. W.; Metman, Leonard Verhagen; van den Munckhof, Pepyn; Braun, Allen R.

    2005-01-01

    H2(15)O positron emission tomography (PET) was used to study the temporal course of central nervous system (CNS) responses to apomorphine in patients with idiopathic Parkinson disease (PD). Agonist-induced changes in regional cerebral blood flow (rCBF) were evaluated within

  4. Zum 215. Gebutstag von Admiral Ferdinand Baron von Wrangell : (29. Dezember 1797 - 25. 25. Mai 1870) / Peter Krienitz

    Index Scriptorium Estoniae

    Krienitz, Peter

    2012-01-01

    Admiral Ferdinand Baron von Wrangellist tema 215. sünniaastapäeva puhul. Silmapaistavast Kirde-Siberi uurijast. Tema poliitilisest tegevusest ja elust Roela mõisas. Ferdinand Baroni poolt seatud viisil tähistati jõulusid Roelas kuni 1944. aasta lõpuni.

  5. 48 CFR 1452.215-71 - Use and Disclosure of Proposal Information-Department of the Interior.

    Science.gov (United States)

    2010-10-01

    ... Text of Provisions and Clauses 1452.215-71 Use and Disclosure of Proposal Information—Department of the... trade commodities. (2) “Confidential commercial or financial information” means any business information... information contained in proposals include exemption (4), which covers “commercial and financial information...

  6. 48 CFR 852.215-70 - Service-disabled veteran-owned and veteran-owned small business evaluation factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Service-disabled veteran... CONTRACT CLAUSES Texts of Provisions and Clauses 852.215-70 Service-disabled veteran-owned and veteran...: Service-Disabled Veteran-Owned and Veteran-Owned Small Business Evaluation Factors (DEC 2009) (a) In an...

  7. 8 CFR 215.8 - Requirements for biometric identifiers from aliens on departure from the United States.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Requirements for biometric identifiers from... HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.8 Requirements for biometric identifiers from aliens on departure from the United States. (a)(1) The Secretary of...

  8. Human immunodeficiency virus fitness in vivo: calculations based on a single zidovudine resistance mutation at codon 215 of reverse transcriptase

    NARCIS (Netherlands)

    Goudsmit, J.; de Ronde, A.; Ho, D. D.; Perelson, A. S.

    1996-01-01

    We monitored a subject newly infected with a zidovudine-resistant human immunodeficiency virus type 1 strain and found that in the absence of drug, the viral population with the resistance-conferring tyrosine (TAC) codon 215 of reverse transcriptase was gradually replaced. By using standard formulas

  9. Nonlinear competition between the whistler and Alfven firehoses. Journal of Geophysical Research, 106, 13,215, 2001

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Matsumoto, H.

    2001-01-01

    Roč. 106, - (2001), s. 13,215-13,224 ISSN 0148-0227 R&D Projects: GA AV ČR IAB3042106 Institutional research plan: CEZ:AV0Z3042911 Keywords : instability * whistler * Alfven wave Subject RIV: BE - Theoretical Physics Impact factor: 2.609, year: 2001

  10. Autoguía para el telescopio 2,15 mts de CASLEO

    Science.gov (United States)

    Aballay, J. A.; Casagrande, A. R.; Pereyra, P. F.; Marún, A. H.

    Se está desarrollando un sistema de autoguía para el telescopio de 2,15 mts. El mismo se realizará aprovechando el Offset Guider. Al ocular móvil de éste se vinculará alguna cámara digital (ST4-ST7-CH250) para lograr la visión del objeto. El funcionamiento del equipo será el siguiente: primero, dadas las coordenadas del objeto a observar, se tomarán las coordenadas del telescopio para que, a través de una base de datos, se determine un campo de objetos que sirvan para la cámara de visión, luego, la PC obtendrá el offset entre la estrella de observación y la estrella seleccionada como guía, este valor será trasladado a los motores que posicionarán en forma automática el ocular. Una vez que la estrella es visualizada en la cámara (monitor de PC ) se correrá el programa que guiará el telescopio automáticamente.

  11. A Dwarf Planet Class Object in the 21:5 Resonance with Neptune

    Science.gov (United States)

    Holman, Matthew J.; Payne, Matthew J.; Fraser, Wesley; Lacerda, Pedro; Bannister, Michele T.; Lackner, Michael; Chen, Ying-Tung; Lin, Hsing Wen; Smith, Kenneth W.; Kokotanekova, Rosita; Young, David; Chambers, K.; Chastel, S.; Denneau, L.; Fitzsimmons, A.; Flewelling, H.; Grav, Tommy; Huber, M.; Induni, Nick; Kudritzki, Rolf-Peter; Krolewski, Alex; Jedicke, R.; Kaiser, N.; Lilly, E.; Magnier, E.; Mark, Zachary; Meech, K. J.; Micheli, M.; Murray, Daniel; Parker, Alex; Protopapas, Pavlos; Ragozzine, Darin; Veres, Peter; Wainscoat, R.; Waters, C.; Weryk, R.

    2018-03-01

    We report the discovery of an H r = 3.4 ± 0.1 dwarf planet candidate by the Pan-STARRS Outer Solar System Survey. 2010 JO179 is red with (g ‑ r) = 0.88 ± 0.21, roughly round, and slowly rotating, with a period of 30.6 hr. Estimates of its albedo imply a diameter of 600–900 km. Observations sampling the span between 2005 and 2016 provide an exceptionally well determined orbit for 2010 JO179, with a semimajor axis of 78.307 ± 0.009 au; distant orbits known to this precision are rare. We find that 2010 JO179 librates securely within the 21:5 mean-motion resonance with Neptune on 100 Myr timescales, joining the small but growing set of known distant dwarf planets on metastable resonant orbits. These imply a substantial trans-Neptunian population that shifts between stability in high-order resonances, the detached population, and the eroding population of the scattering disk.

  12. Biopsy of human morula-stage embryos: outcome of 215 IVF/ICSI cycles with PGS.

    Directory of Open Access Journals (Sweden)

    Elena E Zakharova

    Full Text Available Preimplantation genetic diagnosis (PGD is commonly performed on biopsies from 6-8-cell-stage embryos or blastocyst trophectoderm obtained on day 3 or 5, respectively. Day 4 human embryos at the morula stage were successfully biopsied. Biopsy was performed on 709 morulae from 215 ICSI cycles with preimplantation genetic screening (PGS, and 3-7 cells were obtained from each embryo. The most common vital aneuploidies (chromosomes X/Y, 21 were screened by fluorescence in situ hybridization (FISH. No aneuploidy was observed in 72.7% of embryos, 91% of those developed to blastocysts. Embryos were transferred on days 5-6. Clinical pregnancy was obtained in 32.8% of cases, and 60 babies were born. Patients who underwent ICSI/PGS treatment were compared with those who underwent standard ICSI treatment by examining the percentage of blastocysts, pregnancy rate, gestational length, birth height and weight. No significant differences in these parameters were observed between the groups. Day 4 biopsy procedure does not adversely affect embryo development in vitro or in vivo. The increased number of cells obtained by biopsy of morulae might facilitate diagnostic screening. There is enough time after biopsy to obtain PGD results for embryo transfer on day 5-6 in the current IVF cycle.

  13. Foco Nasmyth para el telescopio 2,15mts. de CASLEO

    Science.gov (United States)

    Casagrande, A. R.

    En principio, este proyecto intenta lograr el mayor aprovechamiento posible del instrumental que se dispone, buscando la manera de optimizar y hacer más eficiente el servicio que brinda el CASLEO a la comunidad astronómica. El mismo consiste en utilizar dispositivos ya existentes en el telescopio, y darle una utilidad. Tal es el caso del camino óptico destinado al foco Coude. Si tenemos en cuenta que disponemos de un tercer espejo Coude, con todos sus mecanismos automatizados, (actualmente sin uso), una distancia apropiada del plano focal, el espacio y el lugar físico necesario para instalar un periférico, es posible la habilitación de un foco Nasmyth en el telescopio 2,15mts. El hecho de contar con este nuevo foco, redundará en importantes beneficios. En primer lugar, posibilitará la observación, casi simultánea, con dos instrumentos. Otro aspecto a tener en cuenta, es que disminuirá el frecuente cambio del instrumental periférico, motivo este que degrada su ideal puesta a punto. Por último, también de interés, es de destacar su escaso costo de ejecución.

  14. Enkele gedagtes oor Matteus se gebruikmaking van die Ou Testament in Matteus 2:15

    Directory of Open Access Journals (Sweden)

    A. B. du Toit

    1986-01-01

    Full Text Available Some thoughts on Matthew's usage of the Old Testament in Matthew 2:15 To make general statements on Old Testament quotations in the New is extremely hazardous. Therefore one citation only is pinpointed. The micro-context of Matthew's citation of Hosea 11:1 shows that a very close relationship between Jesus and Israel is established and that the sojourn in Egypt is doubly divinely sanctioned. An analysis of the quotation within the wider gospel context not only confirms this but also shows that Matthew uses it in a very sophisticated way. He intends 'theologizing' Jesus' childhood movements, showing them to be part of God's plan for his Messiah. This may also have an apologetic undertone. The quotation is in another sense christologically important: It forms part of a chain of Christological pronouncements. Jesus' identity can, however, only be revealed by God himself. We cannot endorse Matthew's usage of the Old Testament quotation in Hosea 11:1, but we can appreciate how he came to his understanding of it. His association of Jesus with Israel must have played a major role. More information on the Wirkungsgeschichte of this text in Early Judaism would probably have furthered our understanding.

  15. Characterization of acid flux in osteoclasts from patients harboring a G215R mutation in ClC-7

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Neutzsky-Wulff, Anita Vibsig

    2008-01-01

    in the presence of a V-ATPase and a chloride channel inhibitor, using a H(+) and Cl(-) driven approach. Finally, acidification rates in ClC-7 enriched membranes from ADOII osteoclasts and their corresponding controls were compared. Resorption by the G215R osteoclasts was reduced by 60% when measured by both CTX...... mutation in ClC-7 (G215R) were isolated, and used these to investigate bone resorption measured by CTX-I, calcium release and pit scoring. The actin cytoskeleton of the osteoclasts was also investigated. ClC-7 enriched membranes from the osteoclasts were isolated, and used to test acidification rates......-I, calcium release, and pit area when comparing to age and sex matched controls. In addition, the ADOII osteoclasts showed no differences in actin ring formation. Finally, V-ATPase and chloride channel inhibitors completely abrogated the H(+) and Cl(-) driven acidification. Finally, the acid influx...

  16. Safety analysis report for packaging (onsite) for limited type Bmaterial in the CNS 14-215H cask

    International Nuclear Information System (INIS)

    Flanagan, B.D.

    1997-01-01

    The purpose of this Safety Analysis Report for Packaging is to provide the analyses and evaluations necessary to demonstrate that the CNS 14-215H cask provided by Chem-Nuclear Systems Inc. can safety transport greater than Type A quantities of radioactive material on the Hanford Site. The CNS 14-215H cask was chosen for its loading abilities, availability, and because it has a Certificate of Compliance (CoC) issued by the U.S. Nuclear Regulatory Commission (NRC) for transporting low specific activity in quantities greater than Type A material in commerce. Although the CDC does not cover greater than Type A material not meeting LSA requirements, it does allow for an established level of protection in determining the safety of transporting Type B material on the Hanford Site

  17. Neuroligin 2 R215H Mutant Mice Manifest Anxiety, Increased Prepulse Inhibition, and Impaired Spatial Learning and Memory

    Directory of Open Access Journals (Sweden)

    Chia-Hsiang Chen

    2017-11-01

    Full Text Available Neuroligin 2 (NLGN2 is a postsynaptic adhesion protein that plays an essential role in synaptogenesis and function of inhibitory neuron. We previously identified a missense mutation R215H of the NLGN2 in a patient with schizophrenia. This missense mutation was shown to be pathogenic in several cell-based assays. The objective of this study was to better understand the behavioral consequences of this mutation in vivo. We generated a line of transgenic mice carrying this mutation using a recombinant-based method. The mice were subjected to a battery of behavioral tests including open field locomotor activity assay, prepulse inhibition (PPI assay, accelerated rotarod test, novel location and novel recognition tests, elevated plus-maze (EPM test, and Morris water maze test. The transgenic animals were viable and fertile, but the Nlgn2 R215H knock-in (KI homozygous mice showed growth retardation, anxiety-like behavior, increased PPI, and impaired spatial learning and memory. There was no significant interaction between sex and genotype in most behavioral tests; however, we observed a significant interaction between sex and genotype in EPM test in this study. Also, we found that the Nlgn2 R215H homozygous KI mice did not express the NLGN2 protein, resembling Nlgn2 knockout mice. Our results demonstrate that Nlgn2 R215H KI homozygous mice manifest several behavioral abnormalities similar to those found in psychiatric patients carrying NLGN2 mutations, indicating that dysfunction of NLGN2 contributes to the pathogenesis of certain psychiatric symptoms commonly present in various mental disorders, not limited to schizophrenia.

  18. Neuroligin 2 R215H Mutant Mice Manifest Anxiety, Increased Prepulse Inhibition, and Impaired Spatial Learning and Memory.

    Science.gov (United States)

    Chen, Chia-Hsiang; Lee, Pin-Wei; Liao, Hsiao-Mei; Chang, Pi-Kai

    2017-01-01

    Neuroligin 2 ( NLGN2 ) is a postsynaptic adhesion protein that plays an essential role in synaptogenesis and function of inhibitory neuron. We previously identified a missense mutation R215H of the NLGN2 in a patient with schizophrenia. This missense mutation was shown to be pathogenic in several cell-based assays. The objective of this study was to better understand the behavioral consequences of this mutation in vivo . We generated a line of transgenic mice carrying this mutation using a recombinant-based method. The mice were subjected to a battery of behavioral tests including open field locomotor activity assay, prepulse inhibition (PPI) assay, accelerated rotarod test, novel location and novel recognition tests, elevated plus-maze (EPM) test, and Morris water maze test. The transgenic animals were viable and fertile, but the Nlgn2 R215H knock-in (KI) homozygous mice showed growth retardation, anxiety-like behavior, increased PPI, and impaired spatial learning and memory. There was no significant interaction between sex and genotype in most behavioral tests; however, we observed a significant interaction between sex and genotype in EPM test in this study. Also, we found that the Nlgn2 R215H homozygous KI mice did not express the NLGN2 protein, resembling Nlgn2 knockout mice. Our results demonstrate that Nlgn2 R215H KI homozygous mice manifest several behavioral abnormalities similar to those found in psychiatric patients carrying NLGN2 mutations, indicating that dysfunction of NLGN2 contributes to the pathogenesis of certain psychiatric symptoms commonly present in various mental disorders, not limited to schizophrenia.

  19. Road to Grid Parity through Deployment of Low-Cost 21.5% N-Type Si Solar Cells

    Energy Technology Data Exchange (ETDEWEB)

    Velundur, Vijay [Suniva, Norcross, GA (United States)

    2017-04-19

    This project seeks to develop and deploy differentiated 21.5% efficient n-type Si solar cells while reaching the SunShot module cost goal of ≤ $0.50/W. This objective hinges on development of enabling low cost technologies that simplify the manufacturing process and reduce overall processing costs. These comprise of (1) Boron emitter formation and passivation; (2) Simplified processing process for emitter and BSF layers; and (3) Advanced metallization for the front and back contacts.

  20. [Chronic salpingitis and extra-uterine pregnancy. Results of the histologic study of 215 tubal pregnancies].

    Science.gov (United States)

    Dubuisson, J B; Aubriot, F X; Vacher-Lavenu, M C; Pichard, C; Henrion, R

    1987-01-01

    215 women who had tubal pregnancy were treated by total salpingectomy at the University Hospital Port-Royal between the 1st January 1977 and the 30th January 1986. All of these had histological examination of the tube in which the pregnancy occurred. Our series of histological examinations confirms that tubal pregnancy occurs in the great majority of cases in a tube that is already pathological. The responsibility for tubal abnormalities in the occurrence of tubal pregnancy has been suggested by a comparative study of a control series where chronic lesions of the tube were statistically far less frequent (p less than 0.001). Ampullary pregnancy, of which there were 200 cases, was associated in 89.5% of the cases with a pathological condition of the ampulla. Isthmic pregnancy, of which there were 15 cases, would seem to be secondary to a pathology in the isthmus in all cases except one, and is nearly always associated with lesions in the ampulla. Chronic salpingitis was the main histological lesion that was observed. It represented 95.5% of the abnormalities of the ampulla in ampullary pregnancies. In isthmic pregnancies it was found in two-thirds of cases attacking the isthmus, the ampulla or the whole tube. Isthmic salpingitis nodosa was the second lesion that was observed in 40% of isthmic pregnancies. As far as endometriosis is concerned, it is very rare and occurred in only one case. Prevention of tubal pregnancy, therefore, necessarily must lie in preventing tubal infections and sexually transmitted diseases.(ABSTRACT TRUNCATED AT 250 WORDS)

  1. Retrospective analysis of the clinical behavior of oral hairy leukoplakia in 215 HIV-seropositive patients

    Directory of Open Access Journals (Sweden)

    Daniela Assis do VALE

    Full Text Available Abstract Oral manifestations are common findings in human immunodeficiency virus (HIV infected patients and frequently influence the overall health. Oral hairy leukoplakia (OHL is strongly associated with HIV infection demonstrating its relationship with the individual’s immune status and progression of immunosuppression. This study aims to retrospectively evaluate OHL in HIV patients, analyzing its incidence, demographic aspects and possible changes in clinical and epidemiological profile of the disease over 17 years. The records of 1600 HIV-infected patients were reviewed. The data were correlated and analyzed, considering HIV exposure category, age, gender, harmful habits, CD4 level, use and type of antiretroviral. OHL was observed in 215 (13.4% patients. Most were men in the fourth decade of life, 171 (79.5% and 112 (52,1% respectively, but an increase in the incidence of OHL among female patients and those in the fifth decade of life was observed. Tobacco smoking was the most frequent harmful habit reported by 114 (68% patients. OHL occurred mostly in patients with CD4 counts between 200 and 500 cells/mm3 35 (55.5%. The lower incidence of OHL was found among patients using at least one non-nucleoside reverse transcriptase inhibitor (NNRTI. OHL is related to CD4 count, use of ARVT and tobacco smoking and is also more prevalent in men in the fourth decade of life. These characteristics were recognized in absolute values, but when verifying the behavior over the years we noticed that the incidence of OHL is decreasing and its epidemiological characteristics changing.

  2. ARCON: experience in 215 patients with advanced head-and-neck cancer

    International Nuclear Information System (INIS)

    Kaanders, Johannes H.A.M.; Pop, Lucas; Marres, Henri; Bruaset, Ingolv; Hoogen, Franciscus J.A. van den; Merkx, Matthijs A.W.; Kogel, Albert J. van der

    2002-01-01

    Purpose: 'ARCON' combines accelerated radiotherapy to counteract tumor repopulation with carbogen breathing and nicotinamide to reduce chronic and acute hypoxia. The aim of this Phase II study was to assess the feasibility, toxicity, and potential effectiveness of ARCON for advanced head-and-neck cancer. Methods and Materials: The study included 215 patients with head-and-neck carcinoma distributed as follows: larynx, n = 100; hypopharynx, n=50; oropharynx, n=52; oral cavity, n=13; Stage II, n=8, Stage III, n=71, and Stage IV, n=136. Accelerated radiotherapy was given to a total dose of 64-68 Gy in 2-Gy fractions within 36-38 days. This was combined with carbogen breathing during irradiation and administration of nicotinamide (60-80 mg/kg) 1-1.5 h before irradiation. Results: There was full compliance with carbogen breathing in 88% of the patients. A nicotinamide dose of 80 mg/kg produced severe nausea and vomiting, necessitating discontinuation of the drug, in 31% of the patients. Adjustment of the dose to 60 mg/kg and antiemesis prophylaxis reduced the discontinuation rate to 10%. Confluent mucositis was observed in 91% of the patients with a median duration of 6 weeks. Grade 4 late complications occurred in 5% of the patients. The actuarial 3-year local control rates were 80% for larynx, 69% for hypopharynx, 88% for oropharynx, and 37% for oral cavity tumors. For T3-4 tumors, the local control rates were 80% for larynx, 60% for hypopharynx, 87% for oropharynx, and 29% for oral cavity. Regional control rates were 100% for N0, 93% for N1, and 74% for N2 disease. Conclusion: ARCON yields high local and regional control rates in advanced head-and-neck carcinomas, and compliance is satisfactory and morbidity acceptable. The local control rate of 80% for T3 and T4 larynx carcinomas offers excellent possibilities for organ preservation

  3. Amiodarone-induced thyroid dysfunction--clinical picture. Study on 215 cases.

    Science.gov (United States)

    Preda, Cristina; Aprotosoaie, Ana Clara; Petris, A; Costache, Irina Iuliana

    2014-01-01

    The purpose of this study was to investigate the prevalence and the clinical-evolutionary implications of thyroid damage in patients treated with amiodarone in the Cardiology Clinic of the "Sf. Spiridon" University Hospital of Iasi. The study included a group of 215 patients, 90 men and 125 women with ages between 35 and 87, hospitalized in the Cardiology Clinic between 2004 and 2014, who received amiodarone treatment, in most cases for the prophylaxis of various arrhythmias, both supra-ventricular and ventricular. In 27.80% of the patients, the assessment of the thyroid function was imposed by the appearance of the clinical picture characteristic for hypo- and hyperthyroidism, and for 72.19% it was carried out as a routine examination. Amiodarone-induced hypothyroidism was clinically diagnosed in 20.85% of the patients. Hyperthyroidism occurring during treatment with Cordarone was found in 6.95% of the patients. The confirmation of the diagnosis of amiodarone-induced thyroid dysfunction was based on hormonal dosages (TSH, FT4 and even FT3 in some cases), on the endocrinological clinical consultation and on the imaging study--i.e. thyroid echography. Amiodarone-induced thyroid dysfunction is relatively rare compared to the number of patients treated with this anti-arrhythmic drug (27.8%) from the group under study. Thyroid dysfunction, regardless of the type (with hypo or hyper-function), represents a negative element in the evolution of patients with pre-existing heart diseases, not only by aggravating the clinical picture of the basic illness, but also by the necessity of permanently reviewing the therapeutic scheme imposed also by the association of thyroid dysfunction medication, according to case.

  4. Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Fabao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); You, Xiaona [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Chi, Xiumei [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Wang, Tao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Ye, Lihong [Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); Niu, Junqi, E-mail: junqiniu@yahoo.com.cn [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Zhang, Xiaodong, E-mail: zhangxd@nankai.edu.cn [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China)

    2014-02-07

    Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells.

  5. Growth, physicochemical properties, and morphogenesis of Chinese wild-type PRV Fa and its gene-deleted mutant strain PRV SA215

    Directory of Open Access Journals (Sweden)

    Tang Shanhu

    2011-06-01

    Full Text Available Abstract Background PRV Fa is common in China and causes most of the pseudorabies in the pig industry. A PRV SA215 strain with deleted gE, gI, and TK genes was constructed to develop a commercial attenuated live vaccine. However, the physicochemical properties, growth pattern, penetration kinetics, and morphogenesis of the PRV SA215 and its parental PRV Fa strain are unclear. Results A series of experiments were conducted to characterize both strains and provide more information. PRV Fa and PRV SA215 were found to have similar penetration patterns, with about 5 min half-time of penetration. The SA215 strain exhibited a slight delay in entry compared with PRV Fa. In the one-step growth test, the titers of the SA215 strain were first detected at 8 h, rapidly increased, and peaked at 12 h. A plateau was formed between 12-36 h of culturing. PRV SA215 showed delayed replication and approximately 10-30-fold lower titers during 0-16 h of culturing compared with the PRV-Fa strain. After 16 h, the PRV Fa titers dramatically decreased, whereas those of PRV SA215 were prolonged to 36 h and reached a titer value equal to that of PRV Fa and then decreased. Both strains were sensitive to both heat and acid-alkali treatments; however, PRV Fa was relatively more stable to heat treatment than PRV SA215. Both strains could propagate in the cultures with pH values from 5.0 to 9.0. Cultures with pH below 3.0 or above 11.0 were fatal to both strains. Both strains had considerable resistance to freeze-thawing treatments. Morphogenetic investigations showed that typical phases in the maturation pathway were observed in the PRV Fa-infected PK15 cells, whereas secondary envelopment was not observed in the PRV SA215 strain. Instead, capsid aggregations with concomitants of electrodense materials were observed. Conclusions These results suggest that PRV SA215 is a promising strain for vaccine development

  6. Cámara CCD Directa con el Telescopio de 2.15 m del CASLEO: algunos diagnósticos

    Science.gov (United States)

    Cellone, S. A.

    Se efectuaron algunas pruebas con la cámara CCD (+ Reductor Focal) instalada en el foco Cassegrain del Telescopio de 2.15 m del Complejo Astronómico El Leoncito (CASLEO). Las conclusiones más significativas son: Los tiempos de exposición efectivos difieren de los nominales en una fracción apreciable de segundo. En exposiciones de menos de 3 segundos, la iluminación no es pareja en todo el detector. En consecuencia, se recomiendan los pasos a seguir por los astrónomos tanto durante la observación como en la reducción de sus datos.

