WorldWideScience

Sample records for actinium 215

  1. Spectroscopy of actinium-215 and (p,t) studies of the stable palladium isotopes

    Science.gov (United States)

    Winkler, Ryan

    2009-12-01

    The study of both the microscopic and macroscopic structural evolution of the atomic nucleus is presented in this work. The excited states of the N = 126 isotone 215Ac were investigated at WNSL using the gas-filled recoil separator SASSYER. Recoil-decay tagging of the gamma rays corresponding to the decay of 215Ac after production via a fusion-evaporation reaction was made possible by using the redesigned SASSYER focal plane apparatus, including the addition of a pair of DSSDs and the multi-wire avalanche counter MACY. A number of transitions feeding the 29/2+ isomeric state corresponding to the ( ph49/2 )⊗(pii13/2) configuration were observed and tentatively assigned as decays from the high-spin 35/2 +, 39/2+, and 41/2+ states. Additionally, the decay from the low-lying 13/2+ state, corresponding to a pii13/2 quasiparticle excitation, was observed at 859 keV. This excitation energy is consistent with the systematics of the lighter N = 126 isotones suggesting a decrease in the energy gap between the pih9/2 and pi i13/2 orbitals. High-resolution (p,t) spectroscopy of the stable, even-even Palladium isotopes was performed in the search for signatures of quantum phase transitional behavior. A total of 54 previously unidentified 0+, 2 +, and 4+ states below an excitation energy of 3.5 MeV were discovered in this experiment. No enhancement of the 0+ level density, a signature of first-order phase transitions in nuclei, was observed in the studied isotopes. A theoretical description of the population strengths of excited 0+ states in two-nucleon transfer reactions was investigated within the framework of the IBM. These studies reveal that an enhanced population strength is not exclusive to regions of shape-coexistence but rather is a measure of the magnitude of the "change of structure" from the initial to residual nucleus.

  2. Synthesis and Characterization of the Actinium Aquo Ion

    OpenAIRE

    Maryline G. Ferrier; Benjamin W. Stein; Enrique R. Batista; John M. Berg; Eva R. Birnbaum; Jonathan W. Engle; Kevin D. John; Stosh A. Kozimor; Juan S. Lezama Pacheco; Lindsay N. Redman

    2017-01-01

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H2O) x 3+) is critical for current ef...

  3. Synthesis and Characterization of the Actinium Aquo Ion.

    Science.gov (United States)

    Ferrier, Maryline G; Stein, Benjamin W; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Engle, Jonathan W; John, Kevin D; Kozimor, Stosh A; Lezama Pacheco, Juan S; Redman, Lindsay N

    2017-03-22

    Metal aquo ions occupy central roles in all equilibria that define metal complexation in natural environments. These complexes are used to establish thermodynamic metrics (i.e., stability constants) for predicting metal binding, which are essential for defining critical parameters associated with aqueous speciation, metal chelation, in vivo transport, and so on. As such, establishing the fundamental chemistry of the actinium(III) aquo ion (Ac-aquo ion, Ac(H 2 O) x 3+ ) is critical for current efforts to develop 225 Ac [ t 1/2 = 10.0(1) d] as a targeted anticancer therapeutic agent. However, given the limited amount of actinium available for study and its high radioactivity, many aspects of actinium chemistry remain poorly defined. We overcame these challenges using the longer-lived 227 Ac [ t 1/2 = 21.772(3) y] isotope and report the first characterization of this fundamentally important Ac-aquo coordination complex. Our X-ray absorption fine structure study revealed 10.9 ± 0.5 water molecules directly coordinated to the Ac III cation with an Ac-O H2O distance of 2.63(1) Å. This experimentally determined distance was consistent with molecular dynamics density functional theory results that showed (over the course of 8 ps) that Ac III was coordinated by 9 water molecules with Ac-O H2O distances ranging from 2.61 to 2.76 Å. The data is presented in the context of other actinide(III) and lanthanide(III) aquo ions characterized by XAFS and highlights the uniqueness of the large Ac III coordination numbers and long Ac-O H2O bond distances.

  4. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  5. In-source laser spectroscopy developments at TRILIS-towards spectroscopy on actinium and scandium

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, Sebastian, E-mail: raeder@triumf.ca; Dombsky, Marik; Heggen, Henning; Lassen, Jens; Quenzel, Thomas [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Sjoedin, Marica [GANIL (France); Teigelhoefer, Andrea [TRIUMF, Canada' s National Laboratory for Nuclear and Particle Physics (Canada); Wendt, Klaus [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik (Germany)

    2013-04-15

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm{sup - 1} which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  6. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  8. LaPO4 Nanoparticles Doped with Actinium-225 that Partially Sequester Daughter Radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Woodward, Jonathan [ORNL; Kennel, Steve J [ORNL; Stucnkey, Alan [University of Tennessee, Knoxville (UTK); Osborne, Dustin [University of Tennessee, Knoxville (UTK); Wall, Jonathan [University of Tennessee, Knoxville (UTK); Rondinone, Adam Justin [ORNL; Standaert, Robert F [ORNL; Mirzadeh, Saed [ORNL

    2011-01-01

    Nanoscale materials have been envisioned as carriers for various therapeutic drugs, including radioisotopes. Inorganic nanoparticles (NPs) are particularly appealing vehicles for targeted radiotherapy because they can package several radioactive atoms into a single carrier and can potentially retain daughter radioisotopes produced by in vivo generators such as actinium -225 (225Ac, t1/2=10 d). Decay of this radioisotope to stable bismuth-209 proceeds through a chain of short-lived daughters accompanied by the emission of four -particles that release >27 MeV of energy. The challenge in realizing the enhanced cytotoxic potential of in vivo generators lies in retaining the daughter nuclei at the therapy site. When 225Ac is attached to targeting agents via standard chelate conjugation methods, all of the daughter radionuclides are released after the initial -decay occurs. In this work, 225Ac was incorporated into lanthanum phosphate NPs to determine whether the radioisotope and its daughters would be retained within the dense mineral lattice. Further, the 225Ac-doped NPs were conjugated to the monoclonal antibody mAb 201B, which targets mouse lung endothelium through the vasculature, to ascertain the targeting efficacy and in vivo retention of radioisotopes. Standard biodistribution techniques and microSPECT/CT imaging of 225Ac as well as the daughter radioisotopes showed that the NPs accumulated rapidly in mouse lung after intravenous injection. By showing that excess, competing, uncoupled antibodies or NPs coupled to control mAbs are deposited primarily in the liver and spleen, specific targeting of NP-mAb 201B conjugates was demonstrated. Biodistribution analysis showed that ~30% of the total injected dose of La(225Ac)PO4 NPs accumulated in mouse lungs 1 h post-injection yielding a value of % ID/g >200. Furthermore, after 24 h, 80% of the 213Bi daughter produced from 225Ac decay was retained within the target organ and 213Bi retention increased to ~87% at 120 h. In

  9. Comment: 215 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 215.png Taxonomy icon (c) Database Center for Life Science licensed under CC Attribution2.1 Japan アイコン:電子顕微鏡バージョン bando 2010/02/15 15:30:03 2010/02/15 15:30:03 ...