  7. A phase I, randomized, single-dose study evaluating the pharmacokinetic equivalence of biosimilar ABP 215 and bevacizumab in healthy adult men.

    Science.gov (United States)

    Markus, Richard; Chow, Vincent; Pan, Zhiying; Hanes, Vladimir

    2017-10-01

    This study compared the pharmacokinetic (PK) profiles of the proposed biosimilar ABP 215 with bevacizumab in healthy males. In this randomized, single-blind, single-dose, three-arm, parallel-group study, healthy subjects were randomized to receive ABP 215 (n = 68), bevacizumab (US) (n = 67), or bevacizumab (EU) (n = 67) 3 mg/kg intravenously. Primary endpoints were area under the serum concentration-time curve from time 0 extrapolated to infinity (AUC inf ) and the maximum observed concentration (C max ). Secondary endpoints included safety and immunogenicity. AUC inf and C max were similar across the three groups. Geometric means ratio (GMR) for C max and AUC inf , respectively, was 0.98 and 0.99 for ABP 215 versus bevacizumab (US); 1.03 and 0.96 for ABP 215 versus bevacizumab (EU); and 1.05 and 0.97 for bevacizumab (US) versus bevacizumab (EU). The 90% confidence intervals for the GMRs of AUC inf and C max were within the prespecified standard PK bioequivalence criteria of 0.80 to 1.25. The incidence of adverse events (AEs) was 47.1, 32.8, and 61.2% in the ABP 215, bevacizumab (US) and bevacizumab (EU) groups, respectively. When analyzed by investigational site, the incidence and severity of AEs were comparable in the ABP 215 and bevacizumab groups. There were no AEs leading to study discontinuation. No binding or neutralizing anti-drug anti-bodies was detected. This study demonstrated the PK similarity of ABP 215 to both bevacizumab (US) and bevacizumab (EU), and of bevacizumab (US) to bevacizumab (EU). Safety and tolerability were comparable between treatments and no subject developed binding or neutralizing anti-drug anti-bodies.

  8. Limited ability of humoral immune responses in control of viremia during infection with SIVsmmD215 strain

    Energy Technology Data Exchange (ETDEWEB)

    Ribiero, Ruy M [Los Alamos National Laboratory

    2009-01-01

    To investigate the impact of humoral immunity on SIV replication, 11 rhesus macaques (RMs) were inoculated with the neutralization-sensitive strain SIVsmmD215. Seven RMs were treated every three weeks, with 50 mglkg of an anti-CD20 antibody (Rituxan, gift from Genentech) starting from day -7 p.i., as follows: four RMs were treated for two months, and three were treated for five months. The remaining four RMs were used as controls. Three RMs were completely depleted of CD20 cells. Four RMs only partially depleted CD20 cells in the LNs and intestine. The efficacy of tissue CD20 depletion predicted the ablation of antibody production, with SIVsmm seroconversion being delayed in the animals with complete tissue CD20 depletion, and neutralizing antibody production being significantly delayed and at low levels in all CD20-depleted RMs. There was no significant difference in acute or chronic VLs between CD20-depleted RMs and control monkeys, with a tendency for lower set-point VLs in CD20-depleted RMs. At 6 weeks p.i., cellular immune responses were significantly stronger in CD20 depleted RMs than in controls. After two years p.i., there was no significant difference in survival between CD20-depleted and control RMs. We concluded that CD20 depletion plays no significant role in the control of SIV replication or disease progression in SIVsmmD215-infected RMs.

  9. Ten-eleven translocation 1 (TET1) gene is a potential target of miR-21-5p in human colorectal cancer.

    Science.gov (United States)

    Cheng, Ya-Wen; Chou, Chia-Jung; Yang, Pei-Ming

    2018-03-01

    DNA 5-methylcytosine (5-mC) methylation, a key epigenetic mark, is critical for biological and pathological processes. Aberrant DNA methylation occurs in all tumor types and correlates with tumor suppressor gene silencing. DNA methylation is thought to be very stable, and active DNA demethylation remains a long-standing enigma. Recently, the ten-eleven translocation (TET) family of oxygenases are found to oxidize 5-mC to 5-hydroxymethylcytosine (5-hmC), which is prerequisite for active DNA demethylation. Both TET1 expression and global 5-hmC content are significantly reduced in colorectal cancer (CRC), the top leading cause of cancer-related death in the world. However, the involving molecular mechanisms are still unclear. The oncogenic microRNA (miRNA) miR-21-5p has recently identified as a diagnostic and prognostic biomarker in CRC. In this study, TET1 was predicted as a novel target of miR-21-5p by using a web-based predictive software starBase v2.0. We found that the 3'-UTR region of TET1 gene contains a miR-21-5p-binding site. Examination of tumor tissues from CRC patients found that loss of TET1 was associated with the progression of CRC to advance stages. In addition, negative correlation of miR-21-5p and TET1 expression was also observed. Transfection of the synthetic miR-21-5p mimic or inhibitor into the colorectal cancer cells could inhibit or increase the TET1-3'-UTR luciferase activity, respectively. Our results demonstrate that TET1 is a potential target of miR-21-5p in CRC. Copyright © 2018 Elsevier Ltd. All rights reserved.

  10. Modulation of Pulmonary Vascular Remodeling in Hypoxia: Role of 15-LOX-2/15-HETE-MAPKs Pathway

    Directory of Open Access Journals (Sweden)

    Xiufeng Yu

    2015-04-01

    Full Text Available Background: We have previously shown that 15-hydroxyeicosatetraenoic acid (15-HETE plays a critical role in pulmonary hypertension (PH-associated vascular remodeling. However, the signaling mechanisms remain unclear. The purpose of this study was to investigate the role of 15-lipoxygenase-2 (15-LO-2/15-HETE-mitogen-activated protein kinases (MAPKs pathway in hypoxia-induced pulmonary vascular remodeling and the underlying mechanisms. Methods: The arterial wall thickness was measured by hematoxylin and eosin (HE staining in distal pulmonary arteries isolated from normal and PAH patient-derived lungs. The protein expression of phosphorylated extracellular signal-regulated kinase (p-ERK and phosphorylated p38 mitogen-activated protein kinases (p-p38MAPK were measured by Western blot in the lungs of PAH patients and hypoxia-induced rats. The apoptosis of cultured rat pulmonary arterial smooth muscle cells (PASMCs was determined by Terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL and Flow cytometry. The cell proliferation and cell cycle in PASMCs following hypoxia were analyzed by bromodeoxyuridine incorporation and flow cytometry, respectively. Results: Our results showed that the levels of p-ERK and p-p38MAPK were both drastically elevated in lungs from human patients and hypoxic rats. The HE staining revealed that the medial wall thickness was higher in patients with PAH than normal humans. In cultured PASMCs, Hypoxia stimulated the cell proliferation, the cell cycle progression, and subsequently promoted cell differentiation and cell migration leading to the suppressed cell apoptosis. Furthermore, MAPKs- induced cell proliferation and anti-apoptosis in PASMCs is 15-LO-2/15HETE activation-dependent. Conclusion: Our study indicates that hypoxia-induced pulmonary vascular remodeling is associated with increased levels of 15-LO-2 and 15-HETE. 15-LO-2/15-HETE stimulates the cell proliferation and anti-apoptosis in PASMCs through

  11. Further investigations at the Naigani Lapita site (VL 21/5), Fiji : excavation, radiocarbon dating and palaeofaunal extinction

    International Nuclear Information System (INIS)

    Irwin, G.; Worthy, T.H.; Best, S.; Hawkins, S.; Carpenter, J.; Matararaba, S.

    2011-01-01

    This paper brings up-to-date a report by S. Best of initial excavations at Naigani in 1981. The results of subsequent fieldwork in 2000 include the excavation and dating of Lapita-age ovens associated with early settlement and extinct palaeofauna. These include the giant megapode (Megavitiornis altirostris), a species of Ducula pigeon, the giant iguana (Lapitiguana impensa), and probably the endemic crocodile (Volia athollandersoni). The Lapita site of VL 21/5 dates from 900 BC and represents an initial colonising settlement within the Fiji Islands. The period of occupation ended around 750 BC. The significance of Naigani is considered in terms of chronology, ceramic history, economy, extinctions, origins and interactions. (author). 33 refs., 10 figs., 2 tabs.

  12. MiR-21-5p in urinary extracellular vesicles is a novel biomarker of urothelial carcinoma.

    Science.gov (United States)

    Matsuzaki, Kyosuke; Fujita, Kazutoshi; Jingushi, Kentaro; Kawashima, Atsunari; Ujike, Takeshi; Nagahara, Akira; Ueda, Yuko; Tanigawa, Go; Yoshioka, Iwao; Ueda, Koji; Hanayama, Rikinari; Uemura, Motohide; Miyagawa, Yasushi; Tsujikawa, Kazutake; Nonomura, Norio

    2017-04-11

    Extracellular vesicles are lipid bilayer vesicles containing protein, messengerRNA and microRNA. Cancer cell-derived extracellular vesicles may be diagnostic and therapeutic targets. We extracted extracellular vesicles from urine of urothelial carcinoma patients and the control group to identify cancer-specific microRNAs in urinary extracellular vesicles as new biomarkers. microRNA from urinary extracellular vesicles extracted from 6 urothelial carcinoma patients and 3 healthy volunteers was analyzed. We verified candidate microRNAs in an independent cohort of 60 urinary extracellular vesicles samples. To normalize the microRNA expression level in extracellular vesicles, we examined the following in extracellular vesicles: protein concentration, CD9 intensity, amounts of whole miRNAs, RNA U6B small nuclear expression and the creatinine concentration of original urine correlating with the counts of extracted extracellular vesicles measured by the NanoSight™ system. From the microarray results 5 microRNAs overexpressed in urinary extracellular vesicles of urothelial carcinoma patients were identified. Creatinine concentration of original urine correlated most with particle counts of extracellular vesicles, indicating that creatinine could be a new tool for normalizing microRNA expression. MiR-21-5p was the most potent biomarker in urinary extracellular vesicles (sensitivity, 75.0%; specificity, 95.8%) and was also overexpressed in urinary extracellular vesicles from urothelial carcinoma patients with negative urine cytology. For the subgroup with negative urine cytology, the sensitivity was 75.0% and specificity was 95.8%. MiR-21-5p in urinary extracellular vesicles could be a new biomarker of urothelial carcinoma, especially for urothelial carcinoma patients with negative urine cytology.

  13. In-gas laser ionization and spectroscopy of actinium isotopes near the N =126 closed shell

    Science.gov (United States)

    Granados, C.; Creemers, P.; Ferrer, R.; Gaffney, L. P.; Gins, W.; de Groote, R.; Huyse, M.; Kudryavtsev, Yu.; Martínez, Y.; Raeder, S.; Sels, S.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wrzosek-Lipska, K.; Zadvornaya, A.; Barzakh, A. E.; Bastin, B.; Delahaye, P.; Hijazi, L.; Lecesne, N.; Luton, F.; Piot, J.; Savajols, H.; Thomas, J.-C.; Traykov, E.; Beerwerth, R.; Fritzsche, S.; Block, M.; Fléchard, X.; Franchoo, S.; Ghys, L.; Grawe, H.; Heinke, R.; Kron, T.; Naubereit, P.; Wendt, K.; Laatiaoui, M.; Moore, I.; Sonnenschein, V.; Loiselet, M.; Mogilevskiy, E.; Rothe, S.

    2017-11-01

    The in-gas laser ionization and spectroscopy (IGLIS) technique was applied on the Ac-215212 isotopes, produced at the Leuven Isotope Separator On-Line (LISOL) facility by using the in-gas-cell and the in-gas-jet methods. The first application under on-line conditions of the in-gas-jet laser spectroscopy method showed a superior performance in terms of selectivity, spectral resolution, and efficiency in comparison with the in-gas-cell method. Following the analysis of both experiments, the magnetic-dipole moments for the Ac-215212 isotopes, electric-quadrupole moments and nuclear spins for the Ac,215214 isotopes are presented and discussed. A good agreement is obtained with large-scale nuclear shell-model calculations by using a 208Pb core.

  14. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    Energy Technology Data Exchange (ETDEWEB)

    Aleissa, Khalid A.; Almasoud, Fahad I.; Islam, Mohammed S. [Atomic Energy Research Institute, King Abdul Aziz City for Science and Technology, P.O. Box 6086, Riyadh 11442 (Saudi Arabia); L' Annunziata, Michael F. [IAEA Expert, Montague Group, P.O. Box 5033, Oceanside, CA 92052-5033 (United States)], E-mail: mlannunziata@cox.net

    2008-12-15

    The activities of {sup 228}Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide {sup 228}Ac. The radium was pre-concentrated on MnO{sub 2} and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter {sup 228}Ra({sup 228}Ac), the daughter nuclide {sup 228}Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by {sup 228}Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9{+-}0.1% was measured for {sup 228}Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317{+-}0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of {sup 228}Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for {sup 228}Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure {sup 228}Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used.

  15. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  16. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  18. XMAP215, XKCM1, NuMA, and cytoplasmic dynein are required for the assembly and organization of the transient microtubule array during the maturation of Xenopus oocytes.

    Science.gov (United States)

    Becker, Bret E; Romney, S Joshua; Gard, David L

    2003-09-15

    During the maturation of Xenopus oocytes, a transient microtubule array (TMA) is nucleated from a novel MTOC near the base of the germinal vesicle. The MTOC-TMA transports the meiotic chromosomes to the animal cortex, where it serves as the precursor to the first meiotic spindle. To understand more fully the assembly of the MTOC-TMA, we used confocal immunofluorescence microscopy to examine the localization and function of XMAP215, XKCM1, NuMA, and cytoplasmic dynein during oocyte maturation. XMAP215, XKCM1, and NuMA were all localized to the base of the MTOC-TMA and the meiotic spindle. Microinjection of anti-XMAP215 inhibited microtubule (MT) assembly during oocyte maturation, disrupting assembly of the MTOC-TMA and subsequent assembly of the first meiotic spindle. In contrast, microinjection of anti-XKCM1 promoted MT assembly throughout the cytoplasm, disrupting organization of the MTOC-TMA and meiotic spindle. Finally, microinjection of anti-dynein or anti-NuMA disrupted the organization of the MTOC-TMA and subsequent assembly of the meiotic spindles. These results suggest that XMAP215 and XKCM1 act antagonistically to regulate MT assembly and organization during maturation of Xenopus oocytes, and that dynein and NuMA are required for organization of the MTOC-TMA.

  19. XMAP215 polymerase activity is built by combining multiple tubulin-binding TOG domains and a basic lattice-binding region.

    Science.gov (United States)

    Widlund, Per O; Stear, Jeffrey H; Pozniakovsky, Andrei; Zanic, Marija; Reber, Simone; Brouhard, Gary J; Hyman, Anthony A; Howard, Jonathon

    2011-02-15

    XMAP215/Dis1 family proteins positively regulate microtubule growth. Repeats at their N termini, called TOG domains, are important for this function. While TOG domains directly bind tubulin dimers, it is unclear how this interaction translates to polymerase activity. Understanding the functional roles of TOG domains is further complicated by the fact that the number of these domains present in the proteins of different species varies. Here, we take advantage of a recent crystal structure of the third TOG domain from Caenorhabditis elegans, Zyg9, and mutate key residues in each TOG domain of XMAP215 that are predicted to be important for interaction with the tubulin heterodimer. We determined the contributions of the individual TOG domains to microtubule growth. We show that the TOG domains are absolutely required to bind free tubulin and that the domains differentially contribute to XMAP215's overall affinity for free tubulin. The mutants' overall affinity for free tubulin correlates well with polymerase activity. Furthermore, we demonstrate that an additional basic region is important for targeting to the microtubule lattice and is critical for XMAP215 to function at physiological concentrations. Using this information, we have engineered a "bonsai" protein, with two TOG domains and a basic region, that has almost full polymerase activity.

  20. Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.

    Science.gov (United States)

    Pagan, Julia K; Marzio, Antonio; Jones, Mathew J K; Saraf, Anita; Jallepalli, Prasad V; Florens, Laurence; Washburn, Michael P; Pagano, Michele

    2015-01-01

    An intercentrosomal linker keeps a cell's two centrosomes joined together until it is dissolved at the onset of mitosis. A second connection keeps daughter centrioles engaged to their mothers until they lose their orthogonal arrangement at the end of mitosis. Centriole disengagement is required to license centrioles for duplication. We show that the intercentrosomal linker protein Cep68 is degraded in prometaphase through the SCF(βTrCP) (Skp1-Cul1-F-box protein) ubiquitin ligase complex. Cep68 degradation is initiated by PLK1 phosphorylation of Cep68 on Ser 332, allowing recognition by βTrCP. We also found that Cep68 forms a complex with Cep215 (also known as Cdk5Rap2) and PCNT (also known as pericentrin), two PCM (pericentriolar material) proteins involved in centriole engagement. Cep68 and PCNT bind to different pools of Cep215. We propose that Cep68 degradation allows Cep215 removal from the peripheral PCM preventing centriole separation following disengagement, whereas PCNT cleavage mediates Cep215 removal from the core of the PCM to inhibit centriole disengagement and duplication.

  1. Words in melody: an H(2)15O PET study of brain activation during singing and speaking.

    Science.gov (United States)

    Jeffries, K J; Fritz, J B; Braun, A R

    2003-04-15

    We used H(2)15O PET to characterize the interaction of words and melody by comparing brain activity measured while subjects spoke or sang the words to a familiar song. Relative increases in activity during speaking vs singing were observed in the left hemisphere, in classical perisylvian language areas including the posterior superior temporal gyrus, supramarginal gyrus, and frontal operculum, as well as in Rolandic cortices and putamen. Relative increases in activity during singing were observed in the right hemisphere: these were maximal in the right anterior superior temporal gyrus and contiguous portions of the insula; relative increases associated with singing were also detected in the right anterior middle temporal gyrus and superior temporal sulcus, medial and dorsolateral prefrontal cortices, mesial temporal cortices and cerebellum, as well as in Rolandic cortices and nucleus accumbens. These results indicate that the production of words in song is associated with activation of regions within right hemisphere areas that are not mirror-image homologues of left hemisphere perisylvian language areas, and suggest that multiple neural networks may be involved in different aspects of singing. Right hemisphere mechanisms may support the fluency-evoking effects of singing in neurological disorders such as stuttering or aphasia.

  2. Galaxy at a redshift of 3.215 - further studies of the PKS 1614+051 system

    International Nuclear Information System (INIS)

    Djorgovski, S.; Strauss, M.A.; Spinrad, H.; Mccarthy, P.; Perley, R.A.; California Univ., Berkeley; National Radio Astronomy Observatory, Charlottesville, VA)

    1987-01-01

    A narrow-emission-line companion of the quasar PKS 1614+051 was reported earlier as a probable galaxy at a redshift of 3.218, which would have made it by far the most distant galaxy known at the time. New radio and optical imaging, and optical and near-IR spectroscopy of the PKS 1614+051 system is reported here. It is argued that the data support and reinforce the original interpretation of the companion object as a mildly active galaxy, possibly a marginal Seyfert 2. The object has a detectable and marginally resolved optical continuum, but was not detected at radio wavelengths. The ionization state is low, and the emission lines are fairly narrow. The improved redshift for the companion, based on the Ly-alpha line alone, is 3.215 + or - 0.002. New Ly-alpha images show interesting morphology of extended emission-line gas, suggestive of a possible tidal interaction with the neighboring QSO. 24 references

  3. The 21.5-kDa isoform of myelin basic protein has a non-traditional PY-nuclear-localization signal

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Graham S.T.; Seymour, Lauren V. [Molecular and Cellular Biology, University of Guelph, Guelph, Ontario (Canada); Boggs, Joan M. [Molecular Structure and Function, Research Institute, Hospital for Sick Children, and Laboratory Medicine and Pathobiology, University of Toronto, Toronto, Ontario (Canada); Harauz, George, E-mail: gharauz@uoguelph.ca [Molecular and Cellular Biology, University of Guelph, Guelph, Ontario (Canada)

    2012-06-15

    Highlights: Black-Right-Pointing-Pointer Full-length 21.5-kDa MBP isoform is translocated to the nucleus. Black-Right-Pointing-Pointer We hypothesized that the exon-II-encoded sequence contained the NLS. Black-Right-Pointing-Pointer We mutated this sequence in RFP-tagged constructs and transfected N19-cells. Black-Right-Pointing-Pointer Abolition of two key positively-charged residues resulted in loss of nuclear-trafficking. Black-Right-Pointing-Pointer The 21.5-kDa isoform of classic MBP contains a non-traditional PY-NLS. -- Abstract: The predominant 18.5-kDa classic myelin basic protein (MBP) is mainly responsible for compaction of the myelin sheath in the central nervous system, but is multifunctional, having numerous interactions with Ca{sup 2+}-calmodulin, actin, tubulin, and SH3-domains, and can tether these proteins to a lipid membrane in vitro. The full-length 21.5-kDa MBP isoform has an additional 26 residues encoded by exon-II of the classic gene, which causes it to be trafficked to the nucleus of oligodendrocytes (OLGs). We have performed site-directed mutagenesis of selected residues within this segment in red fluorescent protein (RFP)-tagged constructs, which were then transfected into the immortalized N19-OLG cell line to view protein localization using epifluorescence microscopy. We found that 21.5-kDa MBP contains two non-traditional PY-nuclear-localization signals, and that arginine and lysine residues within these motifs were involved in subcellular trafficking of this protein to the nucleus, where it may have functional roles during myelinogenesis.

  4. Myostatin Promotes Interleukin-1β Expression in Rheumatoid Arthritis Synovial Fibroblasts through Inhibition of miR-21-5p

    Directory of Open Access Journals (Sweden)

    Sung-Lin Hu

    2017-12-01

    Full Text Available Rheumatoid arthritis (RA is characterized by the infiltration of a number of pro-inflammatory cytokines into synovial fluid and patients with RA often develop joint destruction and deficits in muscle mass. The growth factor myostatin is a key regulator linking muscle mass and bone structure. We sought to determine whether myostatin regulates rheumatoid synovial fibroblast activity and inflammation in RA. We found that levels of myostatin and interleukin (IL-1β (a key pro-inflammatory cytokine in RA in synovial fluid from RA patients were overexpressed and positively correlated. In in vitro investigations, we found that myostatin dose-dependently regulated IL-1β expression through the ERK, JNK, and AP-1 signal-transduction pathways. Computational analysis confirmed that miR-21-5p directly targets the expression of the 3′ untranslated region (3′ UTR of IL-1β. Treatment of cells with myostatin inhibited miR-21-5p expression and miR-21-5p mimic prevented myostatin-induced enhancement of IL-1β expression, showing an inverse correlation between miR-21-5p and IL-1β expression during myostatin treatment. We also found significantly increased paw swelling in an animal model of collagen-induced arthritis (CIA, compared with controls; immunohistochemistry staining revealed substantially higher levels of myostatin and IL-1β expression in CIA tissue. Our evidence indicates that myostatin regulates IL-1β production. Thus, targeting myostatin may represent a potential therapeutic target for RA.

  5. Characterization of osteoclasts from patients harboring a G215R mutation in ClC-7 causing autosomal dominant osteopetrosis type II

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Schaller, Sophie

    2004-01-01

    Autosomal dominant osteopetrosis II (ADOII) is a relatively benign disorder caused by a missense mutation in the ClCN7 gene. In this study, we characterize the osteoclasts from patients with ADOII, caused by a G215R mutation, and investigate the effect on osteoclast function in vitro. Osteoclasts...... osteoclastogenesis in ADOII osteoclasts. However, the residual activity of the ClC-7 channel in ADOII osteoclasts does not allow sufficient acidification and thereby resorption....

  6. Community-based IEC campaign. TFR has dropped to 2.15 in Binh Thanh District, Ho Chi Minh City.

    Science.gov (United States)

    Nguyen Ngoc Lich

    1995-01-01

    Binh Thanh District of Ho Chin Minh City in 1989 had a crude birth rate (CBR) of 20.3 per 1000 population and an average of 5.5 persons per household. The rate of total fertility (TFR) in the district was one of the highest among the city's 18 districts in 1990. Concerned about these demographics, the Binh Thanh District Committee for Population and Family Planning reviewed the family planning program with the goal of developing a special information, education, and communication (IEC) campaign. The following incentive scheme for sterilization was developed: each poor entrepreneur in need of seed money for new business ventures who allows himself to be sterilized receives dong 120,000 (US$11) from the National Committee for Population and Family Planning and dong 220,000 from the District Committee for Population and Family Planning to buy medicine and supplementary food. An IEC room was established in each commune health center to disseminate the relevant information. The results of the campaign have been positive, with 910 people requesting sterilization in 1994, 34% of whom were male. Over the period January-April 1995, the proportion of male sterilization increased dramatically, such that men accounted for 68% of the 153 people who underwent sterilization. The district now ranks the lowest among the 18 districts with regard to the percentage of couples with three children, the CBR is 15.3/1000, TFR is 2.15, the contraceptive prevalence rate is 68%, and sterilization is the fourth most popular method of contraception (13%) behind the IUD (37%), condom (30%), and oral pill (18.5%).

  7. Resultados del tratamiento de 215 tumores pancreáticos y periampulares en el Hospital "Hermanos Ameijeiras"

    Directory of Open Access Journals (Sweden)

    José Luis González González

    Full Text Available Introducción. el cáncer pancreático es una de las neoplasias más letales, ocupa el quinto lugar en frecuencia en occidente y tiene una supervivencia asociada inferior al 20 % al año y al 3 % a los 5 años. La única posibilidad de curación la brindan intervenciones quirúrgicas de gran envergadura que conllevan una alta tasa de morbilidad y mortalidad. Objetivo: caracterizar a los pacientes según variables demográficas, enfermedades asociadas y manifestaciones clínicas, e identificar estudios de mayor valor para el diagnóstico y la relación entre las variables perioperatorias y la aparición de complicaciones, mortalidad hospitalaria y evolucion posoperatoria. Métodos. se realizó un estudio observacional, longitudinal y prospectivo con pacientes con tumores pancreáticos y periampulares que fueron tratados en el Servicio de Cirugía General del Hospital Clínico Quirúrgico "Hermanos Ameijeiras" entre enero de 2006 y diciembre de 2011. Resultados. hubo un total de 215 pacientes con tumores de páncreas: 178 lesiones periampulares y 37 lesiones del cuerpo y la cola de páncreas. Se resecaron 24 lesiones pancreáticas distales y fueron intervenidos quirúrgicamente 153 pacientes con lesiones periampulares, de las cuales se resecaron 83. Se realizaron 78 pancreatoduodenectomías cefálicas y la localización más frecuente fue la ampolla de Vater (36 pacientes, 50,7 %, seguida de la cabeza del páncreas (26 pacientes, 36,6 %. Hubo complicaciones en el 66,2 % de los pacientes. La mortalidad perioperatoria fue del 4,2 % y la hospitalaria del 23,9 %. Conclusiones. los tumores periampulares fueron más frecuentes entre los 50 y 69 años. La enfermedad asociada más frecuente fue la hipertensión arterial, y la ictericia, el síntoma fundamental. La colangiopancreatografía retrógrada endoscópica fue el examen de mayor sensibilidad. La mortalidad hospitalaria estuvo relacionada con las enfermedades asociadas, el tiempo quirúrgico, la

  8. [Local efficiency of percutaneous radiotherapy in lung cancer. Analysis of 215 repeated bronchoscopies in relation to applied radiation dosage].

    Science.gov (United States)

    Schwegler, N; Vrh, N; Kern, T; Notter, M; Frey, M; Grossenbacher, M; Hausmann, M; Pfenninger, T; Ragaz, A; Schmid, R; Siebenschein, R; Keller, R

    1996-02-01

    During a locoregional radiotherapy with curative attempts of lung cancer patients bronchoscopic examinations with biopsies and/or cytologic lavages were repeated to assess the accuracy of limiting the total dose to 60 Gy. In order of the applied dose macroscopic changements of the endoluminal tumor and microscopic elimination should be made out. The correlation between macro- and microscopical regression should allow a statement about reliability of single results. The clinical course and a conventional thoracic X-ray examination seemed to be a to large-meshed screen to evaluate the effect at the end of therapy. The aim was to improve the criterias of success and to adapt and optimize the radiation dose individually. The prospective, together with the pneumologists, defined treatment concept included the repetition of bronchoscopic evaluations after the application of 60 Gy and 80 Gy. These radiation doses from 60 Gy up to 80 Gy have been given with a shrinking-field technique to the mediastinum and the primary. In order to record statistically the optical tumor changements we were urged to create a so-called bT-score. The structure of this score was orientated towards the periphery of the tracheobronchial tree. Hundred and forty-four patients with endoscopically and histologically verified bronchogenic carcinomas were treated. On the subjects 215 re-bronchoscopies accomplished with biopsies were performed and allowed to analyze the macro- and microscopical behavior under treatment. A histological/cytological elimination of tumor was achieved after 60 Gy in 35.1%, after 80 Gy in 62.3%. Macroscopically no tumor was visible after 60 Gy in 43.6%, after 80 Gy in 82%. A correlation between identical micro- and macroscopical observations was only seen in 61%, respectively in 71%. The escalation of the radiation dose from 60 Gy up to 80 Gy with shrinked fields could increase the local tumor sterilization rate by 1.8 times from 35.1% to 62.3%. The refining and completion

  9. CFTR depletion results in changes in fatty acid composition and promotes lipogenesis in intestinal Caco 2/15 cells.

    Directory of Open Access Journals (Sweden)

    Geneviève Mailhot

    2010-05-01

    Full Text Available Abnormal fatty acid composition (FA in plasma and tissue lipids frequently occurs in homozygous and even in heterozygous carriers of cystic fibrosis transmembrane conductance regulator (CFTR mutations. The mechanism(s underlying these abnormalities remained, however, poorly understood despite the potentially CFTR contributing role.The aim of the present study was to investigate the impact of CFTR depletion on FA uptake, composition and metabolism using the intestinal Caco-2/15 cell line. shRNA-mediated cftr gene silencing induced qualitative and quantitative modifications in FA composition in differentiated enterocytes as determined by gas-liquid chromatography. With the cftr gene disruption, there was a 1,5 fold increase in the total FA amount, largely attributable to monounsaturated and saturated FA compared to controls. The activity of delta-7 desaturase, estimated by the 16:1(n-7/16:0, was significantly higher in knockdown cells and consistent with the striking elevation of the n-7 FA family. When incubated with [14C]-oleic acid, CFTR-depleted cells were capable of quick incorporation and export to the medium concomitantly with the high protein expression of L-FABP known to promote intracellular FA trafficking. Accordingly, lipoprotein vehicles (CM, VLDL, LDL and HDL, isolated from CFTR knockdown cells, exhibited higher levels of radiolabeled FA. Moreover, in the presence of [14C]-acetate, knockdown cells exhibited enhanced secretion of newly synthesized phospholipids, triglycerides, cholesteryl esters and free FA, thereby suggesting a stimulation of the lipogenic pathway. Conformably, gene expression of SREBP-1c, a key lipogenic transcription factor, was increased while protein expression of the phosphorylated and inactive form of acetylCoA carboxylase was reduced, confirming lipogenesis induction. Finally, CFTR-depleted cells exhibited lower gene expression of transcription factors (PPARalpha, LXRalpha, LXRbeta and RXRalpha

  10. Optical band gap demarcation around 2.15 eV depending on preferred orientation growth in red HgI{sub 2} films

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, Pankaj, E-mail: pankajtyagicicdu@gmail.com

    2017-04-01

    Thermally evaporated stoichiometric films of red HgI{sub 2} show preferred orientation growth with either (102) or (002) orientation. The as grown films shows a change from one preferred orientation to another depending on their thickness, open-air heat-treatment and in-situ heat treatment of films. The in-situ heat-treatment of thermally evaporated stoichiometric films of red HgI{sub 2} with preferred growth of (102) orientation shows a gradual linear decrease in film thickness with in-situ heat-treatment temperature. On in-situ heat-treatment above 80 °C, it is found that HgI{sub 2} films become thinner than 900 nm, which are otherwise difficult to grow due to high vapor pressure of HgI{sub 2}. For these films the preferred orientation also changed from (102) to (002). The optical band gap (E{sub g}) also found to increase linearly with in-situ heat-treatment temperature. It is interesting to note that in-situ heat-treated films having (002) orientation had higher values of optical band gap than (102) orientation films. On combining these results with those of as grown and open-air heat-treated red HgI{sub 2} films reported in the literature, it is evident that there exists an optical band gap demarcation around 2.15 eV for red HgI{sub 2} thin films depending on their preferred orientation growth. Films with (102) orientation are found to have optical band gap less than 2.15 eV and those with (002) orientation are found to have optical band gap more than 2.15 eV. This is irrespective of the physical mean of obtaining the preferred orientation. The preferred orientation can be achieved by either physical means such as growing films with higher thickness, heat-treating them for short duration in open air or heat-treating them in-situ.

  11. Investigation of 70SiO2-15CaO-10P2O5-5Na2O Glass Composition for Bone Regeneration Applications

    Directory of Open Access Journals (Sweden)

    Vikas Anand

    2014-11-01

    Full Text Available Glass with the composition 70SiO2-15CaO -10P2O5-5Na2O has been prepared by using sol gel technique. Bioactive behavior of the glass sample has been checked by in vitro study using TRIS simulated body fluid. Bioactive properties of the sample has been analyzed by using XRD, Raman, FE-SEM, EDX and Brunauer Emmett Teller studies. pH study has been conducted to check the non- acidic nature of the glass sample. Drug delivery behavior of the sample has been estimated by using gentamicin as an antibiotic. Reported sample has been found to be potential candidate for bone regeneration applications.

  12. Optimized antimicrobial peptide (Bacitracin) production by immobilized and free cells and of Bacillus Spp GU215 using Wood chips and silicon polymer beads.

    Science.gov (United States)

    Amin, Adnan; Khan, Muhammad Ayaz; Ahmad, Taufeeq

    2013-11-01

    The immobilization of bacillus spp. GU215 on silicon polymer beads, wood chips was performed and antibiotic peptide (bacitracin) production, optimization of parameters were investigated. The immobilized cells presented elevated levels of activity than free cells. The silicon polymer based cells showed widest zones of inhibitions (18mm) in 72 hours and 4% concentration of glucose, PH 8 and 30°C, whereas a marginal decrease in the activity (14mm) was noticed in case of wood chips based immobilization systems and least stable immobilization in 72 hours incubation time, 4% glucose concentration, PH 8 and 30°C. This study illustrates that the silicon polymer based beads facilitate a strong interactions with bacitracin producing cells and render them suitable for excessive and long time production of antibiotic.

  13. Synthesis and cytotoxic activities of novel 2-(1,5-bis(aryl penta-1,4-dien-2-yl benzo[d]thiazol derivatives

    Directory of Open Access Journals (Sweden)

    Betül Şahin

    2016-07-01

    Full Text Available Novel 2-(1,5-bis(arylpenta-1,4-dien-2-ylbenzo[d]thiazol (5a,b and 2-(((1S,2S,E-2-(benzo[d]thiazol-2-yl-1,5-di-arylpent-4-en-1-ylthioaniline (6a,b derivatives were obtained by addition of 2-aminobenzothiol to bis-benzylidinecyclobutanones (3a,b. The structures of the obtained compounds were characterized using the spectroscopic methods (NMR, IR, Elemental Analysis. Compounds 5a,b showed cytotoxic activities against C6 (Rat Brain tumor cells and HeLa (human uterus carcinoma in vitro. ©2016 ACG Publications. All rights reserved.

  14. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  15. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  16. Bismuth-213 and actinium-225 -- generator performance and evolving therapeutic applications of two generator-derived alpha-emitting radioisotopes.

    Science.gov (United States)

    Morgenstern, Alfred; Bruchertseifer, Frank; Apostolidis, Christos

    2012-07-01

    The alpha emitters (225)Ac and (213)Bi are promising therapeutic radionuclides for application in targeted alpha therapy of cancer and infectious diseases. Both alpha emitters are available with high specific activity from established radionuclide generators. Their favourable chemical and physical properties have led to the conduction of a large number of preclinical studies and several clinical trials, demonstrating the feasibility, safety and therapeutic efficacy of targeted alpha therapy with (225)Ac and (213)Bi. This review describes methods for the production of (225)Ac and (213)Bi and gives an overview of (225)Ac/(213)Bi radionuclide generator systems. Selected preclinical studies are highlighted and the current clinical experience with (225)Ac and (213)Bi is summarized.

  17. Structure of the San Bernardino Basin Along Two Seismic Transects: Rialto-Colton Fault to the San Andreas Fault and Along the I-215 Freeway (I-10 to SR30)

    Science.gov (United States)

    Catchings, R.D.; Rymer, M.J.; Goldman, M.R.; Gandhok, G.; Steedman, C.E.

    2008-01-01

    In this report, we present seismic data and acquisition parameters for two seismic profiles acquired in the San Bernardino, California area in May and October 2003. We refer to these seismic profiles as the San Bernardino Regional (SBR) and San Bernardino High-Resolution (SBHR) seismic profiles. We present both un-interpreted and interpreted seismic images so that the structure of the area can independently interpreted by others. We explain the rationale for our interpretations within the text of this report, and in addition, we provide a large body of supporting evidence. The SBR seismic profile extended across the San Bernardino Basin approximately N30?E from the town of Colton to the town of Highland. The data were acquired at night when the signal-to-noise ratios were reasonably good, and for the larger shots, seismic energy propagated across the ~20-km-long array. Tomographic velocity data are available to depths of about 4 km, and low-fold reflection data are available to depths in excess of 5 km. The SBR seismic data reveal an asymmetric, fault-bound basin to about 5 km depth. The SBHR seismic profile trended along the I-215 freeway from its intersection with the Santa Ana River to approximately State Road 30 in San Bernardino. Seismic data acquired along the I-215 freeway provide detailed images, with CDP spacing of approximately 2.5 m along an approximately 8.2-km-long profile; shot and geophone spacing was 5 m. For logistical reasons, the high-resolution (SBHR) seismic data were acquired during daylight hours on the shoulder of the I-215 freeway and within 5 to 10 m of high-traffic volumes, resulting in low signal-to-noise ratios. The limited offset at which refracted first-arrivals could be measured along the SBHR seismic profile limited our measurements of tomographic refraction velocities to relatively shallow (< 150 m) depths. The SBHR reflection data reveal a basin with complex structural details within the upper kilometer. The two seismic profiles

  18. SPECTRUM OF CERVICAL LESIONS IN CIMS, BILASPUR: A 5 YEAR RETROSPECTIVE STUDY OF 215 CASES IN A TERTIARY HOSPITAL OF CENTRAL INDIA

    Directory of Open Access Journals (Sweden)

    Sadhna

    2015-10-01

    Full Text Available BACKGROUND AND OBJEC TIVE: Cancer of the cervix is a leading cause of morbidity and mortality among women W orld W ide. Therefore to curb the disease there is need of awareness of this disease. This study is aimed to categorize the premalignant and malignant lesions at the earliest, to reduce the mortality and morbidity. It also aimed to know the incidence of malignancies at our set up and to calculate distribution of patient in relation to parity and symptoms. DESIGN AND SETTING: Study included 215 patients with complain of white dis charge per vagina, per vaginal bleeding and backache attending the gynecology OPD over a period of 05 years. PATIENT AND METHODS: Patients were subjected to cervical biopsy and biopsies were sent to pathology department. Detailed clinical history, age, age at marriage, parity and socio - economic status was obtained. RESULT: Result were classified histopathological l y as inflammatory lesions 70 cases, polypoidal lesion were 30, LSIL accounted for 32 cases and HSIL were 20 cases and 30 were malignant lesions. U nder malignant category moderately differentiated squamous cell carcinoma was the commonest. Maximum numbers of patients were subjected to cervical biopsies in 3 rd decade of life. Malignancies were common in 3 rd & 4 th decade of life. Most of the cases were of parity 4. CONCLUSION : Tissue biopsy is a valuable diagnostic procedure on which surgeons and radiologists still rely.

  19. Nanopore formation by self-assembly of the model genetically engineered elastin-like polymer [(VPGVG)2(VPGEG)(VPGVG)2]15.

    Science.gov (United States)

    Reguera, Javier; Fahmi, Amir; Moriarty, Philip; Girotti, Alessandra; Rodríguez-Cabello, José Carlos

    2004-10-20

    The self-assembly characteristics of the model genetically engineered elastin-like polymer [(VPGVG)2(VPGEG)(VPGVG)2]15 have been studied in this work. An AFM study of the topology of polymer films deposited from acid and basic solutions on a hydrophobic silicon substrate has been carried out. Under acidic conditions, polymer deposition results in a flat surface with no particular topological features. However, from basic solutions, polymer deposition clearly shows an aperiodic pattern of nanopores ( approximately 70 nm width and separated about 150 nm). This dramatic dependence of film topology on pH is explained in terms of the different polarity of the free gamma-carboxyl group of the glutamic acid. In the carboxylate form, this moiety shows a markedly higher polarity than the rest of the polymer domains and the substrate itself. Under these conditions, the charged carboxylates impede hydrophobic contact with their surroundings, which is the predominant assembly pathway for this type of polymer. The charged domains, along with their hydration sphere, are then segregated from the hydrophobic surroundings giving rise to nanopores.

  20. Regional gastrointestinal transit and pH studied in 215 healthy volunteers using the wireless motility capsule: influence of age, gender, study country and testing protocol.

    Science.gov (United States)

    Wang, Y T; Mohammed, S D; Farmer, A D; Wang, D; Zarate, N; Hobson, A R; Hellström, P M; Semler, J R; Kuo, B; Rao, S S; Hasler, W L; Camilleri, M; Scott, S M

    2015-09-01

    The wireless motility capsule (WMC) offers the ability to investigate luminal gastrointestinal (GI) physiology in a minimally invasive manner. To investigate the effect of testing protocol, gender, age and study country on regional GI transit times and associated pH values using the WMC. Regional GI transit times and pH values were determined in 215 healthy volunteers from USA and Sweden studied using the WMC over a 6.5-year period. The effects of test protocol, gender, age and study country were examined. For GI transit times, testing protocol was associated with differences in gastric emptying time (GET; shorter with protocol 2 (motility capsule ingested immediately after meal) vs. protocol 1 (motility capsule immediately before): median difference: 52 min, P = 0.0063) and colonic transit time (CTT; longer with protocol 2: median 140 min, P = 0.0189), but had no overall effect on whole gut transit time. Females had longer GET (by median 17 min, P = 0.0307), and also longer CTT by (104 min, P = 0.0285) and whole gut transit time by (263 min, P = 0.0077). Increasing age was associated with shorter small bowel transit time (P = 0.002), and study country also influenced small bowel and CTTs. Whole gut and CTTs showed clustering of data at values separated by 24 h, suggesting that describing these measures as continuous variables is invalid. Testing protocol, gender and study country also significantly influenced pH values. Regional GI transit times and pH values, delineated using the wireless motility capsule (WMC), vary based on testing protocol, gender, age and country. Standardisation of testing is crucial for cross-referencing in clinical practice and future research. © 2015 John Wiley & Sons Ltd.

  1. THE EXPRESSION OF Hsa-miR-21-5p AS MINIMAL INVASIVE MARKER TO ADJUVANT CHEMOTHERAPY IN BREAST CANCER PATIENTS

    Directory of Open Access Journals (Sweden)

    Dewi Safitri Tanjung

    2017-02-01

    Full Text Available Abstract Breast cancer remains the leading cause of death among women, and there is a need to develop minimally invasive marker. In our previous study based on clinicopathologic in pre-chemotherapy patients showed miR-21 was upregulated 1.32 times higher at advanced stage compared with early stage. Therefore the matched patients for post-chemotherapy samples were used. The aim of this research is to examine the expression of miR-21 as potential marker to adjuvant chemotherapy in breast cancer patients. The samples were taken by using cross sectional method with total 39 blood plasma samples from breast cancer patients in adjuvant chemotherapy and 12 healthy control samples. Plasma was obtained from blood samples and then RNA isolated were performed. Total RNA was reverse transcribed using cDNA synthesis. The expression of miR-21 was then analyzed using specific primer for miR-21 and miR-16 as the reference gene. Livak Method was used to calculate the expression level in each group. The result showed that there is significant downregulated expression of miR-21 in postchemotherapy 2.61 fold compared with pre-chemotherapy (p<0.05. The expression of miR-21 upregulated 2.2 folds (p<0.05 in pre-chemotherapy compared with healthy control, while in post-chemotherapy compared with healthy control, the expression of miR-21 was 0.8 fold (p<0.05. In conclusion, Hsa-miR-21-5p can be used as marker for adjuvant chemotherapy response in breast cancer because there is significant different expression between prechemotherapy, post-chemotherapy and healthy control. The continuation research in the near future for detecting the expression of tumor suppressor protein regulated by miR-21 is needed. Keywords: breast cancer, adjuvant chemotherapy, miR-21, minimal invasive marker

  2. [The role of general practitioners in the management of cancer patients from the central region of Tunisia: a retrospective study of 215 physicians].

    Science.gov (United States)

    Belaid, Imtinene; Ben Fatma, Leila; Hochlaf, Makrem; Mnasser, Soumaya; Boudagga, Mohamed Zaher; Chabchoub, Imene; Zairi, Faten; Gharbi, Olfa; Ben Ahmed, Slim

    2015-07-01

    General practitioners have a major contribution in cancer prevention and screening. However, their contribution in the treatment plan management and in the post treatment follow-up of cancer patients needs to be clarified. To evaluate the contribution of general practitioners of the public and private sectors in the management of cancer patients during and after the treatment protocol. To analyze the problems they encounter and find the possible solutions. A retrospective declarative KAP (Knowledge, Attitudes and Practices) survey was conducted from first September 2010 to 28 February 2011 in the central region of Tunisia among 215 primary care physicians in the public and private sectors. The questionnaire focused on their effective involvement, the role during treatment, follow up and supportive care. Nearly 80% of physicians who participated in the survey were involved in the management of their patients, primarily by ensuring adherence to their treatment (42.9%), in the follow up care after treatment (42.3%) and in palliative care (29%), however the majority has never prescribed opioid drugs (66.5%). Only 46.6% of the physicians announced the diagnosis of cancer to their patients. The questioned doctors deplored the lack of training in oncology (22.8%) and the feeling of being excluded from the management of their patients once they have addressed them to their specialist peers (48.8%). The interviewed physicians expressed their wish to have a further medical training in oncology (79.5%) and to join a structured cancer network (55.8%). The majority of interviewed general practitioners of our region were engaged in cancer patients' care. However, gaps were identified especially in palliative care and in prescribing opioid drugs. Promoting continuing education in this field and the establishment of cancer networks will allow extend the scope of general practitioners' intervention in the cancer network.

  3. Elisante 215-222.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Sisal leaves which constitute only 2% of the sisal plant have been used in the production of pulp and fiber; the remaining 98% ... utilisationThe objective of this study was to identify properties and pertinent characteristics for developing industrially viable ... infrastructure like pipes, tankers and ships are well established ...

  4. Korean Affairs Report No. 215.

    Science.gov (United States)

    1982-05-25

    the Togolese paper LA N0UVELLE MARCHE, the Mauritainian paper AL CHAAB, the Ecuadorian paper EL TIEMPO, and the Finnish paper P0RV00N MITTA...rendered phonetically or transliterated are enclosed in parentheses. Words or names preceded by a ques - tion mark and enclosed in parentheses were...the criminal and dis- cussed a hider-out with him. Thus, he helped the criminal escape. 13. Suspect 0 Sangr -kon, aware that Kim Hyon-chong was a

  5. 215 - 222_Tijjani_Nematodes

    African Journals Online (AJOL)

    pc

    ABSTRACT. Field and screen house studies were conducte. (IITA) Research Farms, Minjibir, Kano State. Savannah Agro-ecological Zone, North breeding lines to infestation of Meloidogyne s. 5000 eggs of Meloidogyne spp. The experim. Complete Block Design laid out in the fiel. Randomized Design. In each location ...

  6. No evidence of a higher 10 year period prevalence of diabetes among 77,885 twins compared with 215,264 singletons from the Danish birth cohorts 1910-1989

    DEFF Research Database (Denmark)

    Petersen, Inge; Nielsen, Morten Frost; Beck-Nielsen, Henning

    2011-01-01

    AIMS/HYPOTHESIS: Previous Danish twin studies have found a highly increased risk of precursors of type 2 diabetes as well as a higher prevalence of type 2 diabetes among twins compared with singletons. Likewise, small-scale studies of Danish twins have shown that monozygotic twins have a higher...... risk of developing precursors of type 2 diabetes compared with dizygotic twins. In the present register-based study, the 10 year period diabetes prevalence in Danish twins is compared with that in a random sample of Danish citizens. Furthermore, the 10 year period prevalence of diabetes in monozygotic...... twins is compared with that in dizygotic twins. METHODS: The study population consisted of twins (n = 77,885) identified in the Danish Twin Registry, and a 5% random sample (n = 215,264) from the birth cohorts 1910-1989. We identified diabetes patients by means of three nationwide Danish health...

  7. Application of serum microRNA-9-5p, 21-5p, and 223-3p combined with tumor markers in the diagnosis of non-small-cell lung cancer in Yunnan in southwestern China.

    Science.gov (United States)

    Yang, Yanlong; Chen, Kai; Zhou, Yongchun; Hu, Zaoxiu; Chen, Shuai; Huang, Yunchao

    2018-01-01

    Xuanwei City is located in late Permian coal-accumulating areas of the northeastern region of Yunnan Province. In China, morbidity and mortality from lung cancer are highest in Yunnan. Identifying useful circulating markers suitable for the diagnosis of lung cancer in this region is quite meaningful. In this study, we evaluated diagnostic roles of serum miR-9-5p, 21-5p, 223-3p, 135b-5p, 339-5p, and 501-5p in patients with non-small-cell lung cancer (NSCLC) in Yunnan. Moreover, we evaluated the diagnostic performance of several tumor markers, including carcinoembryonic antigen (CEA), cytokeratin 19 fragment 21-1 (CYFRA21-1), and squamous cell carcinoma-related antigen (SCC). Quantitative real-time polymerase chain reaction detected six miRNAs in the serum of 104 NSCLC patients and 50 cancer-free controls. Other markers, including CEA, CYFRA21-1, and SCC, in serum were also measured. The diagnostic ability of miRNAs and tumor markers was evaluated by receiver operating characteristic (ROC) curve analysis. The diagnostic performance of these serum markers was also evaluated in Xuanwei and non-Xuanwei subjects, because the etiological and the epidemiological characteristics of lung cancer in Xuanwei were quite different from those in other regions. Serum miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were upregulated in NSCLC patients, compared with cancer-free controls. No significant difference was found in miR-135b-5p, miR-339-5p, and miR-501-5p expression. The area under ROC curves (AUCs) of miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were 0.706, 0.765, 0.744, 0.749, 0.735, and 0.616, respectively. When combined, miRNAs and tumor markers yielded the highest diagnostic power, with AUC of 0.886, sensitivity of 82.69%, and specificity of 88.00%. In Xuanwei subjects, miR-223-3p and CEA may be suitable biomarkers to distinguish NSCLC from cancer-free states with AUCs of 0.752 and 0.791, respectively. The diagnostic power of the combination of mi

  8. Small-angle neutron scattering study of the flux-line lattice in a single crystal of Bi2.15Sr1.95CaCu2O8+x

    DEFF Research Database (Denmark)

    Yethiraj, M.; Mook, H.A.; Forgan, E.M.