  10. Nuclear Data Sheets for A = 215

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Balraj; Mukherjee, Gopal; Abriola, Daniel [International Atomic Energy Agency (IAEA), Vienna (Austria); Basu, Swapan Kumar [VECC, Kolkata (India); Demetriou, Paraskevi [IAEA, Vienna (Austria); Jain, Ashok [Indian Institute of Technology (IIT), Roorkee (India); Kumar, Suresh [Delhi University, Delhi (India); Singh, Sukhjeet [M.M. University, Mullana, Ambala (India); Tuli, Jagdish [Brookhaven National Laboratory (NNDC, BNL), Upton, NY (United States)

    2013-12-15

    The evaluated spectroscopic data are presented for 12 known nuclides of mass 215 (Hg, Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa). For {sup 215}Hg, {sup 215}Tl, {sup 215}Pb, and {sup 215}Pa nuclei, no excited states are known. The decay characteristics of {sup 215}Hg and {sup 215}Tl are unknown. The decay scheme of {sup 215}Pb is considered as incomplete. Ordering of γ cascades in the decay of 36.9–s isomer of {sup 215}Bi and for high–spin states above 2251 keV in {sup 215}Fr are not established. High–spin excitations, including several isomeric states, are well known in {sup 215}Bi, {sup 215}Po, {sup 215}Rn, {sup 215}Fr, {sup 215}Ra, and {sup 215}Ac. No particle–transfer reaction data are available for any of the A=215 nuclei. The rms charge radii for {sup 215}Pb, {sup 215}Bi, {sup 215}Po, {sup 215}Rn, {sup 215}Fr and {sup 215}Ra have been evaluated by Daniel Abriola, from extrapolation or interpolation of available evaluated data in 2013An02 for radii of respective Z chains using formula 9 in 2004An14. This evaluation was carried out as part of ENSDD–workshop at VECC, Kolkata for Nuclear Structure and Decay Data, organized and hosted by VECC and Board of Research in Nuclear Sciences (BRNS) in Kolkata, India, November 26–29, 2012. This work supersedes the previous A = 215 evaluation (2001Br31) published by E. Browne which covered literature prior to May 2001.

  11. 48 CFR 215.404 - Proposal analysis.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Proposal analysis. 215.404 Section 215.404 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Proposal analysis. ...

  12. 46 CFR 108.215 - Insect screens.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Insect screens. 108.215 Section 108.215 Shipping COAST... Construction and Arrangement Accommodation Spaces § 108.215 Insect screens. (a) Accommodation spaces must be protected against the admission of insects. (b) Insect screens must be installed when natural ventilation is...

  13. 2 CFR 215.36 - Intangible property.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Intangible property. 215.36 Section 215.36... NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Property Standards § 215.36 Intangible property. (a) The recipient may copyright any work that is subject to copyright and was developed...

  14. 2 CFR 215.32 - Real property.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Real property. 215.32 Section 215.32 Grants... ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Property Standards § 215.32 Real property. Each... real property acquired in whole or in part under awards. Unless otherwise provided by statute, such...

  15. 31 CFR 215.6 - Parties.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Parties. 215.6 Section 215.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT... COUNTY INCOME OR EMPLOYMENT TAXES BY FEDERAL AGENCIES Withholding Agreement § 215.6 Parties. The parties...

  16. 40 CFR 2.215 - Confidentiality agreements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Confidentiality agreements. 2.215 Section 2.215 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.215 Confidentiality agreements. (a) No EPA officer, employee...

  17. 32 CFR 724.215 - Military representation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Military representation. 724.215 Section 724.215... BOARD Authority/Policy for Departmental Discharge Review § 724.215 Military representation. Military... consult legal counsel before undertaking such representation. Such representation may be prohibited by 18...

  18. 48 CFR 215.402 - Pricing policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Pricing policy. 215.402... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.402 Pricing policy. Follow the procedures at PGI 215.402 when conducting cost or price analysis, particularly...

  19. 7 CFR 948.215 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 948.215 Section 948.215 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN COLORADO Accounting and Collections § 948.215...

  20. 2 CFR 215.34 - Equipment.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Equipment. 215.34 Section 215.34 Grants and... ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Property Standards § 215.34 Equipment. (a) Title to equipment acquired by a recipient with Federal funds shall vest in the recipient, subject to conditions of...

  1. 49 CFR 199.215 - Alcohol concentration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Alcohol concentration. 199.215 Section 199.215... Prevention Program § 199.215 Alcohol concentration. Each operator shall prohibit a covered employee from... alcohol concentration of 0.04 or greater. No operator having actual knowledge that a covered employee has...

  2. 47 CFR 80.215 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 80.215 Section 80.215... MARITIME SERVICES General Technical Standards § 80.215 Transmitter power. (a) Transmitter power shown on the radio station authorization is the maximum power the licensee is authorized to use. Power is...

  3. 7 CFR 215.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 215.3 Section 215.3 Agriculture... CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, CND...

  4. 7 CFR 65.215 - Pork.

    Science.gov (United States)

    2010-01-01

    ..., PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.215 Pork. Pork means meat produced from hogs. ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pork. 65.215 Section 65.215 Agriculture Regulations of...

  5. 48 CFR 1333.215 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1333.215 Section 1333.215 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1333.215 Contract clauses. Alternate I of FAR...

  6. 48 CFR 1433.215 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1433.215 Section 1433.215 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1433.215 Contract clauses. The Disputes...

  7. 48 CFR 833.215 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 833.215 Section 833.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 833.215 Contract clause. The contracting...

  8. 32 CFR 215.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 215.6 Section 215.6 National... EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.6 Responsibilities. (a) The... the accomplishment of his public affairs responsibilities set forth in paragraph (f) of this section...

  9. 25 CFR 215.12 - Advertising costs.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertising costs. 215.12 Section 215.12 Indians BUREAU... LEASES, QUAPAW AGENCY § 215.12 Advertising costs. All advertising costs, publication fees, expenses incurred for abstracts of lease title, and other expenses incurred in connection with the advertising and...

  10. 215

    African Journals Online (AJOL)

    2007-05-01

    May 1, 2007 ... MBChB, Resident, N. Ohene-Oti, BSc, SRN, Senior Oncology Nurse and J.A. Tagoe, SRN, RM, Senior Oncology Nurse,. Department of Radiation Oncology, Korle Bu Teaching Hospital, ..... Blackwood M.A. and Weber B.L. BRCA1 and BRCA2: From molecular genetics to clinical medicine. /. Clin. Oncol.

  11. 49 CFR 215.103 - Defective wheel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective wheel. 215.103 Section 215.103... § 215.103 Defective wheel. A railroad may not place or continue in service a car, if— (a) A wheel flange... tread of the wheel; (b) The height of a wheel flange on the car, from the tread to the top of the flange...

  12. 48 CFR 215.404-4 - Profit.

    Science.gov (United States)

    2010-10-01

    ... prenegotiation profit or fee objective on any negotiated contract action when cost or pricing data is obtained, except for cost-plus-award-fee contracts (see 215.404-74, 216.405-2, and FAR 16.405-2) or contracts with... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-4...

  13. 47 CFR 13.215 - Question pools.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Question pools. 13.215 Section 13.215... Question pools. The question pool for each written examination element will be composed of questions acceptable to the FCC. Each question pool must contain at least five (5) times the number of questions...

  14. 49 CFR 1544.215 - Security coordinators.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Security coordinators. 1544.215 Section 1544.215 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR SECURITY: AIR CARRIERS AND...

  15. 33 CFR 135.215 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Certification. 135.215 Section... Financial Responsibility for Offshore Facilities § 135.215 Certification. (a) Applicants shall: (1) If the...) If any of the information submitted for certification is determined by the Fund Administrator to be...

  16. 2 CFR 215.24 - Program income.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Program income. 215.24 Section 215.24 Grants... income. (a) Federal awarding agencies shall apply the standards set forth in this section in requiring recipient organizations to account for program income related to projects financed in whole or in part with...

  17. 31 CFR 800.215 - Foreign national.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign national. 800.215 Section 800.215 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND...

  18. 7 CFR 925.215 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 925.215 Section 925.215 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE GRAPES GROWN IN A DESIGNATED AREA OF SOUTHEASTERN CALIFORNIA Assessment...

  19. 5 CFR 179.215 - Refunds.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Refunds. 179.215 Section 179.215 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... (unless expressly prohibited by statute or regulation); or (2) An administrative or judicial order directs...