    1994-01-01

    A flux‐line lattice (FLL) was observed in a single crystal of Bi2.15Sr1.95CaCu2O8+x (BSCCO) using small‐angle neutron scattering methods. The sample has a superconducting transition at 85 K. The flux‐line lattice is observed to melt, evidenced by the rapid disappearance of diffracted intensity...... as the temperature is increased above a field‐dependent melting temperature. Diffracted intensity due to the vortex lattice also falls off as the applied field is increased. It is believed that this is a manifestation of the transition of the three‐dimensional flux lines into two‐dimensional pancake vortices...

  9. Quand la liberté de lire est menacée : la lutte de la Campaign for Reader Privacy contre l’article 215 de la loi USA PATRIOT.

    Directory of Open Access Journals (Sweden)

    Cécile Cottenet

    2008-05-01

    Full Text Available De nombreuses associations et mouvements militant pour les libertés individuelles se sont créés ou consolidés au lendemain des attentats du 11 septembre 2001, après le passage de la loi USA PATRIOT. L’un de ces mouvements, porté par les acteurs du monde du livre — libraires, bibliothécaires, éditeurs, écrivains — a très rapidement vu le danger d’une loi permettant l’intrusion de l’Etat dans la vie privée. Cette coalition, sous la bannière Campaign for Reader Privacy, a choisi pour cible l’article 215 de la loi, et mis en œuvre un véritable réseau de militants afin que celui-ci soit amendé et que soit rétabli la protection de la confidentialité des lectures des Américains. Cet article se propose d’examiner les enjeux qui ont fédéré les membres de cette coalition, et d’éclairer la nécessité impérieuse qui a poussé ces associations à se battre jusque dans les couloirs du Congrès pour le droit à la confidentialité de l’information.Many associations and movements for the defense of individual liberties have emerged or grown in the wake of 9/11 and the passing of the USA PATRIOT Act. One of these movements, led by actors of the book industry—booksellers, librarians, publishers, writers—rapidly saw the danger of an act that authorizes the government to intrude into private lives. Under the banner “Campaign for Reader Privacy”, this coalition has chosen to target section 215 of the USA PATRIOT Act. In order to amend this section and to restore the protection of the privacy of Americans’ readings, it has developed a network of militants. This article examines the reasons that pushed the different associations to coalesce and tries to shed some light on the imperious necessity to fight for a fundamental right in American life, the privacy of personal information.

  10. Effect of Sol-Gel Ageing Time on Three Dimensionally Ordered Macroporous Structure of 80SiO2-15CaO-5P2O5 Bioactive Glasses

    Directory of Open Access Journals (Sweden)

    Thanida CHAROENSUK

    2014-04-01

    Full Text Available Three dimensionally ordered macroporous bioactive glasses (3DOM-BGs, namely 80SiO2-15CaO-5P2O5, were synthesized by sol-gel method. PMMA colloidal crystals and non-ionic block copolymers P123 were used as cotemplates. The amorphous 3DOM-BGs had skeletal walls enclosing macropores. Such structure resulted from octahedral and tetrahedral holes of the face-centered cubic (fcc closest packed PMMA templates and windows interconnecting through macropores network. The thicknesses of the walls were around 50 nm – 80 nm and the windows were 90 nm – 110 nm in diameter. These wall thickness is increased by with an increase in ageing time up to 24 h and  then gradually reduced with further increase in aging time. Vibration bands of Si–O–Si and P–O were evident in infrared spectra which are in agreement with EDS spectra indicating Si, P and Ca compositions. After in vitro bioactivity testing by soaking 3DOM-BGs in simulated body fluid at 37 °C, the crystallization of amorphous calcium phosphate layers compatible to the bone component of hydroxyl carbonate apatite were rapidly formed within 3 h. These results indicated that these 3DOM-BGs resembled ideal bone implant materials.DOI: http://dx.doi.org/10.5755/j01.ms.20.1.4755

  11. Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

    Energy Technology Data Exchange (ETDEWEB)

    Hohloch, Karin; Lankeit, H.K.; Truemper, L. [Georg August University, Hematology and Oncology, Goettingen (Germany); Zinzani, P.L. [University of Bologna, Institute of Hematology and Medical Oncology ' ' L. e A. Seragnoli' ' , Bologna (Italy); Scholz, C.W. [Charite, University Berlin, Hematology, Oncology and Tumor Immunology, Berlin (Germany); Lorsbach, M.; Windemuth-Kieselbach, C. [Alcedis GmbH, Giessen (Germany)

    2014-08-15

    Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

  12. 215 ECONOMIC CONTRIBUTION OF CASSAVA PRODUCTION (A ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Jun 1, 2010 ... ECONOMIC CONTRIBUTION OF CASSAVA PRODUCTION (A CASE STUDY OF. KUJE AREA COUNCIL FEDERAL ... transportation were found to be affecting cassava production in the area. It was recommended ... of the Federal Government policy on cassava production for both local and international.

  13. 47 CFR 215.1 - Background.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL FEDERAL GOVERNMENT FOCAL... National Communications System (NCS), with the Defense Communications Agency (DCA), maintains a data base... among affected Federal agencies information concerning the telecommunications effects of EMP and...

  14. Publications | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  15. 49 CFR 215.7 - Prohibited acts.

    Science.gov (United States)

    2010-10-01

    ... persons, or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations, and, where a grossly...

  16. Reference: 215 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available Shinya et al. 2005 Jun. Plant Physiol. 138(2):870-81. Plants have mechanisms for repairing and tolerating de...-damaging agents. Roles of Arabidopsis AtREV1 and AtREV7 in translesion synthesis. 2 870-81 15908599 2005 Jun Plant physio

  17. 2 CFR 215.36 - Intangible property.

    Science.gov (United States)

    2010-01-01

    ... at 37 CFR part 401, “Rights to Inventions Made by Nonprofit Organizations and Small Business Firms..., but not any of the following: Preliminary analyses, drafts of scientific papers, plans for future... journal; or (B) A Federal agency publicly and officially cites the research findings in support of an...

  18. Publications | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... (restricted access). PANACeA brought together 16 researchers from 10 Asian countries to learn about eHealth and eHealth research, and join hands to implement 8 multi-national research projects. The projects ranged from evaluating effectiveness of using technologies for management of health information in hospital.

  19. 12 CFR 215.4 - General prohibitions.

    Science.gov (United States)

    2010-01-01

    ... corporation wholly owned directly or indirectly by the United States; (C) Extensions of credit secured by a... bank or insider of its affiliates unless the extension of credit: (i) Is made on substantially the same... the member bank and, in the case of extensions of credit to an insider of its affiliates, is widely...

  20. 7 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... individuals, who are not residents of an institution or boarding house, but who are living as one economic..., school district, or other political subdivision of a State, or for a combination of school districts or... school or child-care institution for the benefit of the children, all of the income from which is used...

  1. 24 CFR 91.215 - Strategic plan.

    Science.gov (United States)

    2010-04-01

    ... remove the “troubled” designation. (d) Homelessness. With respect to homelessness, the consolidated plan... effects of public policies that serve as barriers to affordable housing, as identified in accordance with...

  2. 36 CFR 2.15 - Pets.

    Science.gov (United States)

    2010-07-01

    ... dogs accompanying visually impaired persons or hearing ear dogs accompanying hearing-impaired persons. (2) Failing to crate, cage, restrain on a leash which shall not exceed six feet in length, or... superintendent. (b) In park areas where hunting is allowed, dogs may be used in support of these activities in...

  3. 49 CFR 212.215 - Locomotive inspector.

    Science.gov (United States)

    2010-10-01

    ..., Safety Appliance Standards and Power Brake Standards; (3) The knowledge of railroad operating procedures... part 229), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232), to... specific qualifications: (1) A comprehensive knowledge of construction, testing, inspecting and repair of...

  4. 18 CFR 281.215 - Additional relief.

    Science.gov (United States)

    2010-04-01

    ... request (for any reason including the provisions of § 281.210) classification under § 281.206 on behalf of its high priority uses or reclassification on behalf of its essential agricultural users, the person... request shall contain the information required in § 2.78(b) of the Commission Regulations. [44 FR 26862...

  5. 47 CFR 87.215 - Supplemental eligibility.

    Science.gov (United States)

    2010-10-01

    ... entities, and to nongovernmental organizations (NGOs) that are authorized to apply for the license by a... applications submitted by NGOs must be accompanied by a new, written certification of support (for the NGO...

  6. 2 CFR 215.31 - Insurance coverage.

    Science.gov (United States)

    2010-01-01

    ... Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for real property and equipment acquired with Federal funds as provided to property owned by the recipient. Federally-owned property need not be insured unless required by the terms and conditions of the award. ...

  7. Publications | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The discussions and interactions between Meghalaya State Police (MSP) leadership and North East Network (NEN) on problems faced by women when dealing with the ... Unregulated privatization of Private Military and Security Companies (PMSCs) poses many challenges to the attainment of African peace and security.

  8. 32 CFR 215.4 - Legal considerations.

    Science.gov (United States)

    2010-07-01

    .... (a) 10 U.S.C. 331. Authorizes use of the militia and Armed Forces when a State is unable to control.... Authorizes use of the militia and Armed Forces to enforce Federal law when unlawful obstructions or rebellion... Article II, section 3, of the Constitution. (c) 10 U.S.C. 333. Authorizes use of the militia and Armed...

  9. 22 CFR 215.13 - General exemptions.

    Science.gov (United States)

    2010-04-01

    ... reference to the Federal Register, volume and page, where the exemption rule can be found. (c) The systems... are being exempted, and the justification for the exemptions, are set forth below: (1) Criminal Law... avoid the disclosure of investigative techniques, and to avoid the endangering the law enforcement...

  10. 7 CFR 215.8 - Reimbursement payments.

    Science.gov (United States)

    2010-01-01

    ... reimbursement for each half-pint (236 ml.) of milk served to children exceed the cost of the milk to the school or child care institution. (2) The rate of reimbursement for milk purchased and served free to needy... shall be the average cost of milk, i.e., the total cost of all milk purchased during the claim period...

  11. 48 CFR 215.404-4 - Profit.

    Science.gov (United States)

    2010-10-01

    ... pricing data threshold (see FAR 15.403-4(a)(1)); (ii) For architect-engineer or construction work; (iii... basic rate on all actions under the agreement, provided that conditions affecting profit do not change... applied weights or values for individual profit factors shall not be attempted, the contracting officer...

  12. 76 FR 6536 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T...

    Science.gov (United States)

    2011-02-07

    ... the number of flight cycles accumulated by each of the applicable accumulators (i.e., brake, aileron, elevator, and rudder accumulators) having part number (P/N) 08-8423-010 (MS28700- 3) installed on the...

  13. 33 CFR 135.215 - Certification.

    Science.gov (United States)

    2010-07-01

    ...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND... for Certificate of Financial Responsibility form, available from the Fund Administrator or any Coast... clearly designated as such to insure confidential treatment by the Fund Administrator, under 5 U.S.C. 552...

  14. 10 CFR 21.5 - Communications.

    Science.gov (United States)

    2010-01-01

    ... this part must be addressed to the NRC's Document Control Desk, and sent by mail to the U.S. Nuclear... Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the NRC to...

  15. 22 CFR 215.14 - Specific exemptions.

    Science.gov (United States)

    2010-04-01

    ..., or qualifications for Federal civilian employment, military service, Federal contracts, or access to... functioning and integrity of law enforcement activities, to prevent disclosure of investigative techniques, to... integrity of law enforcement activities, to prevent disclosure of investigative techniques, to maintain the...

  16. 2 CFR 215.44 - Procurement procedures.

    Science.gov (United States)

    2010-01-01

    ... competition. (ii) Requirements which the bidder/offeror must fulfill and all other factors to be used in... or only one bid or offer is received in response to a solicitation. (3) The procurement, which is... bid procurement. (5) A proposed contract modification changes the scope of a contract or increases the...

  17. 2 CFR 215.71 - Closeout procedures.

    Science.gov (United States)

    2010-01-01

    ... Federal awarding agency has advanced or paid and that is not authorized to be retained by the recipient... the event a final audit has not been performed prior to the closeout of an award, the Federal awarding... recommendations on disallowed costs resulting from the final audit. ...

  18. 24 CFR 200.215 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... imprisonment of two years or less. (c) Packager or Consultant. A person or firm that furnishes or proposes to..., nonprofit association, or any other public or private entity proposing to participate, or participating, in... administrator or operator, packager, or consultant; and architects and attorneys who have any interest in the...

  19. 2 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... institutions. “Research” is defined as a systematic study directed toward fuller scientific knowledge or... Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE... acquisition cost in accordance with the recipient's regular accounting practices. (d) Advance means a payment...

  20. Clinical characteristics and outcome of 467 patients with a clinically recognized eating disorder identified among 52,215 patients with type 1 diabetes: a multicenter german/austrian study.

    Science.gov (United States)

    Scheuing, Nicole; Bartus, Béla; Berger, Gabriele; Haberland, Holger; Icks, Andrea; Knauth, Burkhild; Nellen-Hellmuth, Nicole; Rosenbauer, Joachim; Teufel, Martin; Holl, Reinhard W

    2014-06-01

    To compare clinical characteristics and outcome of type 1 diabetes mellitus (T1DM) between patients with and without a clinically recognized eating disorder (ED). A total of 52,215 T1DM patients aged 8 to anorexia nervosa [AN], n = 141 [female: 94.3%]; bulimia nervosa [BN], n = 62 [90.3%]; and EDs not otherwise specified, including binge-eating disorder [EDNOS], n = 264 [74.2%]). Groups were compared using multivariable regression. Cox proportional hazard ratios were calculated for the association between ED and retinopathy. After adjustment for age, sex, and duration of diabetes, patients with ED revealed higher HbA1c (no ED vs. AN, BN, or EDNOS, respectively: 8.29 ± 0.01% [67.1 ± 0.1 mmol/mol] vs. 8.61 ± 0.15% [70.6 ± 1.6 mmol/mol], 9.11 ± 0.23% [76.1 ± 2.5 mmol/mol], or 9.00 ± 0.11% [74.9 ± 1.2 mmol/mol]) and a higher rate of pathological insulin injection sites (48.4 vs. 64.3, 64.1, or 62.1%). Furthermore, ketoacidosis (5.7 ± 0.1 vs. 12.1 ± 2.1, 18.0 ± 4.1, or 12.9 ± 1.6 events per 100 person-years) and hospitalization (54.9 ± 0.3 vs. 89.3 ± 6.0, 132.0 ± 12.7, or 91.0 ± 4.4 per 100 person-years) were more common, and duration of hospital stay was longer (4.81 ± 0.01 vs. 11.31 ± 0.21, 18.05 ± 0.48, or 8.44 ± 0.13 days per year). All P values were EDNOS had a 2.5-fold (95% CI 1.3-4.8) and a 1.4-fold (0.8-2.3) higher risk for retinopathy, whereas AN patients had no increased risk (0.9 [95% CI 0.4-2.3]). Diabetes health care professionals should be aware of comorbid EDs in pediatric/young-adult T1DM patients. An ED diagnosis is associated with worse metabolic control and higher rates of diabetes complications. © 2014 by the American Diabetes Association.

  1. 76 FR 34014 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and...

    Science.gov (United States)

    2011-06-10

    ... pulley support bracket assembly in combination with other system failures such as an engine failure... emergency water dump pulley support bracket assembly in combination with other system failures such as an... the emergency water dump pulley support bracket assembly in combination with other system failures...

  2. Hardness Analysis. Training Module 5.215.2.77.

    Science.gov (United States)

    Bonte, John L.; Davidson, Arnold C.

    This document is an instructional module package prepared in objective form for use by an instructor familiar with hardness analysis using the EDTA method and the calculation of hardness given metal ion concentrations and a factor table. Included are objectives, an instructor guide, student handouts, and transparency masters. A video tape is also…

  3. 7 CFR 215.6 - Use of funds.

    Science.gov (United States)

    2010-01-01

    ... fiscal year. (b) Whoever embezzles, willfully misapplies, steals, or obtains by fraud any funds, assets... property have been embezzled, willfully misapplied, stolen, or obtained by fraud, shall be subject to the...

  4. 32 CFR 215.1 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... establishes uniform Department of Defense policies, assigns responsibilities, and furnishes general guidance for utilizing DoD military and civilian personnel, facilities, equipment or supplies: (a) In support of civil authorities during civil disturbances within the 50 States, District of Columbia...

  5. 29 CFR 1910.215 - Abrasive wheel machinery.

    Science.gov (United States)

    2010-07-01

    ... end, nut, and flange projections. The safety guard shall be mounted so as to maintain proper alignment... diameter of wheel fits in the depressed side of wheel to prevent interference in side grinding and serves...

  6. All projects related to | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-03-01

    From its independence in 1960 until 1999, Côte d'Ivoire was one of Africa's most stable countries, experiencing continuous economic growth thanks to its many natural resources, agriculture in particular. Start Date: March 1, 2012. End Date: July 17, 2013. Topic: RESEARCH CENTRES, POLITICAL CRISIS, Democracy, ...

  7. 48 CFR 215.404-75 - Fee requirements for FFRDCs.

    Science.gov (United States)

    2010-10-01

    ... FFRDC's— (1) Proportion of retained earnings (as established under generally accepted accounting methods... objective in accordance with FFRDC fee policies in the DoD FFRDC Management Plan. (c) Shall not use the...

  8. 25 CFR 215.16 - Requirements of corporate lessees.

    Science.gov (United States)

    2010-04-01

    ... assessment. (3) How much cash the company has in its treasury and elsewhere and from what source it was received. (4) What property, exclusive of cash, is owned by the company and its value. (5) What the total indebtedness of the company is, and, specifically, the nature of its obligations. (b) Subsequent applications...

  9. Dicty_cDB: VFI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available curbita pepo silverleaf whitefly... 220 e-105 AF360346_1( AF360346 |pid:none) Ara...20_1( AB036420 |pid:none) Citrullus lanatus mRNA for DIP-1, ... 234 e-109 AF170086_1( AF170086 |pid:none) Cu

  10. 2 CFR Appendix A to Part 215 - Contract Provisions

    Science.gov (United States)

    2010-01-01

    .... Clean Air Act (42 U.S.C. 7401 et seq.) and the Federal Water Pollution Control Act (33 U.S.C. 1251 et... issued pursuant to the Clean Air Act (42 U.S.C. 7401 et seq.) and the Federal Water Pollution Control Act... or articles ordinarily available on the open market, or contracts for transportation or transmission...

  11. 28 CFR 2.215 - Place of revocation hearing.

    Science.gov (United States)

    2010-07-01

    ... OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Supervised Releasees § 2... releasee has not been convicted of a crime committed while under supervision; and (2) The releasee denies...

  12. 48 CFR 1352.215-76 - Cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... trends. A narrative statement outlining the offeror's policies and practices for accumulating overhead... venture responsibilities; (D) Extent of offeror's investment; (E) Subcontracting of work; and (F) Other...

  13. 15 CFR 280.215 - Interlocutory review of rulings.

    Science.gov (United States)

    2010-01-01

    ... party, or on the administrative law judge's own initiative, the administrative law judge may certify to... administrative law judge determines that immediate review may hasten or facilitate the final disposition of the... replies, following which the Under Secretary will decide the matter promptly. ...

  14. 20 CFR 725.215 - Determination of dependency; surviving spouse.

    Science.gov (United States)

    2010-04-01

    ... miner's death: (a) The individual was living with the miner (see § 725.232); or (b) The individual was... son or daughter; or (e) The individual had legally adopted the miner's son or daughter while the individual was married to the miner and while such son or daughter was under the age of 18; or (f) The...

  15. 24 CFR 572.215 - Implementation grants-eligible activities.

    Science.gov (United States)

    2010-04-01

    ... related to implementing the affirmative fair housing marketing strategy required under § 572.110. (k...) Homebuyer outreach and selection. Reasonable and necessary costs of marketing the program to potential...

  16. 48 CFR 2052.215-71 - Project officer authority.

    Science.gov (United States)

    2010-10-01

    ... express terms and conditions of this contract. *To be incorporated into any resultant contract. (End of... subject to the technical direction of the NRC project officer. The term technical direction is defined to... performance. (4) Changes any of the expressed terms, conditions, or specifications of the contract. (5...

  17. 7 CFR 1260.215 - Patents, copyrights, inventions and publications.

    Science.gov (United States)

    2010-01-01

    ..., residual payments, or other income from the rental, sale, leasing, franchising, or other uses of such patents, copyrights, inventions, or publications, ensure to the benefit of the Board. Upon termination of...

  18. DNA tests for strawberry: perpetual flowering - Bx215

    Science.gov (United States)

    Perpetual flowering strawberries have great economic value to the fresh market industry. Floral initiation in strawberry is largely determined by photoperiod, temperature, and genetics. Commercially grown strawberries are generally classified as remontant (repeated or perpetual flowering, day neutr...

  19. 215.pdf | feb2013 | jessci | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    How to combat infectious diseases: The role of Science Academies · Academy Public Lecture and INSA–Leopoldina Lecture by Prof. Jörg Hacker, President, German Academy of Sciences Leopoldina. 4 December, 2017, 4 PM Faculty Hall, Indian Institute ...

  20. 2 CFR 215.23 - Cost sharing or matching.

    Science.gov (United States)

    2010-01-01

    ... the use of the current fair market value of the donated property, even if it exceeds the certified... be reasonable and shall not exceed the fair market value of the property at the time of the donation... its fair market value at the time of donation to the recipient as established by an independent...

  1. 12 CFR 347.215 - Exemptions from deposit insurance requirement.

    Science.gov (United States)

    2010-01-01

    ... exemption would give the foreign bank an unfair competitive advantage over United States banking... a foreign bank, foreign business, foreign government, or recognized international organization; (3... next twelve months; (4) Foreign businesses, large United States businesses, and persons from whom an...

  2. Publications | Page 215 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Atelier de formation sur le Suivi évaluation des projets articulé à l'analyse genre et la communication des résultats de recherche : intégration des questions de genre dans le suivi/évaluation des ... Émergence d'un mouvement féministe au Sénégal : le cas du Yewwu-Yewwi PLF; mémoire de maîtrise (restricted access) ...

  3. 50 CFR 600.215 - Council nomination and appointment procedures.

    Science.gov (United States)

    2010-10-01

    ... fishing; (iii) Leadership in a state, regional, or national organization whose members participate in a..., journalism, writing, consulting, practicing law, or researching matters related to fisheries, fishery...

  4. Synthesis of [2-15N]-perlolyrine

    International Nuclear Information System (INIS)

    Tang Ganghua; Wang Shizhen; Wu Shuqin; Jiang Guohui

    1998-01-01

    The synthesis of [2- 15 N]-perlolyrine is described. Furfuryl alcohol was first acetylated and formacylated, and then reacted with [α- 15 N]-dl-tryptophan to form the ring-closed product, which was oxidated and hydrolyzed to give the final product. The product was confirmed by MS, UV and TLC. Its yield from [α- 15 N]-dl-tryptophan was 15.5%, and the abundance of 15 N was 92%. The synthetic [2- 15 N]-perlolyrine is therefore suitable for pharmacologic experiments

  5. 48 CFR 215.304 - Evaluation factors and significant subfactors.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION... require use of the clause at FAR 52.219-9, Small Business Subcontracting Plan, other than those based on... participation of small businesses and historically black colleges or universities and minority institutions in...

  6. 34 CFR 682.215 - Income-based repayment plan.

    Science.gov (United States)

    2010-07-01

    ... the borrower's AGI exceeds 150 percent of the poverty line income applicable to the borrower's family... poverty guideline for the borrower's family size; or (ii) For a married borrower who files a joint Federal... of the difference between the borrower's and spouse's AGI, and 150 percent of the poverty guideline...

  7. Dick Lord Covos Books: Johannesburg, 1998 215 pagcs illustrated ...

    African Journals Online (AJOL)

    the adventures of mountain climbing and skiing; from the icy Antarctic to the scotching heat of Namibia and ... that few have ever heard of; from the joy of another life saved to the sadness of one that could not be saved. ... read it only because of the sheer human ingenuity that Lord so eloquently conveys. Despite Lord's ...

  8. 48 CFR 1552.215-75 - Past performance information.

    Science.gov (United States)

    2010-10-01

    ... description of contract or subcontract and relevance to this requirement. (f) Total contract value. (g) Period... businesses, which are of similar scope, magnitude, relevance, and complexity to the requirement which is... products or services similar in scope, magnitude, relevance, and complexity to this requirement in order to...

  9. 49 CFR 180.215 - Reporting and record retention requirements.

    Science.gov (United States)

    2010-10-01

    ... cylinders must maintain the following records where the requalification is performed: (1) Current RIN... copies of those portions of this subchapter applicable to its cylinder requalification and marking... reference in § 171.7 of this subchapter. (b) Requalification records. Daily records of visual inspection...

  10. 46 CFR 10.215 - Medical and physical requirements.

    Science.gov (United States)

    2010-10-01

    ... impairs judgment or reaction time. Examples of physical impairment or medical conditions that could lead... be able to grasp, lift, and manipulate various common shipboard tools; move hands and arms to open...

  11. 33 CFR 104.215 - Vessel Security Officer (VSO).

    Science.gov (United States)

    2010-07-01

    ...) Understanding of the importance of creating and maintaining safe working and living conditions for passengers... (VSO). (a) General. (1) A VSO may perform other duties within the owner's or operator's organization, provided he or she is able to perform the duties and responsibilities required of the VSO for each such...

  12. 48 CFR 1352.215-70 - Proposal preparation.

    Science.gov (United States)

    2010-10-01

    ... costs, as applicable: (A) Direct Labor: Breakdown of direct labor cost by named person or labor category... (percent) and methodology. Direct labor or levels of effort are to be identified as labor-hours and not as... rate. (B) Other Direct Costs: Specify the amount proposed for duplication/reproduction, meetings and...

  13. 48 CFR 1352.215-75 - Evaluation criteria.

    Science.gov (United States)

    2010-10-01

    ... contract requirements, quality and timeliness of delivery of goods and services, effective management of... customer satisfaction. The Government reserves the right to assess the past performance of proposed...

  14. 21 CFR 172.215 - Coumarone-indene resin.

    Science.gov (United States)

    2010-04-01

    ... polymerization of a crude, heavy coal-tar solvent naphtha meeting the following specifications: (1) It is a... more than 0.25 percent tar bases. (3) 95 percent distills in the range 167 °C-184 °C. (b) The food additive meets the following specifications: (1) Softening point, ring and ball: 126 °C minimum as...

  15. 215 E. Grand Ave, Lindsay Light Radiological Survey

    Science.gov (United States)

    The field gamma measurements within the excavation during the excavation process did not exceed theinstrument threshold previously stated, and ranged from a minimum of 1,300 cpm to a maximum of 3,500cpm shielded.

  16. 215 E. Grand Ave, December 2015, Lindsay Light Radiological Survey

    Science.gov (United States)

    The field gamma measurements within the excavation during the excavation process did not exceed theinstrument threshold previously stated and ranged from a minimum of 6,800 cpm to a maximum of 7,200cpm unshielded.

  17. 18 CFR 2.15 - Specified reasonable rate of return.

    Science.gov (United States)

    2010-04-01

    ... average cost of long-term debt and preferred stock for the year, and the cost of common equity shall be the interest rate on 10-year government bonds (reported as the Treasury Department's 10-year constant...

  18. 48 CFR 2052.215-76 - Preproposal conference.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Preproposal conference... Preproposal conference. As prescribed at 2015.407-70(c), the contracting officer may insert the following provision in applicable solicitations which include a preproposal conference: Preproposal Conference (JAN...

  19. 78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM...

    Science.gov (United States)

    2013-10-31

    ... responsible for providing the most recent certification for the packaging through design certification testing... design qualification test. Our intent is to ensure that under the HMR, the marking on the packaging is... that the packaging passed the design qualification test or the periodic retest. Currently, the HMR...

  20. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  1. 45 CFR 1155.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-10-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  2. 24 CFR 21.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any... may impose upon them for drug abuse violations occurring in the workplace. ... of Housing and Urban Development GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS...

  3. 22 CFR 1509.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  4. 38 CFR 48.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ...) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c... that you may impose upon them for drug abuse violations occurring in the workplace. ... OF VETERANS AFFAIRS (CONTINUED) GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL...

  5. 20 CFR 439.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  6. 29 CFR 1472.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any... may impose upon them for drug abuse violations occurring in the workplace. ... CONCILIATION SERVICE GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements...

  7. 49 CFR 32.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-10-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  8. 21 CFR 1405.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  9. 40 CFR 36.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any... may impose upon them for drug abuse violations occurring in the workplace. ... AND OTHER FEDERAL ASSISTANCE GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE...

  10. 10 CFR 607.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-01-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  11. 14 CFR 1267.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-01-01

    ... abuse violations occurring in the workplace. ... ADMINISTRATION GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for... establish an ongoing drug-free awareness program to inform employees about— (a) The dangers of drug abuse in...

  12. 32 CFR 26.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ...) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c... that you may impose upon them for drug abuse violations occurring in the workplace. ... DoD GRANT AND AGREEMENT REGULATIONS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL...

  13. 22 CFR 1008.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  14. 13 CFR 147.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-01-01

    ... abuse violations occurring in the workplace. ... ADMINISTRATION GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (NONPROCUREMENT) Requirements for Recipients... establish an ongoing drug-free awareness program to inform employees about— (a) The dangers of drug abuse in...

  15. 22 CFR 210.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  16. 45 CFR 630.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-10-01

    ... dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any... may impose upon them for drug abuse violations occurring in the workplace. ...) NATIONAL SCIENCE FOUNDATION GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE...

  17. 31 CFR 20.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ...-free awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than...

  18. 34 CFR 84.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  19. 43 CFR 43.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-10-01

    ...-free awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than...

  20. 45 CFR 1173.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-10-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  1. 22 CFR 133.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-04-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation, and employee... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals...

  2. 28 CFR 83.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ...-free awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation...) GOVERNMENT-WIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) Requirements for Recipients Other Than...

  3. 2 CFR 182.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-01-01

    ... employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free... penalties that you may impose upon them for drug abuse violations occurring in the workplace. ... GOVERNMENTWIDE GUIDANCE FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE...

  4. 15 CFR 29.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-01-01

    ...-free awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any available drug counseling, rehabilitation... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than...

  5. 36 CFR 1212.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free... penalties that you may impose upon them for drug abuse violations occurring in the workplace. ... ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE...

  6. 48 CFR 1552.215-70 - EPA source evaluation and selection procedures-negotiated procurements.

    Science.gov (United States)

    2010-10-01

    ... Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT... determine contract cost or price realism. Cost or price realism relates to an offeror's demonstrating that... for Award. (b) In addition to evaluation of the previously discussed elements, the Government will...

  7. 49 CFR Appendix C to Part 215 - FRA Freight Car Standards Defect Code

    Science.gov (United States)

    2010-10-01

    ... facilitate communication, recordkeeping, and statistical analyses. The code may not be substituted for the... of plain bearing journal or fillet has (1) ridge, (2) depression, (3) circumferential score, (4...

  8. Page 1 Microwave response of green vegetation 215 With a view to ...

    Indian Academy of Sciences (India)

    medium is generally computed by using the reciprocity relation e = (1 — Y) (10). **. In active and passive remote sensing studies the microwave response is measured in terms of brightness temperature of the target medium. The brightness tempera-. O 44 x -- SOYA BEAN. () —- GRASS LEAF. O 40 tn —- CORN LEAF.

  9. Students, Graduates, and Dropouts in the Labor Market, October 1977. Special Labor Force Report 215.

    Science.gov (United States)

    Young, Anne McDougall

    1978-01-01

    This article reports continuing increases in the youth labor force participation rate. The employment situation of workers aged sixteen to twenty-four is described as improved for the year ending October, 1977. The report states that the number with jobs rose by 1.1 million to 20.6 million. Also, the number of unemployed youth dropped by 280,000…

  10. 48 CFR 52.215-1 - Instructions to Offerors-Competitive Acquisition.

    Science.gov (United States)

    2010-10-01

    ... withdrawal of proposals. (1) Unless other methods (e.g., electronic commerce or facsimile) are permitted in... transmitted through an electronic commerce method authorized by the solicitation, it was received at the...

  11. A noninvasive approach to quantitative functional brain mapping with H215O and positron emission tomography

    International Nuclear Information System (INIS)

    Fox, P.T.; Mintun, M.A.; Raichle, M.E.; Herscovitch, P.

    1984-01-01

    Positron emission tomographic (PET) measurements of regional cerebral blood flow (rCBF) with intravenously administered 15 O-labeled water and an adaptation of the Kety autoradiographic model are well suited to the study of functional-anatomical correlations within the human brain. This model requires arterial blood sampling to determine rCBF from the regional tissue radiotracer concentration (Cr) recorded by the tomograph. Based upon the well-defined, nearly linear relation between Cr and rCBF inherent in the model, we have developed a method for estimating changes in rCBF from changes in Cr without calculating true rCBF and thus without arterial sampling. This study demonstrates that quantitative functional brain mapping does not require the determination of rCBF from Cr when regional neuronal activation is expressed as the change in rCBF from an initial, resting-state measurement. Patterned-flash visual stimulation was used to produce a wide range of increases in rCBF within the striate cortex. Changes in occipital rCBF were found to be accurately estimated directly from Cr over a series of 56 measurements on eight subjects. This adaptation of the PET/autoradiographic method serves to simplify its application and to make it more acceptable to the subject

  12. ARCON: experience in 215 patients with advanced head-and-neck cancer.

    NARCIS (Netherlands)

    Kaanders, J.H.A.M.; Pop, L.A.M.; Marres, H.A.M.; Bruaset, I.; Hoogen, F.J.A. van den; Merkx, M.A.W.; Kogel, A.J. van der

    2002-01-01

    PURPOSE: "ARCON" combines accelerated radiotherapy to counteract tumor repopulation with carbogen breathing and nicotinamide to reduce chronic and acute hypoxia. The aim of this Phase II study was to assess the feasibility, toxicity, and potential effectiveness of ARCON for advanced head-and-neck

  13. 49 CFR Appendix B to Part 215 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ... outer springs 5,000 7,500 (e) Truck bolster-center plate interference 5,000 7,500 (f) Brake beam shelf... couplers: (a) Shank bent out of alignment 1,000 2,000 (b) Crack in highly stressed junction area. 2,500 5...

  14. 40 CFR 92.215 - Maintenance of records; submittal of information; right of entry.

    Science.gov (United States)

    2010-07-01

    ... previous two sentences, a description of the origin and selection process for fuel system components... certification locomotive or certification locomotive engine, with respect to its engine, drivetrain, fuel system...

  15. 40 CFR 94.215 - Maintenance of records; submittal of information; right of entry.

    Science.gov (United States)

    2010-07-01

    ... description of the origin and selection process for fuel system components, ignition system components (as..., with respect to its engine, drivetrain, fuel system, emission control system components, exhaust...

  16. 2 CFR 215.33 - Federally-owned and exempt property.

    Science.gov (United States)

    2010-01-01

    ... listing of federally-owned property in their custody to the Federal awarding agency. Upon completion of... alternative methods (e.g., the authority provided by the Federal Technology Transfer Act (15 U.S.C. 3710 (I...

  17. A convenient route to 2-hydroxy- and 2,15-dihydroxyhexahelicene

    Czech Academy of Sciences Publication Activity Database

    Teplý, Filip; Stará, Irena G.; Starý, Ivo; Kollárovič, Adrian; Luštinec, Daniel; Krausová, Zuzana; Šaman, David; Fiedler, Pavel

    -, č. 25 (2007), s. 4244-4250 ISSN 1434-193X R&D Projects: GA ČR GA203/06/1792; GA MŠk LC512 Grant - others:6th Framework Programme(XE) LSHC-CT-2006-015847 Institutional research plan: CEZ:AV0Z40550506 Source of funding: R - rámcový projekt EK Keywords : alkynes * arenes * cyclotrimerisation * fused-ring systems Subject RIV: CC - Organic Chemistry Impact factor: 2.914, year: 2007

  18. Sexospécificités | Page 215 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    alimentation et l'agriculture (FAO) estime que, sur près de 250 000 variétés végétales propres à la culture, on n'en cultive aujourd'hui qu'environ 7 000, soit moins de 3 %. Le non-usage mène à l'abandon et, éventuellement, à l'extinction. Read more ...

  19. 40 CFR 1065.215 - Pressure transducers, temperature sensors, and dewpoint sensors.

    Science.gov (United States)

    2010-07-01

    ... recommend thermocouples that are not grounded to the thermocouple sheath. You may use other temperature...-type, quartz crystal, or laser-interferometer transducers. For other applications, we recommend either...

  20. Page 1 Graded subrings of C[X, Y] 215 References {1} Anderson ...

    Indian Academy of Sciences (India)

    {1} Anderson D. F. Subrings of k[X, Y] generated by monomials, Can. J. Math, Vol. XXX, No. 1 (1978). 2 : 5. 224. [2] Bourbaki N, Commutative Algebra. Hermann, Addison Wesley Publishers. L3] Gurjar R V and Shastri A R, The fundamental group at infinity of affine surfaces, Commen, Math. Heleetici 59 (1984) 459–484.

  1. 24 CFR 598.215 - What are the purpose and content of the strategic plan?

    Science.gov (United States)

    2010-04-01

    ... improve transportation, education, public safety, and enhanced access to information and technology among... community should utilize modern communication techniques and incorporate the Internet in order to enhance...

  2. 75 FR 32440 - Catalog of Federal Domestic Assistance (CFDA) Number: 84.215J

    Science.gov (United States)

    2010-06-08

    ... important in ensuring the healthy physical development of a child and his or her academic success...: We agree that a child's academic, social, and emotional development can contribute to the child's... local levels and help all children meet challenging academic content and academic achievement standards...

  3. 215. Evaluación de la terapia local con atorvastatina a altas concentraciones

    OpenAIRE

    Garrido Jiménez, J.M.; Miguelena Hycka, J.; Prada Arrondo, P.; García Andrade, I.; Muñoz Pérez, R.; Oliva de Anquín, E.; Celemín Canorrea, D.; Epeldegui Torre, A.; Sánchez-Montesinos, I.; Roda Murillo, O.; Esteban Molina, M.

    2010-01-01

    Los efectos pleiotrópicos de las estatinas convierten a este grupo farmacológico en un coadyuvante ideal para la optimización de los procedimientos de revascularización y regeneración tisular. El objetivo de este estudio es identificar sus potenciales beneficios sobre el endotelio vascular, determinando los efectos que la atorvastatina a altas concentraciones genera en la biodinámica endotelial, utilizando un modelo experimental de activación endotelial mediante ácido lisofosfatídico (LPA). ...

  4. PS2-15: Coding for Obesity in a Health Plan Claims Database

    OpenAIRE

    Shainline, Michael; Carter, Shelley; Von Worley, Ann; Gunter, Margaret

    2010-01-01

    Background and Aims: The Centers for Disease Control estimated the obesity rate in New Mexico for 2008 to be 25.2%. Sources estimate the following associations between obesity and type 2 diabetes (80%); cardiovascular disease (70%); hypertension (26 %). Yet obesity is infrequently coded as a secondary diagnosis among providers submitting claims. This study examines the frequency with which obesity is documented on claims forms, the relationship between age, gender, and obesity coding, and the...

  5. 32 CFR 215.9 - Providing military resources to civil authorities.

    Science.gov (United States)

    2010-07-01

    ..., arms, ammunition, tank-automotive equipment, and aircraft. (ii) Group Two. Riot control agents... as Federal employees.) (b) Firefighting equipment will not be used for riot control. (c) Civil...

  6. 49 CFR Appendix D to Part 215 - Pre-departure Inspection Procedure

    Science.gov (United States)

    2010-10-01

    ... missing safety appliance. (h) Lading leaking from a placarded hazardous material car. 2. Insecure coupling. 3. Overheated wheel or journal. 4. Broken or extensively cracked wheel. 5. Brake that fails to... freight car shall, as a minimum, be inspected for the imminently hazardous conditions listed below that...

  7. 22 CFR 1508.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  8. 7 CFR 3017.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  9. 2 CFR 180.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  10. 5 CFR 919.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security...

  11. 29 CFR 1471.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq...

  12. 29 CFR 98.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  13. 31 CFR 19.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq...

  14. 22 CFR 1006.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  15. 34 CFR 85.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  16. 21 CFR 1404.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  17. 41 CFR 105-68.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security...

  18. 47 CFR 73.215 - Contour protection for short-spaced assignments.

    Science.gov (United States)

    2010-10-01

    ... station pursuant to 47 CFR 73.211(b)(3): 6 kW ERP/240 meters HAAT—Class A 25 kW ERP/150 meters HAAT—Class B1 50 kW ERP/472 meters HAAT—Class B (b) Applicants requesting short-spaced assignments pursuant to... achieved: (1) The ERP and antenna HAAT of the proposed station in the direction of the contours of other...

  19. 31 CFR 215.9 - Change of legal residence by members of the Armed Forces.

    Science.gov (United States)

    2010-07-01

    ... legal residence of a member of the Armed Forces for tax withholding purposes, the head of an agency at... change of legal residence of a member of the Armed Forces shall become effective for tax withholding... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Change of legal residence by members...

  20. 48 CFR 52.215-13 - Subcontractor Certified Cost or Pricing Data-Modifications.

    Science.gov (United States)

    2010-10-01

    ... cost or pricing data at FAR 15.403-4, on the date of agreement on price or the date of award, whichever... nature and amount of any contingencies included in the price), unless an exception under FAR 15.403-1... prescribed in FAR 15.406-2 that, to the best of its knowledge and belief, the data submitted under paragraph...

  1. 48 CFR 52.215-12 - Subcontractor Certified Cost or Pricing Data.

    Science.gov (United States)

    2010-10-01

    ... FAR 15.403-4, on the date of agreement on price or the date of award, whichever is later; or before... any contingencies included in the price), unless an exception under FAR 15.403-1 applies. (b) The... that, to the best of its knowledge and belief, the data submitted under paragraph (a) of this clause...

  2. 2 CFR 215.25 - Revision of budget and program plans.

    Science.gov (United States)

    2010-01-01

    ... paragraph (e) are automatically waived (i.e., recipients need not obtain such prior approvals) unless one of... of Federal authorized funds is expected to exceed the needs of the recipient for the project period...) Recipients are required to report deviations from budget and program plans, and request prior approvals for...

  3. 7 CFR 215.13a - Determining eligibility for free milk in child-care institutions.

    Science.gov (United States)

    2010-01-01

    ... segregation of, or other discrimination against, or overt identification of, children unable to pay the full... for determining eligibility for free meals and milk under the National School Lunch and School... eligibility for free meals under the National School Lunch and School Breakfast Programs. (2) The method by...

  4. 48 CFR 1552.215-72 - Instructions for the Preparation of Proposals.

    Science.gov (United States)

    2010-10-01

    .... Indicate the amount of unallowable costs included in the historical data. (iv) Offerors who propose.... (iv) Provide historical other direct costs dollars per level of effort hour on similar contracts or... the following provision: Instructions for the Preparation of Proposals (AUG 1999) (a) Other than cost...

  5. PREDICTING NEW PRODUCT SALES: THE POST-LAUNCH PERFORMANCE OF 215 INNOVATORS

    OpenAIRE

    ALFRED KLEINKNECHT; GERBEN VAN DER PANNE

    2012-01-01

    New product sales are hard to predict. Our analysis of sales performance two years after market launch reveals that three groups of factors do not increase the accuracy of predicting new product sales: (1) A firm's general experience and experience with innovation; (2) High technological competences and strong knowledge networks; (3) Customer involvement in new product development. R&D managers should realise that experience with innovation as well as high technological competences, while pos...

  6. Design of the 4-215 D. A. automotive Stirling engine

    Energy Technology Data Exchange (ETDEWEB)

    van Giessel, R.; Reinink, F.

    1977-01-01

    The Stirling engine holds out prospects of achieving a low pollution, quiet automotive power plant with excellent fuel economy and multi-fuel capability. N. V. Philips, of Holland, has been working with Ford Motor Company since 1972 on a joint program to build, test, and develop a conceptual version of the engine to determine its real potential. A description is given of the approach taken in the design of a four-cylinder double-acting 170-hp Stirling engine with a swash-plate drive, suitable for passenger car installation. Performance and steady-state fuel economy measured on a dynamometer are also presented.

  7. Financing State Governments in Nigeria, 1980-2007 (Pp. 204-215)

    African Journals Online (AJOL)

    Nekky Umera

    Abstract. State governments in Nigeria are saddled with a lot of responsibilities that are geared towards the development of their areas. To do this, they engage in expenditure profiles that are at times overwhelming, especially when compared with their limited financial resources. This problem of insufficient funding sources ...

  8. Ketene photodissociation in the wavelength range 193-215 nm: The H atom production channel

    Science.gov (United States)

    Feltham, Emma J.; Qadiri, Rafay H.; Cottrill, Emily E. H.; Cook, Phillip A.; Cole, John P.; Balint-Kurti, Gabriel G.; Ashfold, Michael N. R.

    2003-09-01

    The speed and angular distributions of H atom products arising in the photodissociation of jet-cooled ketene (CH2CO) molecules following excitation at 193.3, 203.3, 209, and 213.3 nm have been investigated by H Rydberg atom photofragment translational spectroscopy. The observed product energy disposal is interpreted in terms of one photon absorption to the 1B1 electronically excited state, internal conversion to high lying vibrational levels of the ground state and subsequent unimolecular decay to yield the observed H (+HCCO) products. H atoms resulting from secondary photolysis of H containing primary products (most probably singlet CH2 radicals) are evident in the measured spectra, especially at high photolysis laser pulse energies. The kinetic energy distributions of the primary H+HCCO products span all energetically accessible product internal energies, peaking at ˜1170 cm-1 in the case of parent excitation at 213.3 nm, and rising to ˜1450 cm-1 (when exciting at 193.3 nm). These distributions are reproduced, qualitatively, by the statistical adiabatic product distribution (SAPD) method proposed recently by Cole and Balint-Kurti (J. Chem. Phys., preceding paper). This method is based on the use of a quantum mechanical, J conserving, Rice-Ramsperger-Kassel-Marcus (RRKM) treatment and provides a prediction of the product quantum state distributions and the total kinetic energy release spectra. Accurate, quadratic configuration interaction, intrinsic reaction coordinates have been computed for both the lowest singlet (S0) and triplet (T1) potential energy surfaces of CH2CO. Quantum mechanical SAPD calculations have been performed using both surfaces; the results favor the conclusion that the dissociation occurs on the S0 surface. This conclusion is further supported by comparison of the calculated and previously measured CO product vibrational quantum state distributions arising from photodissociation at 193.3 nm. The variational RRKM method has also been used to compute the branching ratios for forming H+HCCO and CH2+CO products on both the S0 and T1 surfaces. Different aspects of the SAPD model, such as the inclusion of quantum mechanical tunneling, the attractiveness of the long-range interfragment potential and the assumed adiabaticity of the fragmentation, have been varied in order to shed light on the nature of the dissociation process and the possible origins of the differences between the model calculations and the experimental results. It is found that the agreement between the quantum mechanical statistical model predictions and the experimentally observed total kinetic energy release spectra for the H atom dissociation channel can be greatly improved if the contribution of lower fragment relative orbital angular momenta is increased over that required by the use of a purely statistical model. This finding is equivalent to the conclusion that the dissociation is not entirely statistical, but that the dynamics of the break-up process plays some role. In particular the initial geometry of the parent molecule may restrict the body-fixed angles into which the final products can scatter and, through this, may restrict the relative orbital angular momenta to be on average smaller than that predicted by a purely statistical theory.

  9. Measured 21.5 GHz Indoor Channels With User-Held Handset Antenna Array

    DEFF Research Database (Denmark)

    Hejselbæk, Johannes; Nielsen, Jesper Ødum; Fan, Wei

    2017-01-01

    networks is still to be investigated. This work investigates how the user affects the performance of a 5G handset mock-up. The user impact is studied by channel sounding in an indoor scenario, with and without the presence of different users. The mock-up handset has a uniform linear array of receive (Rx...

  10. 33 CFR 106.215 - Company or OCS facility personnel with security duties.

    Science.gov (United States)

    2010-07-01

    ... a TWIC, and must have knowledge, through training or equivalent job experience, in the following, as... security equipment and systems; (i) Inspection, control, and monitoring techniques; (j) Methods of physical...

  11. Experimental validation of depletion calculations with VESTA 2.1.5 using JEFF-3.2

    Directory of Open Access Journals (Sweden)

    Haeck Wim

    2017-01-01

    Full Text Available The removal of decay heat is a significant safety concern in nuclear engineering for the operation of a nuclear reactor both in normal and accidental conditions and for intermediate and long term waste storage facilities. The correct evaluation of the decay heat produced by an irradiated material requires first of all the calculation of the composition of the irradiated material by depletion codes such as VESTA 2.1, currently under development at IRSN in France. A set of PWR assembly decay heat measurements performed by the Swedish Central Interim Storage Facility (CLAB located in Oskarshamm (Sweden have been calculated using different nuclear data libraries: ENDF/B-VII.0, JEFF-3.1, JEFF-3.2 and JEFF-3.3T1. Using these nuclear data libraries, VESTA 2.1 calculates the assembly decay heat for almost all cases within 4% of the measured decay heat. On average, the ENDF/B-VII.0 calculated decay heat values appear to give a systematic underestimation of only 0.5%. When using the JEFF-3.1 library, this results a systematic underestimation of about 2%. By switching to the JEFF-3.2 library, this systematic underestimation is improved slighty (up to 1.5%. The changes made in the JEFF-3.3T1 beta library appear to be overcorrecting, as the systematic underestimation is transformed into a systematic overestimation of about 1.5%.