  20. 2 CFR 215.52 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Financial reporting. 215.52 Section 215.52... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status Report...

  1. 2 CFR 215.41 - Recipient responsibilities.

    Science.gov (United States)

    2010-01-01

    ... contractual responsibilities arising under its contract(s). The recipient is the responsible authority... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Recipient responsibilities. 215.41 Section... NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Procurement Standards § 215.41...

  2. 32 CFR 552.215 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... Demonstrations on the Installation of Aberdeen Proving Ground, Maryland § 552.215 Responsibilities. (a) Director, Law Enforcement and Security, U.S. Army Garrison, Aberdeen Proving Ground, will furnish police support...

  3. 48 CFR 215.406-3 - Documenting the negotiation.

    Science.gov (United States)

    2010-10-01

    ... negotiation. 215.406-3 Section 215.406-3 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.406-3 Documenting the negotiation. Follow the procedures at PGI 215.406-3 for...

  4. 48 CFR 215.404-1 - Proposal analysis techniques.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Proposal analysis techniques. 215.404-1 Section 215.404-1 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-1 Proposal analysis techniques. (1) Follow the procedures at PGI 215.404-1 for...

  5. Dicty_cDB: SLC215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC215 (Link to dictyBase) - - - Contig-U11723-1 SLC215F (Link... to Original site) SLC215F 425 - - - - - - Show SLC215 Library SL (Link to library) Clone ID SLC215 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict... sequence KTRRMSLDSRMLNGDQQSLVEKNQHMASPRTSKGIFKSSTTTTKSPEKTIIELKRSLEES GLFTKKKGPYLFFCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT...rame C: KTRRMSLDSRMLNGDQQSLVEKNQHMASPRTSKGIFKSSTTTTKSPEKTIIELKRSLEES GLFTKKKGPYLFFCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  6. 32 CFR 215.4 - Legal considerations.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.4 Legal considerations. (a) Under the Constitution and laws of the United States, the protection of life and property and the... to execute or enforce the laws, except as authorized by the Constitution or Act of Congress. (c) The...

  7. Eyelid dermatitis: a report of 215 patients.

    Science.gov (United States)

    Guin, Jere D

    2004-02-01

    Between April 2001 and October 2003, 215 persons presented with eyelid dermatitis for the first time. They ranged in age from 4 months to 95 years, with an average age of 49.6 years and a median age of 51 years. There were 173 females and 42 males. 165 of 215 had allergic contact dermatitis (ACD) and another 9 had protein contact dermatitis without relevant positive patch tests. Atopic eczema comprised 37 of 215 (17%), but 33 of 37 also had contact allergies. Seborrheic dermatitis, psoriasis or both were found in 35 (16%). Sources of ACD included personal care products in 54 (25%), including 12 with at least 1 positive patch test to cosmetic applicators and 12 sensitive to at least 1 botanical ingredient. Allergy to artificial nails and/or nail lacquer occurred in 18 of 215 (8%). 5 persons had rosacea or periorbital dermatitis, and 2 had dermatomyositis. Other causes included bacterial, fungal and viral infections, some of which were quite unusual. The evaluation of persons presenting with eyelid dermatitis remains a relatively complex but rewarding discipline.

  8. 47 CFR 215.1 - Background.

    Science.gov (United States)

    2010-10-01

    ... Force, and DOE laboratories on matters concerning nuclear weapons, nuclear weapons effects, and nuclear... POINT FOR ELECTROMAGNETIC PULSE (EMP) INFORMATION § 215.1 Background. (a) The nuclear electromagnetic pulse (EMP) is part of the complex environment produced by nuclear explosions. It consists of transient...

  9. 48 CFR 215.407-5 - Estimating systems.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Estimating systems. 215.407-5 Section 215.407-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM....407-5 Estimating systems. ...

  10. 12 CFR 215.8 - Records of member banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Records of member banks. 215.8 Section 215.8... EXECUTIVE OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.8 Records of member banks. (a) In general. Each member bank shall maintain records necessary for compliance with the...

  11. 29 CFR 99.215 - Relation to other audit requirements.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Relation to other audit requirements. 99.215 Section 99.215 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.215 Relation to other audit requirements. (a) Audit under this part in lieu of other audits...

  12. 23 CFR 668.215 - Programming and project procedures.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Programming and project procedures. 668.215 Section 668.215 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS EMERGENCY RELIEF PROGRAM Procedures for Federal Agencies for Federal Roads § 668.215 Programming...

  13. 48 CFR 253.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation. ...

  14. 48 CFR 53.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contracting by negotiation. 53.215 Section 53.215 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.215 Contracting by negotiation. ...

  15. 48 CFR 853.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contracting by negotiation. 853.215 Section 853.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS FORMS Prescription of Forms 853.215 Contracting by negotiation. ...

  16. 48 CFR 2453.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracting by negotiation. 2453.215 Section 2453.215 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.215 Contracting by negotiation. ...

  17. 29 CFR 215.7 - The Special Warranty.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false The Special Warranty. 215.7 Section 215.7 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.7 The Special Warranty. (a) The Special Warranty mentioned in paragraph (b)(2...

  18. 43 CFR 2.15 - Will I be charged fees?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Will I be charged fees? 2.15 Section 2.15 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Requests for Records under the FOIA § 2.15 Will I be charged fees? Bureaus will charge fees...

  19. 49 CFR 215.121 - Defective car body.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective car body. 215.121 Section 215.121..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Car Bodies § 215.121 Defective car body. A railroad may not place or continue in service a car, if: (a) Any portion of...

  20. 49 CFR 234.215 - Standby power system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power system. 234.215 Section 234.215..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.215 Standby power system. A standby source of power shall...

  1. 2 CFR 1.215 - Relationship to previous issuances.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Relationship to previous issuances. 1.215 Section 1.215 Grants and Agreements ABOUT TITLE 2 OF THE CODE OF FEDERAL REGULATIONS AND SUBTITLE A Introduction toSubtitle A § 1.215 Relationship to previous issuances. Although some of the guidance was...

  2. 25 CFR 215.7 - Advertisement of sale of leases.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement of sale of leases. 215.7 Section 215.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.7 Advertisement of sale of leases. Upon authority being granted by...

  3. 34 CFR 682.215 - Income-based repayment plan.

    Science.gov (United States)

    2010-07-01

    ... EDUCATION, DEPARTMENT OF EDUCATION FEDERAL FAMILY EDUCATION LOAN (FFEL) PROGRAM General Provisions § 682.215... for the year the borrower certifies family size. Support includes money, gifts, loans, housing, food... 34 Education 3 2010-07-01 2010-07-01 false Income-based repayment plan. 682.215 Section 682.215...

  4. 20 CFR 655.215 - Territory of Guam.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Territory of Guam. 655.215 Section 655.215... Agricultural Employment § 655.215 Territory of Guam. Subpart C of this part does not apply to temporary employment in the Territory of Guam, and the Department of Labor does not certify to the United States...

  5. 21 CFR 137.215 - Yellow corn flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn flour. 137.215 Section 137.215 Food... Flours and Related Products § 137.215 Yellow corn flour. Yellow corn flour conforms to the definition and standard of identity prescribed by § 137.211 for white corn flour except that cleaned yellow corn is used...

  6. 21 CFR 172.215 - Coumarone-indene resin.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Coumarone-indene resin. 172.215 Section 172.215... CONSUMPTION Coatings, Films and Related Substances § 172.215 Coumarone-indene resin. The food additive coumarone-indene resin may be safely used on grapefruit, lemons, limes, oranges, tangelos, and tangerines in...

  7. 29 CFR 1910.215 - Abrasive wheel machinery.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Abrasive wheel machinery. 1910.215 Section 1910.215 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.215 Abrasive wheel machinery. (a) General requirements—(1) Machine guarding. Abrasive wheels shall be used only on machines provided with...

  8. 25 CFR 215.24 - Books and accounts.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Books and accounts. 215.24 Section 215.24 Indians BUREAU... LEASES, QUAPAW AGENCY § 215.24 Books and accounts. (a) The lessee shall maintain books in which shall be... land. (b) An audit of the lessee's accounts and books shall be made semiannually, or at such other...

  9. 49 CFR 1542.215 - Law enforcement support.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.215 Law... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement support. 1542.215 Section 1542.215... program under § 1542.103(a) or (b) must provide: (1) Law enforcement personnel in the number and manner...

  10. 40 CFR 21.5 - Issuance of statements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Issuance of statements. 21.5 Section 21.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.5 Issuance of statements. (a) Upon application by a small business concern pursuant to § 21.3 the Regional...

  11. 48 CFR 1652.215-71 - Investment Income.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Investment Income. 1652.215... 1652.215-71 Investment Income. As prescribed in 1615.470-1, the following clause shall be inserted in all FEHBP contracts based on cost analysis: Investment Income (JAN 1998) (a) The Carrier shall invest...

  12. 14 CFR 417.215 - Straight-up time analysis.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Straight-up time analysis. 417.215 Section 417.215 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION... vehicle's flight termination system or breakup of the launch vehicle would not cause hazardous debris or...

  13. 30 CFR 77.215-3 - Refuse piles: certification.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles: certification. 77.215-3 Section... COAL MINES Surface Installations § 77.215-3 Refuse piles: certification. (a) Within 180 days following written notification by the District Manager that a refuse pile can present a hazard, the person owning...

  14. 30 CFR 77.215-2 - Refuse piles; reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; reporting requirements. 77.215-2... COAL MINES Surface Installations § 77.215-2 Refuse piles; reporting requirements. (a) The proposed location of a new refuse pile shall be reported to and acknowledged in writing by the District Manager...

  15. 30 CFR 77.215 - Refuse piles; construction requirements.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; construction requirements. 77.215... COAL MINES Surface Installations § 77.215 Refuse piles; construction requirements. (a) Refuse deposited on a pile shall be spread in layers and compacted in such a manner so as to minimize the flow of air...

  16. 30 CFR 77.215-4 - Refuse piles; abandonment.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; abandonment. 77.215-4 Section 77... MINES Surface Installations § 77.215-4 Refuse piles; abandonment. When a refuse pile is to be abandoned... refuse pile shall be abandoned in accordance with a plan submitted by the operator and approved by the...

  17. 30 CFR 77.215-1 - Refuse piles; identification.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; identification. 77.215-1 Section... COAL MINES Surface Installations § 77.215-1 Refuse piles; identification. A permanent identification marker, at least six feet high and showing the refuse pile identification number as assigned by the...

  18. 48 CFR 1552.215-75 - Past performance information.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Past performance information. 1552.215-75 Section 1552.215-75 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION... disadvantaged business concerns, monetary targets for small disadvantaged business participation, and the...

  19. 2 CFR 215.37 - Property trust relationship.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Property trust relationship. 215.37 Section 215.37 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... Property trust relationship. Real property, equipment, intangible property and debt instruments that are...

  20. 22 CFR 146.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-04-01

    ... apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's.... 146.215 Section 146.215 Foreign Relations DEPARTMENT OF STATE CIVIL RIGHTS NONDISCRIMINATION ON THE... are exempt from taxation under section 501(a) of the Internal Revenue Code of 1954, 26 U.S.C. 501(a...

  1. 2 CFR 215.42 - Codes of conduct.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Codes of conduct. 215.42 Section 215.42... Codes of conduct. The recipient shall maintain written standards of conduct governing the performance of... interest is not substantial or the gift is an unsolicited item of nominal value. The standards of conduct...

  2. 14 CFR 21.5 - Airplane or Rotorcraft Flight Manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane or Rotorcraft Flight Manual. 21.5... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.5 Airplane or Rotorcraft Flight Manual. (a) With each airplane or rotorcraft that was not type certificated with an Airplane or Rotorcraft Flight Manual...

  3. 48 CFR 2452.215-70 - Proposal Content.

    Science.gov (United States)

    2010-10-01

    ... of automated systems as required by clause at 48 CFR 2452.239-70 in Section I of this solicitation... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Proposal Content. 2452.215... 2452.215-70 Proposal Content. As prescribed in 2415.209(a), insert a provision substantially the same...

  4. 18 CFR 1317.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Membership practices of certain organizations. 1317.215 Section 1317.215 Conservation of Power and Water Resources TENNESSEE... Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c...

  5. 24 CFR 1710.215 - Subdivision characteristics and climate.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Subdivision characteristics and climate. 1710.215 Section 1710.215 Housing and Urban Development Regulations Relating to Housing and Urban...

  6. 24 CFR 3.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Membership practices of certain organizations. 3.215 Section 3.215 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...

  7. 49 CFR 375.215 - How must I collect charges?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false How must I collect charges? 375.215 Section 375... Services to My Customers Collecting Transportation Charges § 375.215 How must I collect charges? You must... chapter. All rates and charges for the transportation and related services must be in accordance with your...

  8. 32 CFR Appendix C to Part 45 - DD Form 215

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 215 C Appendix C to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. C Appendix C to Part 45—DD Form 215 EC21OC91.050 ...

  9. 42 CFR 2.15 - Incompetent and deceased patients.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Incompetent and deceased patients. 2.15 Section 2... CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.15 Incompetent and deceased patients. (a) Incompetent patients other than minors—(1) Adjudication of incompetence. In the case of a...

  10. 13 CFR 113.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ... regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Membership practices of certain organizations. 113.215 Section 113.215 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  11. 10 CFR 603.215 - Recipient's commitment and cost sharing.

    Science.gov (United States)

    2010-01-01

    ... cost sharing. The purpose of cost sharing is to ensure that the recipient incurs real risk that gives... 10 Energy 4 2010-01-01 2010-01-01 false Recipient's commitment and cost sharing. 603.215 Section... AGREEMENTS Appropriate Use of Technology Investment Agreements § 603.215 Recipient's commitment and cost...

  12. 29 CFR 1603.215 - Record of hearings.

    Science.gov (United States)

    2010-07-01

    ... EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF THE GOVERNMENT EMPLOYEE RIGHTS ACT OF 1991 Hearings § 1603.215 Record of hearings. (a) All hearings...

  13. 48 CFR 215.404-76 - Reporting profit and fee statistics.

    Science.gov (United States)

    2010-10-01

    ... statistics. 215.404-76 Section 215.404-76 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-76 Reporting profit and fee statistics. Follow the procedures at PGI 215.404-76 for reporting profit and fee statistics. ...

  14. 6 CFR 27.215 - Security vulnerability assessments.

    Science.gov (United States)

    2010-01-01

    ... FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.215 Security vulnerability assessments. (a) Initial Assessment. If the Assistant Secretary determines that a chemical facility is high-risk, the facility must complete a Security Vulnerability Assessment. A Security Vulnerability...

  15. 2 CFR 215.21 - Standards for financial management systems.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Standards for financial management systems... Financial and Program Management § 215.21 Standards for financial management systems. (a) Federal awarding... information whenever practical. (b) Recipients' financial management systems shall provide for the following...

  16. 48 CFR 2515.215-70 - NSF negotiation authorities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NSF negotiation authorities... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Negotiation Authorities 2515.215-70 NSF negotiation authorities. (a) Authorities. Citation: 42 U.S.C. 1870(c). (b) Application. When an NSF contract...

  17. 20 CFR 628.215 - State Human Resource Investment Council.