  12. Experimental validation of depletion calculations with VESTA 2.1.5 using JEFF-3.2

    Science.gov (United States)

    Haeck, Wim; Ichou, Raphaëlle

    2017-09-01

    The removal of decay heat is a significant safety concern in nuclear engineering for the operation of a nuclear reactor both in normal and accidental conditions and for intermediate and long term waste storage facilities. The correct evaluation of the decay heat produced by an irradiated material requires first of all the calculation of the composition of the irradiated material by depletion codes such as VESTA 2.1, currently under development at IRSN in France. A set of PWR assembly decay heat measurements performed by the Swedish Central Interim Storage Facility (CLAB) located in Oskarshamm (Sweden) have been calculated using different nuclear data libraries: ENDF/B-VII.0, JEFF-3.1, JEFF-3.2 and JEFF-3.3T1. Using these nuclear data libraries, VESTA 2.1 calculates the assembly decay heat for almost all cases within 4% of the measured decay heat. On average, the ENDF/B-VII.0 calculated decay heat values appear to give a systematic underestimation of only 0.5%. When using the JEFF-3.1 library, this results a systematic underestimation of about 2%. By switching to the JEFF-3.2 library, this systematic underestimation is improved slighty (up to 1.5%). The changes made in the JEFF-3.3T1 beta library appear to be overcorrecting, as the systematic underestimation is transformed into a systematic overestimation of about 1.5%.

  13. P2-15: EEG Analysis on Story Change in TV Drama

    Directory of Open Access Journals (Sweden)

    Chung-Yeon Lee

    2012-10-01

    Full Text Available The human brain naturally recognizes a change of environment or atmosphere without great effort, and this is essential for interactive communication in social life and a specific reaction in an emergency situation. Most studies have investigated change detection of the brain with conditional experimental paradigms rather than the performance of everyday tasks. However, naturally occurring sensory stimuli are multimodal and dynamic. In an effort to study the relationship between users' induced physiological responses and changes of environment and atmosphere under more naturalistic and ecological conditions, we performed a basic experiment using audio-visual movies and electroencephalogram (EEG measurement. 8 healthy subjects were asked to watch a television sitcom without any responses, and their EEG signals were recorded simultaneously with 126 electrodes mounted in an elastic electrode cap. Time-frequency analysis of EEG revealed distinctive neural oscillations at the point of story change in the movie. This result could be used for applications in brain-computer interfaces, and provides a reference to cognitive impairment studies such as Attention Deficit Disorder (ADD or Attention-Deficit/Hyperactivity Disorder (ADHD.

  14. 48 CFR 1852.215-78 - Make or buy program requirements.

    Science.gov (United States)

    2010-10-01

    ... buy.” The reasons must include the consideration given to the applicable evaluation factors described... and size status. (g) Any recommendations to defer make-or-buy decisions when categorization of some... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Make or buy program...

  15. Synthesis of [2-15N]-perlolyrine from 15N-glycine

    International Nuclear Information System (INIS)

    Tang Ganghua; Wang Shizhen; Wu Shuqin; Jiang Guohui

    1999-01-01

    To study the metabolism of [2- 15 N]-Perlolyrine in animals, [α- 15 N]-dl-tryptophan and [2- 15 N]-perlolyrine are designed and synthesized. [α- 15 N]-dl-Tryptophan is first synthesized from 15 N-glycine via many steps by the use of Al-Ni alloy as a catalytic reduction agent, and then [2- 15 N]-perlolyrine is synthesized from [α- 15 N]-dl-tryptophan. The abundance of 15 N is determined by GC-MS, the chemical purity is determined by TLC and the final product is confirmed by MS, UV and TLC. The overall yield of the final product is 7.3%, the abundance of 15 N is 92% and the chemical purity is 98%. The synthetic [2- 15 N]-perlolyrine is suitable for pharmacological experiments

  16. 32 CFR 37.215 - What must I conclude about the recipient's commitment and cost sharing?

    Science.gov (United States)

    2010-07-01

    ... recipient's management plan, or through other means. A recipient's self-interest might be driven, for example, by a research project's potential for fostering technology to be incorporated into products and... SECRETARY OF DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Appropriate Use of...

  17. 215. Evaluación de la terapia local con atorvastatina a altas concentraciones

    Directory of Open Access Journals (Sweden)

    J.M. Garrido Jiménez

    2010-01-01

    Conclusiones: el tratamiento con atorvastatina a altas concentraciones ejerce diferentes efectos sobre la viabilidad, proliferación y funcionalidad celular dependiendo del estado basal de las células endoteliales, siendo las células previamente activadas las que presentan niveles óptimos de viabilidad y funcionalidad.

  18. 215 Johanna J Therion*, R.l. Mackie and Frances M.C. Gilchrist

    African Journals Online (AJOL)

    Low-protein teff hay was supplemented with 3% urea and 6% starch to promote growth of the amylolytic bacteria, which liberate branched chain amino acids in the rumen upon lysis. These serve as a source of branched chain volatile fatty acids for the fibrolytic bacteria and thus result in improved fibre digestion.

  19. 20 CFR 498.215 - The hearing and burden of proof.

    Science.gov (United States)

    2010-04-01

    ... burden of going forward and the burden of persuasion with respect to affirmative defenses and any... persuasion with respect to all other issues. (c) The burden of persuasion will be judged by a preponderance...

  20. 48 CFR 52.215-9 - Changes or Additions to Make-or-Buy Program.

    Science.gov (United States)

    2010-10-01

    ... cost or pricing data in accordance with FAR 15.408, Table 15-2 when required by FAR 15.403, and data other than certified cost or pricing data, to permit evaluation; and (2) After approval is granted... with paragraph (k) of the Incentive Price Revision—Firm Target clause or paragraph (m) of the Incentive...

  1. Application of a network analysis in H215O-PET study

    International Nuclear Information System (INIS)

    Kim, Hee Jung; Kang, Eun Joo; Lee, Dong Soo; Chung, June Key; Lee, Myung Chul

    2001-01-01

    The goal of this study was to examine effective connectivity among brain areas involved in a memory function using a statistical method, i.e., structural equation modeling (SEM). Eight brain areas were chosen in left hemisphere including visual, frontal, and parahippocampal areas activated (analyzed with SPM99) during an associative memory task based on a H 2 15 O-PET study. A connectivity model consisting of these brain regions, its anatomical pathways, and the functional influences of these paths was hypothesized and task effect (picture memory task vs. perceptual control task) was compared with a statistical package program for SEM (AMOS 4.0). The strongest functional linkage from fusiform to parahippocampus was found in both tasks. Linkages both from cuneus and inferior prefrontal areas to middle frontal were significantly strong in the perceptual task (p<.005), whereas linkages from cuneus to fusiform as well as from parahippocampus to middle frontal were significantly strong in the memory task (p<.005). Our results confirmed that SEM can be a useful analysis method on hypothesized neural pathways among brain areas identified in functional images

  2. Functional brain mapping using H215O positron emission tomography (I): statistical parametric mapping method

    International Nuclear Information System (INIS)

    Lee, Dong Soo; Lee, Jae Sung; Kim, Kyeong Min; Chung, June Key; Lee, Myung Chul

    1998-01-01

    We investigated the statistical methods to compose the functional brain map of human working memory and the principal factors that have an effect on the methods for localization. Repeated PET scans with successive four tasks, which consist of one control and three different activation tasks, were performed on six right-handed normal volunteers for 2 minutes after bolus injections of 925 MBq H 2 15 O at the intervals of 30 minutes. Image data were analyzed using SPM96 (Statistical Parametric Mapping) implemented with Matlab (Mathworks Inc., U.S.A.). Images from the same subject were spatially registered and were normalized using linear and nonlinear transformation methods. Significant difference between control and each activation state was estimated at every voxel based on the general linear model. Differences of global counts were removed using analysis of covariance (ANCOVA) with global activity as covariate. Using the mean and variance for each condition which was adjusted using ANCOVA, t-statistics was performed on every voxel. To interpret the results more easily, t-values were transformed to the standard Gaussian distribution (Z-score). All the subjects carried out the activation and control tests successfully. Average rate of correct answers was 95%. The numbers of activated blobs were 4 for verbal memory I, 9 for verbal memory II, 9 for visual memory, and 6 for conjunctive activation of these three tasks. The verbal working memory activates predominantly left-sided structures, and the visual memory activates the right hemisphere. We conclude that rCBF PET imaging and statistical parametric mapping method were useful in the localization of the brain regions for verbal and visual working memory

  3. Functional brain mapping using H215O positron emission tomography (II): mapping of human working memory

    International Nuclear Information System (INIS)

    Lee, Jae Sung; Lee, Dong Soo; Lee, Sang Kun; Nam, Hyun Woo; Kim, Seok Ki; Park, Kwang Suk; Jeong, Jae Min; Chung, June Key; Lee, Myung Chul

    1998-01-01

    To localize and compare the neural basis of verbal and visual human working memory, we performed functional activation study using H 2 15 O PET. Repeated H 2 15 O PET scans with one control and three different activation tasks were performed on six right-handed normal volunteers. Each activation task was composed of 13 matching trials. On each trial, four targets, a fixation dot and a prove were presented sequentially and subject's tasks was to press a response button to indicate whether or not the prove was one of the previous targets. Short meaningful Korean words, simple drawings and monochromic pictures of human faces were used as matching objects for verbal or visual memory. All the images were spatially normalized and the differences between control and activation states were statistically analyzed using SPM96. Statistical analysis of verbal memory activation with short words showed activation in the left Broca's area, premotor cortex, cerebellum and right cingulate gyrus. In verbal memory with simple drawing, activation was shown in the larger regions including where activated with short words and left superior temporal cortex, basal ganglia, thalamus, prefrontal cortex, anterior portion of right superior temporal gyrus and right infero-lateral frontal cortex. On the other hand, the visual memory task activated predominantly right-sided structures, especially inferior frontal cortex, supplementary motor cortex and superior parietal cortex. The results are consistent with the hypothesis of the laterality and dissociation of the verbal and visual working memory from the invasive electrophysiological studies and emphasize the pivotal role of frontal cortex and cingulate gyrus in working memory system

  4. : tous les projets | Page 215 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: INSTITUTION BUILDING, EVALUATION TECHNIQUES, INSTITUTIONAL FRAMEWORK, LAW, POLICY MAKING, ADMINISTRATIVE REFORM. Région: North of Sahara, South of Sahara, North and Central America, South America, Central Asia, Far East Asia, South Asia, Bolivia, Brazil, Colombia, India, Kenya, Peru.

  5. 48 CFR 1552.215-74 - Advanced understanding-uncompensated time.

    Science.gov (United States)

    2010-10-01

    ... applicable direct labor costs (including applicable indirect costs). (c) Within three weeks after the end of... policy, entitled, ________. (b) Recognizing that the probable cost to the Government for the labor... adjusted amounts shall not be allowable as a direct or indirect cost to this or any other Government...

  6. 41 CFR 105-74.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a drug-free... penalties that you may impose upon them for drug abuse violations occurring in the workplace. ... Regional Offices-General Services Administration 74-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE...

  7. Topographic Map of Quadrangle 3768 and 3668, Imam-Saheb (215), Rustaq (216), Baghlan (221), and Taloqan (222) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file report (OFR) number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The OFR numbers range in sequence from 1092 to 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  8. 48 CFR 252.215-7005 - Evaluation Factor for Employing or Subcontracting With Members of the Selected Reserve.

    Science.gov (United States)

    2010-10-01

    ... are members of the Selected Reserve. (c) If the offeror, in the performance of any contract resulting... personnel records, indicating the names of the Selected Reserve members who are currently employed by the company; or (2) A statement that one or more positions will be set aside to be filled by new hires of...

  9. SU-E-J-215: Onboard Split PET Including the Effects of Attenuation, Scatter, and Random Events

    Energy Technology Data Exchange (ETDEWEB)

    Darwish, N [Rush University Medical Center, Chicago, IL (United States); Kao, C [The University of Chicago, Chicago, IL (United States); Thomadsen, B; Mackie, T [University of Wisconsin, Madison, WI (United States)

    2014-06-01

    Purpose: Positron emission tomography (PET) using split PET geometry was investigated as an on-board system for functional imaging and PET marker tracking, specifically with tomotherapy. The open dual ring PET would allow measurement of both inter and intra-fractional variation, improving the delineation of tumor volume at any stage in the radiation treatment delivery process. We present results from data obtained using Monte Carlo simulations including the effects of attenuation, random events, and scatter. Methods: PET design was accomplished via Monte Carlo simulations with GATE, the Geant4 Application for Emission Tomography. Images were reconstructed using Software for Image Reconstruction (STIR) with a fully 3D ordered subset expectation maximization (OSEM) image reconstruction technique. Results: Monte Carlo simulations of the split PET geometry indicate that including physical factors that degrade image quality such as attenuation, random events, and scatter still prove the feasibility of near real-time PET for both inter and intra-fractional radiation delivery. The image quality of scan times under 1 minute reveals that it is possible to utilize PET scanning and reconstruction during the treatment session intrafractionally. GATE also simulates the depth information but does not correct obliqueness of the path of line of response so the data is much more realistic than the data obtained with ray tracing. Conclusion: Onboard split PET with TomoTherapy can generate quality images under 1 minute scan times without the need to correct for attenuation, scatter, random events, or depth information of the interaction.

  10. Oahu Hyperspectral Imagery 2000 (215-0611-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  11. Oahu Hyperspectral Imagery 2000 (215-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  12. 33 CFR 148.215 - What if a port has plans for a deep draft channel and harbor?

    Science.gov (United States)

    2010-07-01

    ...) Estimated annual operating expenses, by phases if development is staged, including labor, for 30 years for... project; (vi) Estimated economic benefits of the project, including: (A) Economic contribution to the... community; and (viii) An estimate of the economic impact that the deepwater port license will have on the...

  13. 16 CFR 2.15 - Orders requiring witnesses to testify or provide other information and granting immunity.

    Science.gov (United States)

    2010-01-01

    ... Bureaus of Competition and Economics, the Bureau Director, Deputy Directors and Associate Directors of the... essential to serve the interests of justice. Such appeals shall be made on the record and shall be in the...

  14. Improved energy of the 21.5 keV M1+E2 nuclear transition in Eu-151

    Czech Academy of Sciences Publication Activity Database

    Inoyatov, A. K.; Kovalík, Alojz; Filosofov, D. V.; Ryšavý, Miloš; Perevoshchikov, L. L.; Baimukhanova, A.

    2016-01-01

    Roč. 52, č. 5 (2016), s. 133 ISSN 1434-6001 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : electron binding energies * internal conversion * Gd-151 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.833, year: 2016

  15. 5 CFR 551.215 - Fire protection activities and 7(k) coverage for FLSA pay and exemption determinations.

    Science.gov (United States)

    2010-01-01

    ... functions (e.g., communications or dispatching functions, equipment maintenance or repair) or who is... control and suppression or prevention duties. Supporting functions (such as maintenance of fire apparatus...) are included when performed by firefighters but are not included when performed by mechanics...

  16. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon

    2002-01-01

    of the occipital activation during stage-1 sleep supports a hypothesis of this state being a state of imagery. The rCBF decreases in premotor cortex, thalamus and cerebellum could be indicative of a general decline in preparedness for goal directed action during stage-1 sleep. Stage-1 sleep seems more similar...

  17. 12 CFR Appendix to Part 215 - Section 5200 of the Revised Statutes Total Loans and Extensions of Credit

    Science.gov (United States)

    2010-01-01

    ... discount by dealers in dairy cattle of paper given in payment for dairy cattle, which paper carries a full... or extensions of credit to the Student Loan Marketing Association shall not be subject to any...

  18. X-ray Lβ215 emission spectrum of Ru in Ru(NH3)6Cl3

    International Nuclear Information System (INIS)

    Perera, R.C.C.; Barth, J.; LaVilla, R.E.; Nordling, C.

    1984-07-01

    One of the broader applications of synchrotron radiation has been to EXAFS studies for material structure determination, i.e., for an analysis of x-ray absorption over an extended energy region beyond a core ionization limit. Studies of the near edge structure (XANES) give a different type of information, characteristic of the local symmetry and electronic configuration of the absorbing atom. This type of information is reflected also in the x-ray emission spectra, in particular for transitions involving the valence levels. Examination of the near edge absorption or the emission spectrum does not require an instrument capable of scanning a wide energy range with high counting statistics, as does EXAFS; the needs are rather for good resolution and a reliable calibration of the energy scale. Some of the problems of near edge spectra were particularly evident in our investigation of Ru-Lβ 2 15 emission from Ru(NH 3 ) 6 Cl 3 . The Ru-Lβ 2 15 emission was measured with a laboratory Rowland circle x-ray spectrometer with a curved quartz (1010) crystal (radius = 22 inches) in a fixed position appropriate to the energy range, and a position sensitive detector which can be positioned along the Rowland circle. The Ru spectrum was excited mainly by Sn-L/sub α/ primary radiation from a Sn anode in a demountable x-ray tube operating at 13 kV and 120 mA. The resolution of the instrument in this region is 1.5 eV. An accurate calibration of the energy scale was conveniently obtained by measuring a reference x-ray emission line in the same instrumental configuration. In the present case the Pd-L/sub α/ emission line at 2838 eV was used to establish the energy scale. The energy dispersion of the instrument was determined from the Cl-K/sub β/ emission spectrum of CH 3 Cl between 2810 eV and 2830 eV and Pd-Lα 1 2 and extrapolated to the energy region of the recorded emission spectrum. 6 references, 1 figure

  19. “Remotion” Total Wrist Arthroplasty: Preliminary Results of a Prospective International Multicenter Study of 215 Cases

    DEFF Research Database (Denmark)

    Herzberg, Guillaume; Boeckstyns, Michel Ernest Henri; Sorensen, Allan Ibsen

    2012-01-01

    than 2 years of follow-up (minimum: 2 years, maximum: 8 years). In rheumatoid and non-RA group, visual analog scale (VAS) pain score improved by 48 and 54 points, respectively, and QuickDASH score improved by 20 and 21 points, respectively, with no statistical differences. Average postoperative arc...

  20. Demonstration of decreased posterior cingulate perfusion in mild Alzheimer's disease by means of H215O positron emission tomography

    International Nuclear Information System (INIS)

    Ishii, Kazunari; Sasaki, Masahiro; Yamaji, Shigeru; Sakamoto, Setsu; Kitagaki, Hajime; Mori, Etsuro

    1997-01-01

    Although decreased posterior cingulate metabolism in Alzheimer's disease (AD) has been previously reported, there have been no reports on posterior cingulate perfusion. In this study we evaluated posterior cingulate perfusion as a relative value using statistical parametric maps (SPMs) and as an absolute value using conventional region of interest (ROI) settings. Twenty-eight subjects, including 14 patients with mild AD (mean age: 66.4±12.1 years) and 14 normal controls (65.9±7.3 years) were studied. Regional cerebral blood flow (CBF) was measured with H 2 15 O and positron emission tomography (PET). In the SPM analysis, the left posterior cingulate and left parietotemporal CBFs were significantly decreased in the patients with mild AD (P<0.001). At a lower statistical threshold (P<0.05), the right posterior cingulate and right parietotemporal CBFs were also significantly decreased in the AD patients. In the ROI studies, the left parietal and posterior cingulate CBFs in the patients with mild AD were significantly lower than those of the normal controls by analysis of variance and post-hoc Scheffe's test (P<0.001). We conclude that posterior cingulate perfusion is decreased in mild AD, reflecting the pathological changes and metabolic reduction in the posterior cingulate gyrus that have previously been reported to occur in mild AD. (orig.). With 1 fig., 2 tabs

  1. 20 CFR 645.215 - What must a WtW operating entity that serves noncustodial parent participants do?

    Science.gov (United States)

    2010-04-01

    ... and children who may be at risk of domestic violence, the operating entity must consult with domestic violence prevention and intervention organizations in the development of its WtW project serving... responsibility contracts: (1) Take into account the employment and child support status of the noncustodial...

  2. Functional mapping of the neural basis for the encoding and retrieval of human episodic memory using H215O PET

    International Nuclear Information System (INIS)

    Lee, Jae Sung; Nam, Hyun Woo; Lee, Dong Soo; Lee, Sang Kun; Jang, Myoung Jin; Ahn, Ji Young; Park, Kwang Suk; Chung, June Key; Lee, Myung Chul

    2000-01-01

    Episodic memory is described as an 'autobiographical' memory responsible for storing a record of the events in our lives. We performed functional brain activation study using H 2 1 5O PET to reveal the neural basis of the encoding and the retrieval of episodic memory in human normal volunteers. Four repeated H 2 1 5O PET scans with two reference and two activation tasks were performed on 6 normal volunteers to activate brain areas engaged in encoding and retrieval with verbal materials. Images from the same subject were spatially registered and normalized using linear and nonlinear transformation. Using the means and variances for every condition which were adjusted with analysis of covariance, t-statistic analysis were performed voxel-wise. Encoding of episodic memory activated the opercular and triangular parts of left inferior frontal gyrus, right prefrontal cortex, medial frontal area, cingulate gyrus, posterior middle and inferior temporal gyri, and cerebellum, and both primary visual and visual association areas. Retrieval of episodic memory activated the triangular part of left inferior frontal gyrus and inferior temporal gyrus, right prefrontal cortex and medial temporal ares, and both cerebellum and primary visual and visual association areas. The activations in the opercular part of left inferior frontal gyrus and the right prefrontal cortex meant the essential role of these areas in the encoding and retrieval of episodic memeory. We could localize the neural basis of the encoding and retrieval of episodic memory using H 2 1 5O PET, which was partly consistent with the hypothesis of hemispheric encoding/retrieval asymmetry.=20

  3. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon

    2002-01-01

    This is the first report on the distribution of regional cerebral blood flow (rCBF) changes during stage-1 sleep or somnolence. Two hypotheses were tested: (A) that rCBF differed between the awake relaxed state and stage-1 sleep, (B) that hypnagogic hallucinations frequently experienced at sleep...

  4. U.S. comments on co-chairmen WG.2/15, chapter 7-A assurance of supply

    International Nuclear Information System (INIS)

    1979-05-01

    The U.S. delegation proposes revision in chapter 7 regarding assurance of supply, to reflect that alternative suppliers now exist to provide an assured supply, and that for most countries national enrichment facilities would not be practical or economic. The paper also argues that the spread of national facilities could increase proliferation risks. The revised text also argues that, because enrichment is highly capital-intensive, consumers should not expect significant surplus capacity at any given time, and should not interpret the absence of surplus capacity as an indication of lack of assurance in supply. Options which increase a consumer's flexibility in meeting enrichment needs are reviewed

  5. Comparison of rCBF between patients with medial temporal lobe epilepsy and normal controls using H215O PET

    International Nuclear Information System (INIS)

    Kang, Eun Joo; Lee, Jae Sung; Nam, Hyun Woo; Lee, Sang Kun; Lee, Dong Soo; Chung, June Key; Lee, Myung Chul

    2002-01-01

    The aim of this study was to identify the brain areas whose regional cerebral blood flow (rCBF) was changed in medial temporal lobe epilepsy (mTLE) using H 2 15 O-PET. 12 patients with mTLE (6 left, 6 right mTLE) and 6 normal controls were scanned during a fixation baseline period and a sensory-motor condition where subjects pressed a button to an upward arrow. A voxel-based analysis using SPM99 software was performed to compare the patient groups with the normal controls for the rCBF during fixation baseline period and for relative changes of rCBF during the sensory-motor task relative to fixation. Duirng the fixation baseline, a significant reduction of rCBF was found posterior insula bilaterally and right frontopolar regions in right mTLE patients compared to the normal controls. In left mTLE patients, the reduction was found in left frontopolar and temporal regions. During the sensory-motor task, rCBF increase over the fixation period, was reduced in left frontal and superior temporal regions in the right mTLE patients whereas in various areas of right hemisphere in left mTLE patients, relative to normal controls. However, the increased rCBF was also found in the left inferior parietal and anterior thalamic/fornix regions in both right and left mTLE patients compared to normal controls. Epilepsy induced changes were found not only in relative increase/ decrease of rCBF during a simple sensory-motor control condition relative to a fixation rest condition but also in the relative rCBF distribution during the rest period

  6. The Modified Bentall Procedure: A Single-Institution Experience in 249 Patients with a Maximum Follow Up of 21.5 Years.

    Science.gov (United States)

    Celiento, Michele; Ravenni, Giacomo; Margaryan, Rafik; Ferrari, Gabriele; Blasi, Stefania; Pratali, Stefano; Bortolotti, Uberto

    2016-07-01

    The study aim was to evaluate the long-term clinical outcomes of the modified Bentall procedure (MBP) with a mechanical conduit. Between 1993 and 2014, a total of 249 patients (mean age 62 ± 12 years; range: 25-87 years) underwent a MBP at the authors' institution. The main indication was annuloaortic ectasia in 102 patients (41%), followed by acute aortic dissection in 82 patients (33%); moderate to severe aortic regurgitation was present in 79% of cases. A bicuspid aortic valve was found in 17% of patients, and Marfan syndrome in 7%. The mean NYHA functional class was 2.5 ± 1.1. Concomitant procedures were performed in 36 patients (14%). The mean follow up was 8.7 ± 5.0 years (range: 0.3-21.5 years) and was 99% complete. The total follow up was 6.475 patient-years (pt-yr). Operative mortality was 3% in elective cases. Age, prolonged cardiopulmonary bypass times and mechanical ventilation >96 h were independent risk factors for early mortality. Actuarial survival at 15 and 20 years was 62% and 60%, respectively. Risk factors for late mortality were age and emergency operation. Actuarial freedom from thromboembolism (linearized incidence 0.93%/pt-yr) was 82% at 15 years, and 74% at 20 years. Seven patients required reoperation (0.38%/pt-yr), with an actuarial freedom from reoperation of 91% at 15 years and 87% at 20 years. The incidence of overall valve-related complications was 0.32%/pt-yr, with actuarial freedoms of 94% at 15 and 20 years. The MBP has shown excellent long-term results with a low incidence of procedure-related complications up to 20 years postoperatively. For this reason, it is considered to be a valid option for the treatment of aortic root disease, whenever valvesparing procedures are not indicated.

  7. 77 FR 20408 - [FWS-R9-MB-2011-N215; 91400-5110-0000-7B; 91400-9410-0000-7B

    Science.gov (United States)

    2012-04-04

    ... Sport Wildlife Management 50,000.00 50,000.00 100,000.00 Fish Restoration Program Institute. 75th... the fiscal year 2012, priority list of wildlife and sport fish conservation projects from the Association of Fish and Wildlife Agencies (AFWA). As required by the Wildlife and Sport Fish Restoration...

  8. Study on the aligned uranium-235 nuclear decay in the neutron energy range of 1.7 eV - 2.15 keV

    International Nuclear Information System (INIS)

    Danelyan, L.S.; Zakharov, Yu.V.; Zykov, V.M.; Mostovoj, V.I.; Stolyarov, V.A.; Biryukov, S.A.; Zysina, N.Yu.; Osochnikov, A.A.; Svettsov, A.V.

    1983-01-01

    Using a time-of-flight neutron spectrometer comparative measurements of intensity of fission reaction on the aligned and non-oriented uranium-235 nuclei have been performed in order to identify the resonances caused by p-neutron capture as well as to determine the p-neutron contribution to the fission cross section in the region of unresolved resonances. In some isolated resonances differences in cross sections on aligned and non-oriented nuclei of about 10% have been observed which can permit to assi.on them to p-resonances. In the region of unresolved resonances in the 0.15-2.15 keV neutron energy range to the accuracy +-1% no changes in the fission cross section during the nuclear alignment have been observ

  9. Measurement of absolute myocardial blood flow with H215O and dynamic positron-emission tomography. Strategy for quantification in relation to the partial-volume effect

    International Nuclear Information System (INIS)

    Iida, H.; Kanno, I.; Takahashi, A.

    1988-01-01

    An in vivo technique was developed for measuring the absolute myocardial blood flow with H 2 15 O and dynamic positron-emission tomography. This technique was based on a new model involving the concept of the tissue fraction, which was defined as the fraction of the tissue mass in the volume of the region of interest. The myocardium was imaged dynamically by positron-emission tomography, starting at the time of intravenous bolus injection of H 2 15 O. The arterial input function was measured continuously with a beta-ray detector. A separate image after C 15 O inhalation was also obtained for correction of the H 2 15 O radioactivity in the blood. The absolute myocardial blood flow and the tissue fraction were calculated for 15 subjects with a kinetic technique under region-of-interest analysis. These results seem consistent with their coronary angiographic findings. The mean value of the measured absolute myocardial blood flows in normal subjects was 0.95 +/- 0.09 ml/min/g. This technique detected a diffuse decrease of myocardial blood flow in patients with triple-vessel disease

  10. 31 CFR 535.215 - Direction involving other properties in which Iran or an Iranian entity has an interest held by...

    Science.gov (United States)

    2010-07-01

    ... based upon the International Emergency Economic Powers Act. (b) Any properties subject to a valid... shall include arrangements for payment of the costs of transporting the properties, unless the...

  11. Fabrication and post-irradiation examination of a zircaloy-2 clad UO2-1.5 wt% PuO2 fuel pin irradiated in PWL, CIRUS

    International Nuclear Information System (INIS)

    Sah, D.N.; Sahoo, K.C.; Chatterjee, S.; Majumdar, S.; Kamath, H.S.; Ramachandran, R.; Bahl, J.K.; Purushottam, D.S.C.; Ramakumar, M.S.; Sivaramakrishnan, K.S.; Roy, P.R.

    1977-01-01

    A zircaloy-2 clad UO 2 -1.5 wt% PuO 2 fuel pin was fabricated at the Radiometallurgy Section of the Bhabha Atomic Research Centre, Bombay, for irradiation in the pressurised water loop in CIRUS. Requisite development work related to powder conditioning, blending, pressing and sintering parameters was carried out to meet the exacting fuel pellet specifications of CANDU fuel. The fuel pin ruptured while being irradiated in the pressurised water loop in CIRUS, after experiencing a low burn-up of 507 MWD/MTM and was subsequently examined at the Radiometallurgy Hot Cells Facility. The results showed that internal clad hydriding led to primary failure of the fuel pin. Subsequent ingress of the coolant water caused excessive swelling of the thermal insulating magnesia pellets located at the ends of the fuel column. The swelling of magnesia pellets caused severe rupturing of the fuel pin at the two ends. The delayed rupturing of the fuel pin at the upper end, caused the fuel column to be displaced downwards by 5.85mm. (author)

  12. Bone Metabolism after Total Hip Revision Surgery with Impacted Grafting: Evaluation using H215O and [18F]fluoride PET; A Pilot Study

    NARCIS (Netherlands)

    Temmerman, Olivier; Raijmakers, Pieter; Heyligers, Ide; Comans, Emile; Lubberink, Mark; Teule, Gerrit; Lammertsma, Adriaan

    2008-01-01

    Purpose: To evaluate bone blood flow and bone formation in patients after total hip revision surgery with impacted bone grafting using H2 15O and [18F]fluoride positron emission tomography (PET). Procedures: To asses bone blood flow and bone metabolism in bone allograft after impaction grafting,

  13. SU-F-T-215: An Investigation Of Multi-Scanner CT Hounsfield Unit Calibration for Pencil Beam Scanning Proton Therapy Using 3D Gamma Analysis

    International Nuclear Information System (INIS)

    Zhang, J; Li, X; Liu, G; Liu, Q; Liang, J; Ding, X

    2016-01-01

    Purpose: We compare and investigate the dosimetric impacts on pencil beam scanning (PBS) proton treatment plans generated with CT calibration curves from four different CT scanners and one averaged ‘global’ CT calibration curve. Methods: The four CT scanners are located at three different hospital locations within the same health system. CT density calibration curves were collected from these scanners using the same CT calibration phantom and acquisition parameters. Mass density to HU value tables were then commissioned in a commercial treatment planning system. Five disease sites were chosen for dosimetric comparisons at brain, lung, head and neck, adrenal, and prostate. Three types of PBS plans were generated at each treatment site using SFUD, IMPT, and robustness optimized IMPT techniques. 3D dose differences were investigated using 3D Gamma analysis. Results: The CT calibration curves for all four scanners display very similar shapes. Large HU differences were observed at both the high HU and low HU regions of the curves. Large dose differences were generally observed at the distal edges of the beams and they are beam angle dependent. Out of the five treatment sites, lung plans exhibits the most overall range uncertainties and prostate plans have the greatest dose discrepancy. There are no significant differences between the SFUD, IMPT, and the RO-IMPT methods. 3D gamma analysis with 3%, 3 mm criteria showed all plans with greater than 95% passing rate. Two of the scanners with close HU values have negligible dose difference except for lung. Conclusion: Our study shows that there are more than 5% dosimetric differences between different CT calibration curves. PBS treatment plans generated with SFUD, IMPT, and the robustness optimized IMPT has similar sensitivity to the CT density uncertainty. More patient data and tighter gamma criteria based on structure location and size will be used for further investigation.

  14. Non-invasive estimation of hepatic blood perfusion from H215O PET images using tissue-derived arterial and portal input functions

    International Nuclear Information System (INIS)

    Kudomi, N.; Slimani, L.; Jaervisalo, M.J.; Lautamaeki, R.; Naum, G.A.; Knuuti, J.; Kiss, J.; Savunen, T.; Iida, H.; Nuutila, P.; Iozzo, P.

    2008-01-01

    The liver is perfused through the portal vein and the hepatic artery. When its perfusion is assessed using positron emission tomography (PET) and 15 O-labeled water (H 2 15 O), calculations require a dual blood input function (DIF), i.e., arterial and portal blood activity curves. The former can be generally obtained invasively, but blood withdrawal from the portal vein is not feasible in humans. The aim of the present study was to develop a new technique to estimate quantitative liver perfusion from H 2 15 O PET images with a completely non-invasive approach. We studied normal pigs (n=14) in which arterial and portal blood tracer concentrations and Doppler ultrasonography flow rates were determined invasively to serve as reference measurements. Our technique consisted of using model DIF to create tissue model function and the latter method to simultaneously fit multiple liver time-activity curves from images. The parameters obtained reproduced the DIF. Simulation studies were performed to examine the magnitude of potential biases in the flow values and to optimize the extraction of multiple tissue curves from the image. The simulation showed that the error associated with assumed parameters was 2 15 O PET imaging. This suggests the possibility to enable completely non-invasive technique to assess liver perfusion in patho-physiological studies. (orig.)

  15. SU-G-IeP2-15: Virtual Insertion of Digital Kidney Stones Into Dual-Source, Dual- Energy CT Projection Data

    Energy Technology Data Exchange (ETDEWEB)

    Ferrero, A; Chen, B; Huang, A; Montoya, J; Yu, L; McCollough, C [Mayo Clinic, Rochester, MN (United States)

    2016-06-15

    Purpose: In order to investigate novel methods to more accurately estimate the mineral composition of kidney stones using dual energy CT, it is desirable to be able to combine digital stones of known composition with actual phantom and patient scan data. In this work, we developed and validated a method to insert digital kidney stones into projection data acquired on a dual-source, dual-energy CT system. Methods: Attenuation properties of stones of different mineral composition were computed using tabulated mass attenuation coefficients, the chemical formula for each stone type, and the effective beam energy at each evaluated tube potential. A previously developed method to insert lesions into x-ray CT projection data was extended to include simultaneous dual-energy CT projections acquired on a dual-source gantry (Siemens Somatom Flash). Digital stones were forward projected onto both detectors and the resulting projections added to the physically acquired sinogram data. To validate the accuracy of the technique, digital stones were inserted into different locations in the ACR CT accreditation phantom; low and high contrast resolution, CT number accuracy and noise properties were compared before and after stone insertion. The procedure was repeated for two dual-energy tube potential pairs in clinical use on the scanner, 80/Sn140 kV and 100/Sn140 kV, respectively. Results: The images reconstructed after the insertion of digital kidney stones were consistent with the images reconstructed from the scanner. The largest average CT number difference for the 4 insert in the CT number accuracy module of the phantom was 3 HU. Conclusion: A framework was developed and validated for the creation of digital kidney stones of known mineral composition, and their projection-domain insertion into commercial dual-source, dual-energy CT projection data. This will allow a systematic investigation of the impact of scan and reconstruction parameters on stone attenuation and dual-energy behavior under rigorously controlled conditions. Dr. McCollough receives research support from Siemens Healthcare.

  16. Effects of Lactobacillus formosensis S215Tand Lactobacillus buchneri on quality and in vitro ruminal biological activity of condensed tannins in sweet potato vines silage.

    Science.gov (United States)

    Mangwe, M C; Rangubhet, K T; Mlambo, V; Yu, B; Chiang, H I

    2016-11-01

    This study investigated the influence of two microbial inoculants; Lactobacillus formosensis and Lactobacillus buchneri on fermentation quality, chemical composition, aerobic stability and in vitro ruminal biological activity of condensed tannins in sweet potato vines silage. Sweet potato vines were ensiled for 28 and 60 days; without inoculant (CON), with Lact. buchneri (LB) or with Lact. formosensis (LF), both inoculants applied to achieve 1 × 10 6  CFU g -1 fresh forage. Lactobacillus formosensis silage had lower pH and higher lactic acid than all treatments. Yeasts and moulds were not detected in LB silage after ensiling. Lactobacillus buchneri silage was more aerobically stable than all treatments, whereas LF was more stable than CON silage. In vitro ruminal biological activity of condensed tannins was lower in microbial-inoculated silages than CON after ensiling. Lactobacillus formosensis improved fermentability by reducing silage pH and improved aerobic stability by producing more propionate, which inhibited yeast activity. Lactobacillus buchneri improved aerobic stability of the silage by producing more acetate. Both strains effectively reduced the antinutritional effect of condensed tannins after ensiling. Lactobacillus formosensis has the potential to be used as a silage inoculant because of its ability to improve fermentability and aerobic stability in sweet potato vines silage. © 2016 The Society for Applied Microbiology.

  17. Assessment of the perfusion of glioblastomas before and during radiotherapy: longitudinal comparison between H2-15O positron emission tomography and perfusion MRI

    International Nuclear Information System (INIS)

    Laprie, A.; Ken, S.; Moyal Cohen-Jonathan, E.; Laprie, A.; Ken, S.; Lotterie, J.A.; Franceries, X.; Celsis, P.; Payoux, P.; Berry, I.; Lotterie, J.A.; Berry, I.; Barcelo, C.

    2010-01-01

    The authors report the comparison of different perfusion imagery modalities for patients suffering form glioblastomas and included in a phase-1 clinic trial comprising conformational radiotherapy concomitant with the use of a farnesyl-transferase inhibitor (tipifarnib). With these different techniques, perfusion MRI and perfusion positron emission tomography, the authors made respectively a qualitative and quantitative assessment of the tumour vascularisation. Short communication

  18. Ultrasound-induced martensitic transition in ferromagnetic Ni2.15Mn0.81Fe0.04Ga shape memory alloy

    International Nuclear Information System (INIS)

    Buchelnikov, V.; Dikshtein, I.; Grechishkin, R.; Khudoverdyan, T.; Koledov, V.; Kuzavko, Y.; Nazarkin, I.; Shavrov, V.; Takagi, T.

    2004-01-01

    The experimental observation of direct and reverse martensitic transformation due to ultrasound processing of Ni-Mn-Ga alloy is discussed. It was found that martensite-austenite as well as austenite-martensite structural transitions can be induced by the intense ultrasound at constant temperature. During the experiments low magnetic field susceptibility measurements and optical detection of twin domains arising due to martensitic transformation were performed in situ. The non-thermal nature of the effect is confirmed making use of the pulsed ultrasound technique

  19. Determination of {sup 227}Ac by {alpha}-particle spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Martin, P. [Environmental Research Inst. of the Supervising Scientist, Jabiru, NT (Australia); Hancock, G.J. [Commonwealth Scientific and Industrial Research Organization, Canberra, ACT (Australia). Div. of Water Resources; Paulka, S. [Australian Radiation Lab., Yallambie, VIC (Australia); Akber, R.A. [Queensland Univ. of Technology, Brisbane, QLD (Australia)

    1995-10-01

    A method is described for the determination of {sup 227}Ac concentration in environmental samples. Actinium is separated from the sample digest by co-precipitation with lead sulphate, purified using anion and cation exchange techniques, and electrodeposited onto a stainless-steel disc. The chemical yield is monitored by addition of a {sup 229}Th/{sup 225}Ra/{sup 225}Ac tracer before sample dissolution. {sup 225}Ac recovery is determined from an initial count by measurement of its {alpha}-emitting daughter, {sup 217}At. The disc is then stored for 2-3 months and recounted. The {sup 227}Ac activity is obtained by measurement of the ingrown {sup 227}Th and {sup 223}Ra activities in the 5.38-6.10 MeV region. Co-precipitation with lead sulphate enables the convenient determination of actinium, thorium and radium on the same sample digest. (author).

  20. Status of liquid metal reactor development in the United States of America

    International Nuclear Information System (INIS)

    Griffith, J.D.; Horton, K.E.

    1991-01-01

    An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

  1. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira

    2007-11-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  2. Determination of radionuclides in discharged water from gold ...

    African Journals Online (AJOL)

    Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

  3. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    Ahlquist, A.J.

    1981-01-01

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  4. Tumor Immunotargeting Using Innovative Radionuclides

    OpenAIRE

    Françoise Kraeber-Bodéré; Caroline Rousseau; Caroline Bodet-Milin; Cédric Mathieu; François Guérard; Eric Frampas; Thomas Carlier; Nicolas Chouin; Ferid Haddad; Jean-François Chatal; Alain Faivre-Chauvet; Michel Chérel; Jacques Barbet

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others a...

  5. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  6. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Moulin, J.

    2008-06-01

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  7. Efeito da implantação de rodovias no cerrado brasileiro sobre a fauna de vertebrados - DOI: 10.4025/actascibiolsci.v28i3.215 Effect of the implantation of roads in the brazilian cerrado on the fauna of vertebrates - DOI: 10.4025/actascibiolsci.v28i3.215

    Directory of Open Access Journals (Sweden)

    Zara Faria Sobrinha Guimarães

    2007-11-01

    Full Text Available A fragmentação de hábitat causada pela ação humana vem sendo um dos grandes desafios para a biologia da conservação. A construção de estradas é um mecanismo de fragmentação de alto impacto, removendo a cobertura vegetal original, gerando efeito de borda e alterando a função e estrutura da paisagem, em contraste com a necessidade e o alto valor econômico imposto pela sociedade humana. Neste sentido, este estudo teve como objetivo avaliar o impacto da estrada na comunidade de fauna silvestre do Parque Altamiro de Moura Pacheco associada à presença da rodovia (BR-153/GO-060. Durante um ano de pesquisa, foram registrados 141 animais mortos por atropelamento. Os resultados do presente estudo, conduzido de Agosto/2003 a Julho/2004, foram comparados e analisados com estudo feito entre os anos de 1996 e 1997, tanto ao nível de carcaças encontradas quanto ao nível de ambiente. De acordo com os dados apresentados, reforça-se a necessidade de haver um melhor planejamento ao construir estradas, principalmente próximos a ambientes preservados ou unidades de conservação.The fragmentation of habitat caused by the action human being is comes one of the great challenges for the biology of the conservation. The construction of roads is a mechanism of the fragmentation of high impact, removing the original vegetablel covering, generating edge effect and modifying the function and structure of the landscape, in contrast with the necessity and the high economic value tax for the society human being. In this direction, this study it had as objective to evaluate the impact of the road in the community of wild fauna of the Park Altamiro de Moura Pacheco associated with the presence of the road (BR-153/GO-060. During one year of research, they had been registered 141 animals died for running over The results of the present study, lead of Agosto/2003 the Julho/2004, had been compared and analyzed with made study it enters the years of 1996 and 1997, as much the level of finded species how much the environment level. In accordance with the presented data, it is strengthened necessity to have one better planning when constructing roads, mainly next the preserved environments or units to conservation.

  8. Neutron Flux Depression in the UO{sub 2}-PuO{sub 2}(15 to 30%) Fuel Rods from IVO-FR2-Vg7-Irradiation Experiment; Depresion de flujo neutronico en las barras combustibles de UO2-PuO2(15 al 30%) del experimento de irradiacion IVO-FR2-Vg7

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, J.; Fernandez, J. L.

    1983-07-01

    The thermal-neutron flux depression within a fuel rod has a great influence in the radial temperature profile of the rod, especially for high enrichment fuel. For this reason, a study was made about the UO{sub 2}-PUO{sub 2} (15 to 30% PUO{sub 2}) fuel pins for the KfK-JEN joint irradiation program IVO, in the FR2 reactor. Different methods (diffusion, Bonalumi, successive generations) were compared and a new approach (parabolic approximation) was developed. (Author) 22 refs.

  9. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    International Nuclear Information System (INIS)

    P. Bernot

    2005-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  10. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  11. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  12. Towards energy-efficient territories: which choices for the territorial organisation? ADeus' Notes Nr 214. Towards territories producing renewable energies. ADeus' Notes Nr 215, November 2016

    International Nuclear Information System (INIS)

    Pons, Anne; Gendron, Yves; Isenmann, Jean; Masse, Camille; Berlet, Jessica; Mallick, Amandine; Martin, Stephanie; Delahaye, Mathilde; Muller, Lisa

    2016-11-01

    After having outlined that each territory does not possess the same potential in terms of energy efficiency, a first issue of this publication outlines the role of territorial planning to improve performance and efficiency of the built environment, to develop infrastructures and to improve their quality, to organise mobility demand, to put back the car to a right place, to reduce and to optimise goods road transport. It also notices that planning is not enough: individuals must somehow be constrained and encouraged, and changes of practices on the long term must be promoted. A panel of solutions to be adapted to the local context is then proposed for different situations related to mobility and transport. The second issue first outlines how to valorise local energy potentials by promoting energy saving and energy efficiency, by choosing the right energy for the right usage. It shows how to promote interdependency and solidarity between territories as far as energy production and consumption are concerned. It describes how to plan renewable energy sites in town planning documents

  13. Relationship between foot sensibility and postural control in the young and elderly. http://dx.doi.org/10.5007/1980-0037.2013v15n1p215

    Directory of Open Access Journals (Sweden)

    Letícia Suemi Ueda

    2013-03-01

    Full Text Available Impairments in the foot sensitivity in the elderly cause changes in locomotion and postural control that may increase fall risk. Understanding the use of foot afference in the elderly may help preventing loss of mobility and fall. However, there are few studies addressing the relation between the sensitivity of different foot regions and postural control. To investigating this lack in literature, the objective of our study was to assess the relationship between foot sensibility and postural control in young and elderly. Forty-two subjects volunteered to this study; they were assigned to a group according to their age (young or elderly. The participants were assessed regarding anthropometry, foot sensibility (using monofilaments and postural control (using a force plate. The indexes of foot sensibility and postural control were correlated and compared between the groups. Elderly had worst foot sensibility and postural control than young. Center of pressure are and amplitude in antero-posterior direction were correlated with the general foot sensibility, but not with a specific point of the foot in the elderly. For young, the sensitivity in the forefoot region was related to improved postural control.

  14. From Soft Power to Economic Diplomacy? A Comparison of the Changing Rationales and Roles of the U. S. and Canadian Federal Governments in International Education. Research & Occasional Paper Series: CSHE.2.15

    Science.gov (United States)

    Trilokekar, Roopa Desai

    2015-01-01

    Through a historical and comparative analysis of international education policy development in Canada and the U.S., this paper will map the similarities and differences in the two countries. It will highlight the contributions and challenges of the government's involvement in international education (IE) in the two federal states and in…

  15. Report made on the behalf of the Commission of foreign affairs, defence and armed forces on the bill project authorizing the ratification of the international convention for the repression of acts of nuclear terrorism - Nr 215

    International Nuclear Information System (INIS)

    Pintat, Xavier

    2012-01-01

    In a first part, this report recalls that the terrorist threat has already been addressed by texts which have been negotiated within the United Nations. It describes how the content of the convention has been elaborated while taking into account existing conventions related to nuclear issues. It outlines that this text is the fruit of the efforts made by a special committee created by the U N, and by the Lyons-Rome group within the G8. The second part comments how this convention is based on other conventions already ratified by France, notably the conventions of 1980 and 1997 on the physical protection of nuclear material. It outlines the important progress contained by this convention regarding incriminations of acts of nuclear terrorism and their crackdown

  16. Nr 215 - Report made on the behalf of the Foreign affairs, defence and armed forces Commission on the bill project authorizing the approval of the International Convention for the Repression of Acts of Nuclear Terrorism

    International Nuclear Information System (INIS)

    Pintat, Xavier

    2012-01-01

    This report first recalls that the suppression of terrorist threat has already been the object of several texts negotiated under the aegis of UNO, that the current convention has been elaborated by taking existing conventions related to nuclear into account, and that this convention is the result of efforts made by the special committee created by the UNO and the G8 'Lyon-Rome' group. In a second part, the author shows that this text is based on conventions already ratified by France. As shown in a table containing the convention articles and the associated obligations for states after ratification, this agreement contains important progresses in terms of incriminations of acts of nuclear terrorism and their suppression

  17. Tensile/compressive behaviour of non-lyered tetragonal Ni.sub.52.8./sub.Mn.sub.25.7./sub.Ga.sub.21.5./sub. alloy

    Czech Academy of Sciences Publication Activity Database

    Söderberg, O.; Straka, L.; Novák, Václav; Heczko, O.; Hannula, S.-P.; Lindroos, V. K.

    2004-01-01

    Roč. 386, - (2004), s. 27-33 ISSN 0921-5093 Institutional research plan: CEZ:AV0Z1010914 Keywords : Ni-Mn-Ga alloys * tensile testing * twinning Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.445, year: 2004

  18. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VGI 60 ... Query: 156 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 215 ... VGGFNKDRTPFLKYVDLLGVTYHASTM...ATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK Sbjct: 121 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 180 ...