    Science.gov (United States)

    2010-04-01

    ... PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Planning § 628.215 State Human Resource... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false State Human Resource Investment Council. 628..., 702, and 703 of the Act, establish a State Human Resource Investment Council (HRIC). The HRIC's...

  18. 2 CFR 215.15 - Metric system of measurement.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Metric system of measurement. 215.15 Section... measurement. The Metric Conversion Act, as amended by the Omnibus Trade and Competitiveness Act (15 U.S.C. 205) declares that the metric system is the preferred measurement system for U.S. trade and commerce. The Act...

  19. 48 CFR 215.404-75 - Fee requirements for FFRDCs.

    Science.gov (United States)

    2010-10-01

    ... objective in accordance with FFRDC fee policies in the DoD FFRDC Management Plan. (c) Shall not use the... Contract Pricing 215.404-75 Fee requirements for FFRDCs. For nonprofit organizations that are FFRDCs, the... FFRDC's— (1) Proportion of retained earnings (as established under generally accepted accounting methods...

  20. 46 CFR 107.215 - Renewal of Certificate of Inspection.

    Science.gov (United States)

    2010-10-01

    ... 107.215 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING... renewal of a Certificate of Inspection by submitting a completed Application for Inspection of U.S. Vessel... service may apply for renewal of a Certificate of Inspection by submitting a completed Application for...

  1. 7 CFR 1260.215 - Patents, copyrights, inventions and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions and publications... AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Miscellaneous § 1260.215 Patents, copyrights, inventions and publications. (a) Any patents, copyrights, inventions or publications developed...

  2. 49 CFR 215.119 - Defective freight car truck.

    Science.gov (United States)

    2010-10-01

    ... Suspension System § 215.119 Defective freight car truck. A railroad may not place or continue in service a car, if the car has— (a) A side frame or bolster that— (1) Is broken; or (2) Has a crack of 1/4 of an... support the brake beam. Car Bodies ...

  3. 7 CFR 215.7 - Requirements for participation.

    Science.gov (United States)

    2010-01-01

    ... authority under this part to support a nonprofit nutrition program for the elderly, including a program... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.7 Requirements for participation...

  4. 48 CFR 2052.215-77 - Travel approvals and reimbursement.

    Science.gov (United States)

    2010-10-01

    ... Official Foreign Travel, and must be in compliance with FAR 52.247-63 Preference for U.S. Flag Air Carriers... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Travel approvals and....215-77 Travel approvals and reimbursement. As prescribed at 2015.209-70(d), the contracting officer...

  5. 43 CFR 46.215 - Categorical exclusions: Extraordinary circumstances.

    Science.gov (United States)

    2010-10-01

    ...) Have highly controversial environmental effects or involve unresolved conflicts concerning alternative uses of available resources . (d) Have highly uncertain and potentially significant environmental... IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT OF 1969 Initiating the NEPA Process § 46.215 Categorical...

  6. 21 CFR 1311.215 - Internal audit trail.

    Science.gov (United States)

    2010-04-01

    ... Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF JUSTICE REQUIREMENTS FOR ELECTRONIC ORDERS AND PRESCRIPTIONS (Eff. 6-1-10) Electronic Prescriptions § 1311.215 Internal audit trail. (a) The... provider, if applicable, and the Administration within one business day. ...

  7. 7 CFR 215.14a - Procurement standards.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.14a Procurement standards. (a... connection with the Program. This includes but is not limited to: Source evaluation, protests, disputes...

  8. 41 CFR 102-117.215 - What are household goods (HHG)?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are household goods (HHG)? 102-117.215 Section 102-117.215 Public Contracts and Property Management Federal Property... MANAGEMENT Shipping Household Goods § 102-117.215 What are household goods (HHG)? Household goods (HHG) are...

  9. 48 CFR 52.215-12 - Subcontractor Certified Cost or Pricing Data.

    Science.gov (United States)

    2010-10-01

    ... Cost or Pricing Data. 52.215-12 Section 52.215-12 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-12 Subcontractor Certified Cost or Pricing Data. As prescribed in 15.408(d), insert the following clause: Subcontractor Certified Cost or Pricing Data (OCT 2010) (a) Before awarding...

  10. 48 CFR 215.403-3 - Requiring information other than cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Requiring information other than cost or pricing data. 215.403-3 Section 215.403-3 Federal Acquisition Regulations System... CONTRACTING BY NEGOTIATION Contract Pricing 215.403-3 Requiring information other than cost or pricing data...

  11. 9 CFR 381.215 - Poultry or other articles subject to judicial seizure and condemnation.

    Science.gov (United States)

    2010-01-01

    ... judicial seizure and condemnation. 381.215 Section 381.215 Animals and Animal Products FOOD SAFETY AND... Detention; Seizure and Condemnation; Criminal Offenses § 381.215 Poultry or other articles subject to judicial seizure and condemnation. Any poultry carcass, or part thereof, or any product made wholly or in...

  12. 2 CFR 215.20 - Purpose of financial and program management.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of financial and program management... Financial and Program Management § 215.20 Purpose of financial and program management. Sections 215.21 through 215.28 prescribe standards for financial management systems, methods for making payments and rules...

  13. 48 CFR 52.215-2 - Audit and Records-Negotiation.

    Science.gov (United States)

    2010-10-01

    ...-Negotiation. 52.215-2 Section 52.215-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-2 Audit and Records—Negotiation. As prescribed in 15.209(b), insert the following clause: Audit and Records—Negotiation (OCT 2010) (a) As used in this clause, records includes books, documents...

  14. 41 CFR 102-37.215 - When must a SASP make a certification regarding lobbying?

    Science.gov (United States)

    2010-07-01

    ... certification regarding lobbying? 102-37.215 Section 102-37.215 Public Contracts and Property Management Federal... Property § 102-37.215 When must a SASP make a certification regarding lobbying? You are subject to the anti-lobbying certification and disclosure requirements in part 105-69 of this title when all of the following...

  15. 31 CFR 215.9 - Change of legal residence by members of the Armed Forces.

    Science.gov (United States)

    2010-07-01

    ... of the Armed Forces. 215.9 Section 215.9 Money and Finance: Treasury Regulations Relating to Money... Withholding Agreement § 215.9 Change of legal residence by members of the Armed Forces. (a) In determining the legal residence of a member of the Armed Forces for tax withholding purposes, the head of an agency at...

  16. 48 CFR 1452.215-70 - Examination of Records by the Department of the Interior.

    Science.gov (United States)

    2010-10-01

    ... the Department of the Interior. 1452.215-70 Section 1452.215-70 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1452.215-70 Examination of Records by the Department of the Interior. As prescribed in...

  17. 48 CFR 52.215-16 - Facilities Capital Cost of Money.

    Science.gov (United States)

    2010-10-01

    ... Money. 52.215-16 Section 52.215-16 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-16 Facilities Capital Cost of Money. As prescribed in 15.408(h), insert the following provision: Facilities Capital Cost of Money (JUN 2003) (a) Facilities capital cost of money will be an allowable cost...

  18. 48 CFR 52.215-17 - Waiver of Facilities Capital Cost of Money.

    Science.gov (United States)

    2010-10-01

    ... Capital Cost of Money. 52.215-17 Section 52.215-17 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-17 Waiver of Facilities Capital Cost of Money. As prescribed in 15.408(i), insert the following clause: Waiver of Facilities Capital Cost of Money (OCT 1997) The Contractor did not...

  19. 41 CFR 102-34.215 - May Government contractors use Government motor vehicles?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May Government contractors use Government motor vehicles? 102-34.215 Section 102-34.215 Public Contracts and Property... PROPERTY 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.215 May Government...

  20. 40 CFR 63.215 - What General Provisions apply to me?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false What General Provisions apply to me? 63.215 Section 63.215 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... and Information § 63.215 What General Provisions apply to me? (a) All the provisions in 40 CFR part 61...

  1. 48 CFR 1552.215-73 - General financial and organizational information.

    Science.gov (United States)

    2010-10-01

    ... organizational information. 1552.215-73 Section 1552.215-73 Federal Acquisition Regulations System ENVIRONMENTAL... Clauses 1552.215-73 General financial and organizational information. As prescribed in 1515.408(a)(2), insert the following provision: General Financial and Organizational Information: (AUG 1999) Offerors or...

  2. 50 CFR 226.215 - Critical habitat for the North Pacific Right Whale (Eubalaena japonica).

    Science.gov (United States)

    2010-10-01

    ... Right Whale (Eubalaena japonica). 226.215 Section 226.215 Wildlife and Fisheries NATIONAL MARINE... DESIGNATED CRITICAL HABITAT § 226.215 Critical habitat for the North Pacific Right Whale (Eubalaena japonica). (a) Primary Constituent Elements. The primary constituent elements of the North Pacific right whale...

  3. 40 CFR 1065.215 - Pressure transducers, temperature sensors, and dewpoint sensors.

    Science.gov (United States)

    2010-07-01

    ... sensors, and dewpoint sensors. 1065.215 Section 1065.215 Protection of Environment ENVIRONMENTAL... Measurement of Engine Parameters and Ambient Conditions § 1065.215 Pressure transducers, temperature sensors, and dewpoint sensors. (a) Application. Use instruments as specified in this section to measure...

  4. 25 CFR 215.25 - Other minerals and deep-lying lead and zinc minerals.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Other minerals and deep-lying lead and zinc minerals. 215.25 Section 215.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.25 Other minerals and deep-lying lead...

  5. 28 CFR 2.15 - Petition for consideration of parole prior to date set at hearing.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Petition for consideration of parole prior to date set at hearing. 2.15 Section 2.15 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.15 Petition...

  6. Mass balance and metabolism of Z-215, a novel proton pump inhibitor, in healthy volunteers.

    Science.gov (United States)

    Toda, Ryoko; Miyagawa, Tomoharu; Masuda, Yuka; Hoshino, Yusuke; Yoshii, Kazuyoshi; Hirayama, Masamichi; Shibuya, Minaka; Kawabata, Yoshihiro

    2017-11-02

    The human mass balance of [(14 )C]Z-215, a novel proton pump inhibitor, was characterised in six healthy male volunteers following single oral administration of [(14 )C]Z-215 (20 mg, 3.7 MBq) to determine the elimination pathway of Z-215 and the distribution of its metabolites in plasma, urine, and faeces (NCT02618629). [(14 )C]Z-215 was rapidly absorbed, with a Cmax of 434 ng/mL at 0.38 h for Z-215 and 732 ng eq./mL at 0.5 h for total radioactivity. Means of 59.61% and 31.36% of the administered radioactive dose were excreted in urine and faeces, respectively, within 168 h post-dose. The majority of the dose was recovered within 24 h in urine and 96 h in faeces. Unchanged Z-215 was excreted in urine at trace levels but was not detected in faeces. The main components in plasma were Z-215 and Z-215 sulphone, accounting for 29.8% and 13.3% of the total circulating radioactivity, respectively. Additionally, Z-215 was metabolised through oxidation, reduction and conjugation. Our in vitro Z-215 metabolism study showed that the major isozyme contributing to the oxidation of Z-215, including the formation of Z-215 sulphone, was CYP3A4. In conclusion, Z-215 is well absorbed in humans and primarily eliminated via metabolism, where CYP3A4 plays an important role.

  7. The case for medical marijuana: vote yes on Proposition 215.

    Science.gov (United States)

    Baker, R

    1996-09-01

    In order to create a safe and affordable mechanism through which seriously ill patients can access marijuana, supporters of its legitimate use have placed Proposition 215 on the California State ballot. The ballot lists medical uses that include AIDS and cancer. The law would stipulate that a patient or primary caregiver may grow marijuana for personal use and would not be subject to criminal prosecution. Until a raid in August 1996, more than 10,000 people in the San Francisco area have procured medical marijuana through the Cannabis Buyer's Club.

  8. 29 CFR 1472.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false What must I include in my drug-free awareness program? 1472.215 Section 1472.215 Labor Regulations Relating to Labor (Continued) FEDERAL MEDIATION AND... of drug abuse in the workplace; (b) Your policy of maintaining a drug-free workplace; (c) Any...

  9. 29 CFR 94.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true What must I include in my drug-free awareness program? 94.215 Section 94.215 Labor Office of the Secretary of Labor GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE... inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy of maintaining a...

  10. 47 CFR 25.215 - Technical requirements for space stations in the Direct Broadcast Satellite Service.

    Science.gov (United States)

    2010-10-01

    ... the Direct Broadcast Satellite Service. 25.215 Section 25.215 Telecommunication FEDERAL COMMUNICATIONS... Technical requirements for space stations in the Direct Broadcast Satellite Service. In addition to § 25.148(f), space station antennas operating in the Direct Broadcast Satellite Service must be designed to...

  11. 31 CFR 20.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false What must I include in my drug-free awareness program? 20.215 Section 20.215 Money and Finance: Treasury Office of the Secretary of the Treasury GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than...

  12. 49 CFR Appendix B to Part 215 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ... support worn 2,500 5,000 215.121Defective car body: (a) Has less than 21/2″ clearance from the top of rail... 215.127Defective draft arrangement: (a) Draft gear that is inoperative 2,500 5,000 (b) Yoke that is...

  13. 48 CFR 215.404-72 - Modified weighted guidelines method for nonprofit organizations other than FFRDCs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Modified weighted guidelines method for nonprofit organizations other than FFRDCs. 215.404-72 Section 215.404-72 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY...

  14. 25 CFR 215.21 - Payment of gross production tax on lead and zinc.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Payment of gross production tax on lead and zinc. 215.21... ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.21 Payment of gross production tax on lead and... production tax due the State on production of lead and zinc from restricted lands under his jurisdiction as...

  15. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547. ...

  16. 48 CFR 215.404-70 - DD Form 1547, Record of Weighted Guidelines Method Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-70 DD Form 1547, Record of Weighted Guidelines Method Application. Follow the procedures at PGI 215.404-70 for use of DD Form 1547 whenever a structured...

  17. 49 CFR Appendix C to Part 215 - FRA Freight Car Standards Defect Code

    Science.gov (United States)

    2010-10-01

    ... core except by design of metal parts in contact with journal. (E)(1) Missing; (2) Not in contact with... Bearing Box: Journal Lubrication System. 215.111Defective Plain Bearing. 215.113Defective Plain Bearing...″ in depth: (C) Broken or cracked end collar on plain bearing axle. (D) Overheated journal. (E) Surface...

  18. File list: Pol.Emb.05.RpII215.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Emb.05.RpII215.AllCell dm3 RNA polymerase RpII215 Embryo SRX859013,SRX859009,SR...X859007,SRX859011 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.Emb.05.RpII215.AllCell.bed ...

  19. 8 CFR 215.6 - Departure from the Canal Zone, the Trust Territory of the Pacific Islands, or outlying...

    Science.gov (United States)

    2010-01-01

    ... Territory of the Pacific Islands, or outlying possessions of the United States. 215.6 Section 215.6 Aliens... FROM THE UNITED STATES § 215.6 Departure from the Canal Zone, the Trust Territory of the Pacific... alien who seeks to depart from the Canal Zone, the Trust Territory of the Pacific Islands, or an...

  20. 25 CFR 171.215 - What if the elevation of my farm unit is too high to receive irrigation water?

    Science.gov (United States)

    2010-04-01

    ... receive irrigation water? 171.215 Section 171.215 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER IRRIGATION OPERATION AND MAINTENANCE Irrigation Service § 171.215 What if the elevation of my farm unit is too high to receive irrigation water? (a) We will not change our service ditch...