  19. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 60 ... Query: 156 MKNNGVNLYAISVQNEPDYAHEWTWWTPQEILRFMRENAGSINARVIAPESFQYLKNLSD 215 ... ... ... MKNNGVNLYAISVQNEPDYAHEWTWWTPQEILRFMRENAGSINARVIAPESFQYLKNLSD Sbjct: 121 MKNNGVNLYAISVQNEPDYAHEWTWWTP

  20. 78 FR 21850 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

    Science.gov (United States)

    2013-04-12

    ... for uploading business clearance documentation in the Contract Business Analysis Repository (CBAR). 2.... PART 215--CONTRACTING BY NEGOTIATION 0 2. Section 215.406-3 is revised to read as follows: 215.406-3 Documenting the negotiation. Follow the procedures at PGI 215.406-3 for documenting the negotiation and...

  1. Reconstitution of normal and hyperactivated forms of casein kinase-2 by variably mutated beta-subunits

    DEFF Research Database (Denmark)

    Boldyreff, B; Meggio, F; Pinna, L A

    1993-01-01

    -terminal part (mutants beta delta 209-215, beta delta 194-215, beta delta 181-215, beta delta 171-215, beta delta 150-215) or have undergone Ala substitutions for the acidic and basic residues which are concentrated in the sequences 55-70 and 171-180, respectively. All these mutants have been examined...... for their ability to functionally replace the wild type beta-subunit. All substitutions and the deletions delta 1-4, delta 194-215, and delta 209-215 are compatible with effective binding of the catalytic alpha-subunit, as judged by sucrose density gradient analysis, stimulation of catalytic activity...

  2. Analytical methodology for radium in food and water

    International Nuclear Information System (INIS)

    Baratta, E.J.

    1990-01-01

    The hazards associated with radium-226 and radium-228 have been well studied and documented. Analysis at the levels set by the Environmental Protection Agency for these two isotopes in drinking water should present no analytical problems. The methods for radium-226 by total radium and emanation have been collaboratively studied and published in the ALPHA Standard Methods. The method of Krieger for radium-228, although it has not been collaboratively tested, has the tentative approval of the American Public Health Association (ALPHA) Standard Methods and was recommended by the National Institute for Science and Technology. In this method the radium is precipitated using barium and lead carriers, then purified and the actinium-228 allowed to ingrow. It is separated using a yttrium carrier and the actinium-228 is beta counted. Other methods could also be used. It should be noted that the EPA's Quality Assurance Program should be used to document that the methods being used are performing adequately. 42 refs., 3 tabs

  3. Formerly utilized MED/AEC sites remedial action program: radiological survey of the former Linde Uranium Refinery, Tonawanda, New York. Final report

    International Nuclear Information System (INIS)

    Leggett, R.W.; Cottrell, W.D.; Burden, J.; Ryan, M.T.

    1978-05-01

    The results of a radiological survey of the Linde Air Products Division of Union Carbide Corporation, Tonawanda, New York, are presented. During the period 1940 to 1948, this site was used for the separation of UO 2 from uranium ores and for the conversion of UO 2 to UF 4 . Five buildings were involved in these operations. The survey included measurements of the following: residual alpha and beta-gamma contamination levels in these buildings; external gamma radiation levels at one meter above the surface in these buildings and outdoors throughout the Linde property; radon and radon daughter concentrations in the air in these buildings; uranium, radium, actinium, and thorium concentrations in soil samples taken both onsite and offsite; contamination in surface water on and near the site; and airborne concentrations of uranium, radium, and thorium in the building in which the separation process was carried out. Elevated concentrations of uranium, radium, and/or actinium were found in two of the buildings and outdoors in widely separated areas of the site. Alpha and beta-gamma contamination levels in some areas of the buildings were above limits set by current federal guidelines concerning the release of property for unrestricted use. Elevated external gamma radiation levels were measured at some outdoor locations and in three of the buildings. The concentration of radium in a water sample taken from an old conveyor pit in one of the buildings was in excess of the non-occupational maximum permissible concentration

  4. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  5. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    Riedhauser, S.R.

    1994-06-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  6. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  7. Late excretion of 231Pa and its decay products

    International Nuclear Information System (INIS)

    Holtzman, R.B.; Ilcewicz, F.H.

    1978-01-01

    Excretion rates of members of the naturally-occurring actinium series (4n + 3) were determined for a 69-year-old man who had acquired 231 Pa(T/sub 1/2/ = 32500 yr) about 45 years prior to this investigation. The body contents determined by whole body counting were approximately 71 nCi of 231 Pa, 51 nCi each of 22 yr 227 Ac and 18.2 day 227 Th, and 39 nCi of 11.4 day 223 Ra. All urinary and fecal samples were collected, as were representative daily diets during the 10 days the subject was maintained on a metabolic ward. The samples were wet ashed with nitric acid. After separation the 231 Pa and 227 Th were electrodeposited on stainless steel and alpha counted. The 223 Ra was coprecipitated with BaSO 4 , mounted, and alpha counted. Actinium-227 was determined from the 227 Th daughter after a long growth period. The excretion rates varied quite dramatically over the 10-day study

  8. 76 FR 34289 - Proposed Agency Information Collection Activities; Comment Request

    Science.gov (United States)

    2011-06-13

    ... September 30, 2013. (11.) OMB No. 2130-0519, Bad Order and Home Shop Card (49 CFR part 215). The new... Reporting Mark on Freight Cars (49 CFR part 215). The new expiration date for this information collection is... 34290

  9. 76 FR 61296 - Defense Federal Acquisition Regulation Supplement: Contracting With the Canadian Commercial...

    Science.gov (United States)

    2011-10-04

    ..., public health and safety effects, distributive impacts, and equity). E.O. 13563 emphasizes the importance.... 1303 and 48 CFR chapter 1. PART 215--CONTRACTING BY NEGOTIATION 2. Amend section 215.403-1 by revising...

  10. Communication Satellites 1958 to 1986

    Science.gov (United States)

    1984-10-01

    CATALOG NUMBER S. TYRE OF REPORT * PERIOD COVERED Interim S. PERFORMING ORG. REPORT NUMBER TR-0084A(5417-03)-l S. CONTRACT OR GRANT NUMRERT...Intelsat Leases 7-211 Other Systems 7-215 The Philippines 7-215 Malaysia 7-215 Planned Systems 7-215 OTHER SATELLITES 8-1 Satellites for... industry . ( The purpose of this report is to describe and summarize the technical details of each type of communication satellite for the years 1958 to

  11. Table:2

    Indian Academy of Sciences (India)

    CHC+ 0.042261 -115.619792 -115.577531 -115.291056 -115.482384. c-C3H3+ 0.045333 -115.733846 -115.688513 -115.396826 -115.589954. H2CCCH+ +HF 0.052087 -216.111454 -215.059367 -215.631844 -215.944155. c-C3H3+ +HF ...

  12. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 32; Issue 3. Issue front cover thumbnail. Volume 32, Issue 3. June 2009, pages 215-367. pp 215-215. Foreword · S B Krupanidhi H L Bhat · More Details Fulltext PDF. pp 217-225. Molecule-based magnets · J V Yakhmi · More Details Abstract Fulltext PDF.

  13. 38 CFR 3.27 - Automatic adjustment of benefit rates.

    Science.gov (United States)

    2010-07-01

    ... amounts payable under section 215(i) of title II of the Social Security Act, VA shall, effective on the... amounts payable under section 215(i) of title II of the Social Security Act, VA shall, effective on the... Vietnam veterans. Whenever there is a cost-of-living increase in benefit amounts payable under section 215...

  14. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-09-01

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

  15. Towards high-resolution laser ionization spectroscopy of the heaviest elements in supersonic gas jet expansion.

    Science.gov (United States)

    Ferrer, R; Barzakh, A; Bastin, B; Beerwerth, R; Block, M; Creemers, P; Grawe, H; de Groote, R; Delahaye, P; Fléchard, X; Franchoo, S; Fritzsche, S; Gaffney, L P; Ghys, L; Gins, W; Granados, C; Heinke, R; Hijazi, L; Huyse, M; Kron, T; Kudryavtsev, Yu; Laatiaoui, M; Lecesne, N; Loiselet, M; Lutton, F; Moore, I D; Martínez, Y; Mogilevskiy, E; Naubereit, P; Piot, J; Raeder, S; Rothe, S; Savajols, H; Sels, S; Sonnenschein, V; Thomas, J-C; Traykov, E; Van Beveren, C; Van den Bergh, P; Van Duppen, P; Wendt, K; Zadvornaya, A

    2017-02-22

    Resonant laser ionization and spectroscopy are widely used techniques at radioactive ion beam facilities to produce pure beams of exotic nuclei and measure the shape, size, spin and electromagnetic multipole moments of these nuclei. However, in such measurements it is difficult to combine a high efficiency with a high spectral resolution. Here we demonstrate the on-line application of atomic laser ionization spectroscopy in a supersonic gas jet, a technique suited for high-precision studies of the ground- and isomeric-state properties of nuclei located at the extremes of stability. The technique is characterized in a measurement on actinium isotopes around the N=126 neutron shell closure. A significant improvement in the spectral resolution by more than one order of magnitude is achieved in these experiments without loss in efficiency.

  16. Development of ion beam sputtering techniques for actinide target preparation

    International Nuclear Information System (INIS)

    Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

    1985-01-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

  17. The chemistry of the actinide elements. Volume I

    International Nuclear Information System (INIS)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

  18. Process for radioisotope recovery and system for implementing same

    Science.gov (United States)

    Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

    2009-10-06

    A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

  19. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    Higgo, J.J.W.

    1987-09-01

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  20. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

    1979-01-01

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  1. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    International Nuclear Information System (INIS)

    1979-09-01

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222 Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222 Rn from the site was observed

  2. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  3. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  4. Gas-phase structure of (1,1,1,5,5,5-hexafluoro-2,4-pentanedionato)(eta(2)-1,5-cyclooctadiene)copper(I), Cu(1,5-cod)(hfac), an important precursor for vapor deposition of copper

    Czech Academy of Sciences Publication Activity Database

    Hnyk, Drahomír; Bühl, M.; Brain, P. T.; Robertson, H. E.; Rankin, D. W. H.

    2002-01-01

    Roč. 124, č. 27 (2002), s. 8078-8084 ISSN 0002-7863 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : molecular-structure * electron-diffraction * basis-sets Subject RIV: CA - Inorganic Chemistry Impact factor: 6.201, year: 2002

  5. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  6. Scintillation properties of (Na.sub.0.425./sub.Lu.sub.0.575-x./sub.Nd.sub.x./sub.)F.sub.2.15./sub. and its comparison with (Ca.sub.1-x./sub.Nd.sub.x./sub.)F.sub.2+x./sub. and NdF.sub.3./sub..

    Czech Academy of Sciences Publication Activity Database

    Furuya, Y.; Tanaka, H.; Fukuda, K.; Kawaguchi, N.; Yokota, K.; Yanagida, T.; Pejchal, Jan; Chani, V.; Nikl, Martin; Yoshikawa, A.

    2011-01-01

    Roč. 8, č. 1 (2011), s. 136-139 ISSN 1862-6351 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillators * Nd 3+ 5d-4f transition * micro-pulling-down (μ-PD) method Subject RIV: BM - Solid Matter Physics ; Magnetism

  7. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LESG Sbjct: 1 ... LIASEFTYKKEEEIYGEDEPSEYVYQVVSGAVRSYKLLSDGRRQIGAFYLPGDVFGLESG 60 ... Query: 156 MERVANFLLEMDRRLA...VAGMMALPMCRRDIGDYLGLTLETVSRALSQLQSKGILGFSGAR 215 ... MERVANFLLEMDRRLAVAGMM...ALPMCRRDIGDYLGLTLETVSRALSQLQSKGILGFSGAR Sbjct: 121 MERVANFLLEMDRRLAVAGMMALPMCRRDIGDYLGLTLETVSRALSQLQSKGILGFSGAR 180 ...

  8. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... palustris CGA009] ... Length = 157 ... Query: 95 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDA...KIETVLSDNGREFCGRP 154 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETV...LSDNGREFCGRP Sbjct: 1 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETVLSDNGREFCGRP 60 ... Query: 215 LDDYLVGY

  9. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    International Nuclear Information System (INIS)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-01-01

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  10. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  11. Chlorophyll Diagenesis in the Water Column and Sediments of the Black Sea

    Science.gov (United States)

    1993-02-01

    in accumulation rates of Black Sea sediments inferred from Records of Laminae and 2 10Pb. Paleoceanography 7, 215-227. Czeczuga B. (1964) Quantitative...Sea sediments inferred from Records of Laminae and 2 10 Pb. Paleoceanography 7, 215-227. Degens E. T., Michaelis W., Garrasi C., Mopper K., Kempe S

  12. Growth and scintillation characteristics of CeF.sub.3./sub., PrF.sub.3./sub. and NdF.sub.3./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Shimamura, K.; Víllora, E. G.; Nakakita, S.; Nikl, Martin; Ichinose, N.

    2004-01-01

    Roč. 264, 208-215 (2004), s. 208-215 ISSN 0022-0248 R&D Projects: GA MŠk 1P04ME716 Institutional research plan: CEZ:AV0Z1010914 Keywords : Czochralski method * rare-earth compounds * scintillator materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.707, year: 2004

  13. A note on existence and stability of solutions for semilinear Dirichlet ...

    Indian Academy of Sciences (India)

    (Math. Sci.) Vol. 121, No. 2, May 2011, pp. 201–215. c Indian Academy of Sciences. A note on existence and stability of solutions for semilinear. Dirichlet problems. MAREK GALEWSKI. Institute of Mathematics, Technical University of Lodz, Wolczanska 215,. 90-924 Lodz, Poland. E-mail: marek.galewski@p.lodz.pl.

  14. 78 FR 38017 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2013-06-25

    ... DEPARTMENT OF DEFENSE Department of the Army [Docket ID USA-2013-0017] Privacy Act of 1974; System... at the Defense Privacy and Civil Liberties Office Web site at http://dpclo.defense.gov/privacy/SORNs...; Army Regulation 215-3, Nonappropriated Funds Personnel Policies and Procedures; Army Regulation 215-8...

  15. 76 FR 39977 - Petition for Waiver of Compliance

    Science.gov (United States)

    2011-07-07

    ...] Petition for Waiver of Compliance In accordance with Part 211 of Title 49 of the Code of Federal... compliance from certain provisions of the Federal railroad safety regulations contained at 49 CFR 215.303... waiver of compliance from certain provisions of the Railroad Freight Car Safety Standards, 49 CFR 215.303...

  16. 76 FR 80369 - Notice of a Regional Project Waiver of Section 1605 (Buy American) of the American Recovery and...

    Science.gov (United States)

    2011-12-23

    ... submitted by the County and its consulting engineer, EPA has concluded that there are no HVAC systems... Assistant Administrator of the Office of Administration and Resources Management has concurred on this... Director, (215) 814-2162, or David McAdams, Environmental Engineer, (215) 814-5764, Office of...

  17. Thermomechanical processing of 5083 aluminum to increase strength without increasing susceptibility to stress corrosion cracking

    International Nuclear Information System (INIS)

    Edstrom, C.M.; Blakeslee, J.J.

    1980-01-01

    5083 aluminium with 25% cold work must be processed above 215 0 C or below 70 0 C to avoid forming continuous precipitate in the grain boundaries which makes the material susceptible to stress corrosion cracking. Time at temperature above 215 0 C should be held to minimum (less than 30 min) to retain some strength from the 25% cold work

  18. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 54; Issue 2. Volume 54, Issue 2. February 2000, pages 215-330 and L331-L336. pp 215-225 ... Estimation of light transport parameters in biological media using coherent backscattering · S Anantha Ramakrishna K Divakara Rao · More Details Abstract Fulltext PDF.

  19. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 2006 Honorary. Klein, Michael L FRS. Date of birth: 1940. Address: Director, ICMS, Temple University, CST, SERC Building, 704E, 1925 North 12th Street, Philadelphia, PA 19122, U.S.A.. Contact: Office: (+1-215) 898 8571. Fax: (+1-215) 898 8296. Email: mlklein@temple.edu.

  20. 76 FR 75461 - Express Mail Domestic Postage Refund Policy and Waiver of Signature

    Science.gov (United States)

    2011-12-02

    ... signature. * * * * * 115 Mail Preparation * * * * * 2.0 Express Mail Next Day and Second Day * * * * * 2.2... 215.2.2 for more information regarding the addressee's signature. * * * * * 215 Mail Preparation... Mail Preparation * * * * * 2.0 Express Mail Next Day and Second Day * * * * * 2.2 Waiver of Signature...

  1. 78 FR 38337 - Submission for OMB Review; Tangible Personal Property Report (SF-428A, 428B, and 428C)

    Science.gov (United States)

    2013-06-26

    ...-acquired equipment in Obtain the approval of Acquiring replacement 2 CFR 215.34(e) A-102, -- which the... the replacement equipment. Compensate the Equipment has a per unit 2 CFR 215.34(g) A-102, -- original... property, or equipment and supplies (tangible personal property) acquired with assistance award funds. The...

  2. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 114; Issue 2. A Variational Proof for the Existence of a Conformal Metric with Preassigned Negative Gaussian Curvature for Compact Riemann Surfaces of Genus >1. Rukmini Dey. Erratum Volume 114 Issue 2 May 2004 pp 215-215 ...

  3. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 54; Issue 2. Volume 54, Issue 2. February 2000, pages 215-330 and L331-L336. pp 215-225 Research Articles. Static charged spheres with anisotropic pressure in general relativity · J Krishna Rao M Annapurna M M Trivedi · More Details Abstract Fulltext PDF.

  4. Kinetics of the methylglyoxal scavenging by antidiabetic biguanide drugs investigated using ion transfer voltammetry and capillary electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Langmaier, Jan; Samec, Zdeněk; Tůma, P.; Samcová, E.

    2015-01-01

    Roč. 61, č. 3 (2015), s. 215-215 ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR(CZ) GA15-03139S Institutional support: RVO:61388955 Keywords : electrochemistry * methylglyoxal * electrophoresis Subject RIV: CG - Electrochemistry

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 215 of 215 ... Vol 17, No 2 (2005), Toxicity of Raphia vinifera, P. beauv fruit extracts on biochemical composition of Nile Tilapia (Oreochromis niloticus, Trewavas) ... Vol 18, No 1 (2006), Vitamin b12 supplementation: effects on some biochemical and haematological indices of rats on phenytoin administration ...

  6. Impact of nucleotide polymorphisms at drug resistance sites on ...

    African Journals Online (AJOL)

    Rachel

    2011-11-02

    Nov 2, 2011 ... is replaced by AAG in most subtypes C viruses. Similarly,. AAC is the codon that predominates in subtype B viruses at position T215, whereas ACT encodes T215 in most A and all recombinant A/E viruses. Also, V106 is encoded by GTG in majority of subtype C viruses and about half of subtype D viruses.

  7. Cancer and African Americans

    Science.gov (United States)

    ... 7 2.3 Source: NCI 2016. Seer Cancer Statistics Review, 1975-2013. Tables 2.15 through 24.15 http://seer.cancer. ... 7 1.0 Source: NCI 2016. Seer Cancer Statistics Review, 1975-2013. Tables 2.15 through 24.15 http://seer.cancer. ...

  8. Change management

    CSIR Research Space (South Africa)

    Herselman, M

    2014-12-01

    Full Text Available .......................................................................................................... 212 6.4 References ....................................................................................................... 213 Section 7. Sustainability and Value through Improved Decision-making ........................... 215 7.1 Introduction... ..................................................................................................... 215 7.2 Sustainability and value in ICT4D initiatives ..................................................... 216 7.3 A decision-making view on sustainability ......................................................... 219 7.4 Understanding costs: Total...

  9. 75 FR 57719 - Federal Acquisition Regulation; TINA Interest Calculations

    Science.gov (United States)

    2010-09-22

    ... compounding. The Truth in Negotiation Act (TINA) also references 26 U.S.C. 6621 for interest calculation. This...-AL73 Federal Acquisition Regulation; TINA Interest Calculations AGENCIES: Department of Defense (DoD... clauses at FAR 52.214-27, 52.215-10 and 52.215-11 to require compound interest calculations be applied to...

  10. Klein, Michael L

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 2006 Honorary. Klein, Michael L FRS. Date of birth: 1940. Address: Director, ICMS, Temple University, CST, SERC Building, 704E, 1925 North 12th Street, Philadelphia, PA 19122, U.S.A.. Contact: Office: (+1-215) 898 8571. Fax: (+1-215) 898 8296. Email: mlklein@temple.edu.

  11. 48 CFR 570.601 - FAR provisions and clauses.

    Science.gov (United States)

    2010-10-01

    ... Business Participation Program—Targets.52.219-25Small Disadvantaged Business Participation Program...-24Preaward On-Site Equal Opportunity Compliance Review. (i) you require cost or pricing data for work or services exceeding $500,000 52.215-10Price Reduction for Defective Cost or Pricing Data.52.215...

  12. 78 FR 13544 - Defense Federal Acquisition Regulation Supplement: Acquisition of Tents and Other Temporary...

    Science.gov (United States)

    2013-02-28

    ... equity). E.O. 13563 emphasizes the importance of quantifying both costs and benefits, of reducing costs...: Authority: 41 U.S.C. 1303 and 48 CFR chapter 1. PART 215--CONTRACTING BY NEGOTIATION 0 2. Subpart 215.1 is...

  13. Review of radionuclide source terms used for performance-assessment analyses

    International Nuclear Information System (INIS)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

  14. Alpha-emitting nuclides in the marine environment

    Science.gov (United States)

    Pentreath, R. J.

    1984-06-01

    The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.

  15. Cyclotron production of cesium radionuclides as analogues for francium-221 biodistribution

    International Nuclear Information System (INIS)

    Finn, R.; McDevitt, M.; Sheh, Y.; Lom, C.; Qiao, J.; Cai, S.; Burnazi, E.; Nacca, A.; Pillarsetty, N.; Jaggi, J.; Scheinberg, D.

    2005-01-01

    In our clinical investigations focussing on improved therapeutic treatment of specific tumors we have concentrated on a targeted therapy approach utilizing designed radiolabeled monoclonal antibodies as the cytotoxic reagent. The physical characteristics of the alpha particle emitting radionuclide bismuth-213 including the short half-life of 45.6 min, has shown promise for the treatment of specific cancers such as leukemias and lymphomas or micrometastatic carcinomas. In an effort to increase the cytocidal effect of the HuM195, a humanized monoclonal antibody carrier to the CD33 antigen expressed on leukemia cells, our focus is directed toward an 'internal' nano-generator composed of Ac-225 radionuclide, the parent of the bismuth-213. The actinium-225 radionuclide decays through several short-lived, alpha emitting daughters including francium-221, astatine-217 and bismuth-213. In order to study the biodistribution and the pharmacokinetics of the individual daughter nuclide, francium-221, the cyclotron production and separation of cesium radionuclides, specifically cesium-132, from a natural xenon gas target was undertaken. The choice of cesium as an analogue for francium was predicated upon both elements being in Group 1A alkali metals and cesium radionuclide possesses a sufficient half-life to allow biodistribution studies to be performed. The preliminary experimental results of this investigation are presented

  16. Workplace monitoring and related health hazard evaluation in South African mining and mineral processing industries by application of nuclear and related analytical techniques

    International Nuclear Information System (INIS)

    Faanhof, Arnaud

    2000-01-01

    The South African Government notice R 849 (23 April 1994) requires application to the South African Council for Nuclear Safety (CNS) for a nuclear licence if materials are dealt with that contain more than 0,2 but less than 1 Becquerel per gram of any radionuclide of the natural uranium, thorium and actinium decay series. If the material is to be used in the construction of buildings the application should have been made before 1 April 1996, otherwise before 31 March 1999. The first phase of the monitoring programme assesses the observed radioactivity levels of waste products and the possible radiological impact on people working on site and living in the direct environment of the operational site. Information has been obtained on the radionuclide content and elemental composition of the various sources of the coal, waste ash, ash related products, crusher materials and effluent water. Except for the effluent and coal samples all other materials showed activity levels for one or more nuclides above the 0,2 Bq/g but not exceeding the 1 Bq/g level. Accordingly a first order assessment of the possible radiological impact on workers and the public has been performed for water consumption and dust inhalation. Actual dust concentrations recorded at various sites within the operational area are used to evaluate the yearly dose to workers. (author)

  17. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  18. Soil nuclide distribution coefficients and their statistical distributions

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

    1984-12-01

    Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

  19. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  20. The high-temperature vaporization/decomposition of actinide materials: fundamental and technological aspects

    International Nuclear Information System (INIS)

    Haire, R.G.

    1997-01-01

    The unique and variable chemistry exhibited across the actinide series offers a scientifically challenging group of elements. Investigations of their high-temperature materials science and thermodynamics can provide important insights into fundamental actinide science and generate critical information for technological applications. The wide variations in the physicochemical properties and the availability of the various actinide elements necessitates special experimental techniques be employed, even when investigating a single property (e.g., the enthalpy of vaporization). Experimental approaches range can from classical to novel methods to permit studies of the rarer and the more intensely radioactive members. We have developed special equipment and techniques to investigate the high-temperature, physicochemical properties of several actinides through Md, as well as the precursor elements, radium and actinium. These experimental approaches employed both alloys and solid solutions of compounds, in addition to the pure elements themselves. The vaporization/decomposition of compounds and the sublimation of the elements, together with the associated thermodynamics, are the main issues. Results for several of the actinide elements, some of the techniques employed and systematic comparisons of the thermochemical aspects of bonding are discussed to give a fuller understanding of the series as a whole. (orig.)