  1. Clinical analysis of acute anterior uveitis in 215 cases

    Directory of Open Access Journals (Sweden)

    Xue-Wei Zhou

    2013-11-01

    Full Text Available AIM: To analyze the etiology, therapeutic effects,risk of relapse and prognosis of acute anterior uveitis.MEHTODS: Medical history of 215 patients with acute anterior uveitis who underwent treatment in Department of Ophthalmology, People's Hospital of Fenghua was collected, together with results of clinical examinations and auxiliary examinations. The data were studied in terms of therapeutic effects, etiological factors, prognosis and relapse rate. RESULTS: In 85 cases(39.5%, the cause was identified, and among the among the most frequent causes were traumatic or surgical injury, viral infection and glaucomatocyclitic crisis. After treatment, the best corrected visual acuity was no less than 1.0 in 153 cases(71.2%, between 0.5 and 1.0 in 55 cases(25.6%, between 0.3 and 0.5 in 4 cases(1.9%, between 0.05 and 0.3 in 2 cases(0.9%, and less than 0.05 in 1 case(0.5%. During the follow-up of more than 6 months, relapse occurred in 4 cases(1.9%during 4-6 months, in 7 cases(3.2%during 7-12 months, in 10 cases(4.7%during 13-24 months, and in 3 cases(1.4%during 25-60 months. CONCLUSION: The etiology of acute anterior uveitis is complicated and mostly idiopathic. Vision prognosis is good after treatment, but therelapse rate is high and can cause visual impairment, so better understanding should be gained of its relapse and its prevention and early treatment should be emphasized.

  2. 215 Johanna J Therion*, R.l. Mackie and Frances M.C. Gilchrist

    African Journals Online (AJOL)

    215. Johanna J Therion*, R.l. Mackie and. Frances M.C. Gilchrist. Animal and Dairy Science Research Instituie,. Private BagXZ,Irene L675, Republic of South Africa. *To whom correspondence should be addressed ...

  3. Role of MiR-215 in Hirschsprung's Disease Pathogenesis by Targeting SIGLEC-8

    Directory of Open Access Journals (Sweden)

    Hao Lei

    2016-12-01

    Full Text Available Background/Aims: Hirschsprung's disease (HSCR, known as aganglionosis, is an infrequent congenital gut motility disorder characterized by absence of enteric neurons. In this study, we focus on the role of the intronic miR-215 and its host gene isoleucyl-tRNA synthetase 2 (IARS2 in the pathogenesis of HSCR. Methods: Quantitative real time PCR and Western blot were used to detect the miRNA, mRNAs, and proteins levels. The dual-luciferase reporter gene assay confirmed the direct regulation of the specific mRNA and miRNAs in cell lines. Transwell assays, CCK8 assay, and flow cytometry were used to measure cell function of the human 293T and SH-SY5Y cells. Results: Expression levels of miR-215 in HSCR patient colon tissues were outstandingly lower than controls, which was positively correlated with expression of the host gene IARS2 and negatively correlated with predicted target gene: sialic acid binding Ig-like lectin 8 (SIGLEC-8. The loss of miR-215 inhibited cell migration and proliferation, which was consistent with the reduction of IARS2. The dual-luciferase reporter gene assay confirmed that miR-215 resulted in the inhibition of SIGLEC-8 by directly binding to the 3'-UTR of SIGLEC-8. Moreover, knocking-down SIGLEC-8 rescued the extent of suppressed cell migration and proliferation that resulted from the diminishment of miR-215. Conclusions: Our findings indicate that miR-215 acts in concert with the host gene IARS2 to affect neuron migration and proliferation through the target gene SIGLEC-8. We infer that the IARS2-miR-215-SIGLEC-8 pathway may play a crucial role in the pathogenesis of HSCR.

  4. Molecular mechanism of chemoresistance by miR-215 in osteosarcoma and colon cancer cells

    Directory of Open Access Journals (Sweden)

    Formentini Andrea

    2010-04-01

    Full Text Available Abstract Background Translational control mediated by non-coding microRNAs (miRNAs plays a key role in the mechanism of cellular resistance to anti-cancer drug treatment. Dihydrofolate reductase (DHFR and thymidylate synthase (TYMS, TS are two of the most important targets for antifolate- and fluoropyrimidine-based chemotherapies in the past 50 years. In this study, we investigated the roles of miR-215 in the chemoresistance to DHFR inhibitor methotrexate (MTX and TS inhibitor Tomudex (TDX. Results The protein levels of both DHFR and TS were suppressed by miR-215 without the alteration of the target mRNA transcript levels. Interestingly, despite the down-regulation of DHFR and TS proteins, ectopic expression of miR-215 resulted in a decreased sensitivity to MTX and TDX. Paradoxically, gene-specific small-interfering RNAs (siRNAs against DHFR or TS had the opposite effect, increasing sensitivity to MTX and TDX. Further studies revealed that over-expression of miR-215 inhibited cell proliferation and triggered cell cycle arrest at G2 phase, and that this effect was accompanied by a p53-dependent up-regulation of p21. The inhibitory effect on cell proliferation was more pronounced in cell lines containing wild-type p53, but was not seen in cells transfected with siRNAs against DHFR or TS. Moreover, denticleless protein homolog (DTL, a cell cycle-regulated nuclear and centrosome protein, was confirmed to be one of the critical targets of miR-215, and knock-down of DTL by siRNA resulted in enhanced G2-arrest, p53 and p21 induction, and reduced cell proliferation. Additionally, cells subjected to siRNA against DTL exhibited increased chemoresistance to MTX and TDX. Endogenous miR-215 was elevated about 3-fold in CD133+HI/CD44+HI colon cancer stem cells that exhibit slow proliferating rate and chemoresistance compared to control bulk CD133+/CD44+ colon cancer cells. Conclusions Taken together, our results indicate that miR-215, through the suppression

  5. 31 CFR 585.215 - Conveyances and cargo suspected of being in violation of United Nations sanctions; detention...

    Science.gov (United States)

    2010-07-01

    ... being in violation of United Nations sanctions; detention; blocking. 585.215 Section 585.215 Money and... and cargo suspected of being in violation of United Nations sanctions; detention; blocking. (a) Except... § 585.201, but which are suspected of a violation of United Nations Security Council Resolutions No. 713...

  6. 48 CFR 215.370 - Evaluation factor for employing or subcontracting with members of the Selected Reserve.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation factor for employing or subcontracting with members of the Selected Reserve. 215.370 Section 215.370 Federal... employing or subcontracting with members of the Selected Reserve. ...

  7. 16 CFR 2.15 - Orders requiring witnesses to testify or provide other information and granting immunity.

    Science.gov (United States)

    2010-01-01

    ... provide other information and granting immunity. 2.15 Section 2.15 Commercial Practices FEDERAL TRADE... and granting immunity. (a) The Bureau Director, Deputy Directors, and Assistant Directors in the... issuance of an order requiring a witness to testify or provide other information granting immunity under...

  8. Identification and comparative expression analysis of interleukin 2/15 receptor B chain in chickens infected with E. tenella

    Science.gov (United States)

    Background: Interleukin (IL) 2 and IL15 receptor beta chain (IL2/15Receptor beta, CD122) play critical roles in signal transduction for the biological activities of IL2 and IL15. Increased knowledge of non-mammalian IL2/15Receptor beta will enhance the understanding of IL2 and IL15 functions. Meth...

  9. 30 CFR 204.215 - Are the information collection requirements in this subpart approved by the Office of Management...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Are the information collection requirements in this subpart approved by the Office of Management and Budget (OMB)? 204.215 Section 204.215 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES...

  10. 48 CFR 215.404-74 - Fee requirements for cost-plus-award-fee contracts.

    Science.gov (United States)

    2010-10-01

    ... NEGOTIATION Contract Pricing 215.404-74 Fee requirements for cost-plus-award-fee contracts. In developing a fee objective for cost-plus-award-fee contracts, the contracting officer shall— (a) Follow the... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Fee requirements for cost...

  11. 9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... vaccine production. All serials of vaccine shall be prepared from the first through the fifth passage from... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed... REQUIREMENTS Killed Virus Vaccines § 113.215 Bovine Virus Diarrhea Vaccine, Killed Virus. Bovine Virus Diarrhea...

  12. 24 CFR 965.215 - Lead-based paint liability insurance coverage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lead-based paint liability... Insurance Coverage § 965.215 Lead-based paint liability insurance coverage. (a) General. The purpose of this... with lead-based paint activities that the PHA undertakes, in accordance with the PHA's ACC with HUD...

  13. 48 CFR 52.215-15 - Pension adjustments and asset reversions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Pension adjustments and... Clauses 52.215-15 Pension adjustments and asset reversions. As prescribed in 15.408(g), insert the following clause: Pension Adjustments and Asset Reversions (OCT 2010) (a) The Contractor shall promptly...

  14. 29 CFR 780.215 - Meaning of forestry or lumbering operations.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Meaning of forestry or lumbering operations. 780.215... forestry or lumbering operations. The term forestry or lumbering operations refers to the cultivation and... considers the sec. 13(b)(28) exemption for forestry or logging operations in which not more than eight...

  15. 48 CFR 215.407-5-70 - Disclosure, maintenance, and review requirements.

    Science.gov (United States)

    2010-10-01

    ... management systems (e.g., production control or cost accounting) with the estimating system so that the... CONTRACTING BY NEGOTIATION Contract Pricing 215.407-5-70 Disclosure, maintenance, and review requirements. (a... of fair and reasonable prices. (b) Applicability. (1) DoD policy is that all contractors have...

  16. 13 CFR 120.215 - What interest rates apply to smaller loans?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What interest rates apply to... BUSINESS LOANS Policies Specific to 7(a) Loans Maturities; Interest Rates; Loan and Guarantee Amounts § 120.215 What interest rates apply to smaller loans? For a loan over $25,000 but not exceeding $50,000, the...

  17. 8 CFR 215.7 - Instructions from the Administrator required in certain cases.

    Science.gov (United States)

    2010-01-01

    ... IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.7 Instructions from the... status of a nonimmigrant under section 101(a)(15) (A) or (G) of the Immigration and Nationality Act, or... United Nations and the United States of America regarding the Headquarters of the United Nations (61 Stat...

  18. 48 CFR 2052.215-78 - Travel approvals and reimbursement-Alternate 1.

    Science.gov (United States)

    2010-10-01

    ... Foreign Travel, and must be in compliance with FAR 52.247-63 Preference for U.S. Flag Air Carriers. The... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Travel approvals and... Clauses 2052.215-78 Travel approvals and reimbursement—Alternate 1. As prescribed in 2015.209-70(d), the...

  19. 14 CFR 302.215 - Briefs to the administrative law judge.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Briefs to the administrative law judge. 302... (AVIATION PROCEEDINGS) PROCEDURAL REGULATIONS RULES OF PRACTICE IN PROCEEDINGS Rules Applicable to U.S. Air....215 Briefs to the administrative law judge. Briefs to the administrative law judge shall be filed...

  20. 49 CFR 215.109 - Defective plain bearing box: Journal lubrication system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing box: Journal lubrication... Freight Car Components Suspension System § 215.109 Defective plain bearing box: Journal lubrication system... impairs proper lubrication of the pad; (d) Has— (1) An exposed center core (except by design); or (2...

  1. 27 CFR 24.215 - Wine or wine products not for beverage use.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine or wine products not... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.215 Wine or wine products not for beverage use. (a) General. Wine, or wine products made from wine...

  2. Gsg1, Trnp1, and Tmem215 Mark Subpopulations of Bipolar Interneurons in the Mouse Retina

    Science.gov (United States)

    Park, Ko Uoon; Randazzo, Grace; Jones, Kenneth L.; Brzezinski, Joseph A.

    2017-01-01

    Purpose How retinal bipolar cell interneurons are specified and assigned to specialized subtypes is only partially understood. In part, this is due to a lack of early pan- and subtype-specific bipolar cell markers. To discover these factors, we identified genes that were upregulated in Blimp1 (Prdm1) mutant retinas, which exhibit precocious bipolar cell development. Methods Postnatal day (P)2 retinas from Blimp1 conditional knock-out (CKO) mice and controls were processed for RNA sequencing. Genes that increased at least 45% and were statistically different between conditions were considered candidate bipolar-specific factors. Candidates were further evaluated by RT-PCR, in situ hybridization, and immunohistochemistry. Knock-in Tmem215-LacZ mice were used to better trace retinal expression. Results A comparison between Blimp1 CKO and control RNA-seq datasets revealed approximately 40 significantly upregulated genes. We characterized the expression of three genes that have no known function in the retina, Gsg1 (germ cell associated gene), Trnp1 (TMF-regulated nuclear protein), and Tmem215 (a predicted transmembrane protein). Germ cell associated gene appeared restricted to a small subset of cone bipolars while Trnp1 was seen in all ON type bipolar cells. Using Tmem215-LacZ heterozygous knock-in mice, we observed that β-galactosidase expression started early in bipolar cell development. In adults, Tmem215 was expressed by a subset of ON and OFF cone bipolar cells. Conclusions We have identified Gsg1, Tmem215, and Trnp1 as novel bipolar subtype-specific genes. The spatial and temporal pattern of their expression is consistent with a role in controlling bipolar subtype fate choice, differentiation, or physiology. PMID:28199486

  3. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2014. Scientific Opinion on Flavouring Group Evaluation 215 (FGE.215): Seven α,β-Unsaturated Cinnamyl Ketones from subgroup 3.2 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of flavouring substances from subgroup 3.2 of FGE.19 in the Flavouring Group Evaluation 215 (FGE.215). The Flavour Industry has...... provided in vitro genotoxicity studies for the representative substances in FGE.215, namely 4-phenylbut-3-en-2-one [FL-no: 07.024] and 1-(4-methoxyphenyl)pent-1-en-3-one [FL-no: 07.030]. Based on these genotoxicity data, the Panel concluded that the genotoxicity concern could not be ruled out and in vivo...

  4. 48 CFR 215.403-5 - Instructions for submission of cost or pricing data or information other than cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... submission of cost or pricing data or information other than cost or pricing data. 215.403-5 Section 215.403... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.403-5 Instructions for submission of cost or pricing data or information other than cost or pricing data. When the...

  5. 48 CFR 853.215-70 - VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA.

    Science.gov (United States)

    2010-10-01

    ..., Application for Furnishing Nursing Home Care to Beneficiaries of VA. 853.215-70 Section 853.215-70 Federal... 853.215-70 VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA. VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA, will be used for...

  6. Downregulation of Plasma miR-215 in Chronic Myeloid Leukemia Patients with Successful Discontinuation of Imatinib

    Directory of Open Access Journals (Sweden)

    Kazuma Ohyashiki

    2016-04-01

    Full Text Available Approximately 40% of chronic myeloid leukemia (CML patients who discontinue imatinib (IM therapy maintain undetectable minimal residual disease (UMRD for more than one year (stopping IM (STOP-IM. To determine a possible biomarker for STOP-IM CML, we examined plasma miRNA expression in CML patients who were able to discontinue IM. We first screened candidate miRNAs in unselected STOP-IM patients, who had sustained UMRD after discontinuing IM for more than six months, in comparison with healthy volunteers, by using a TaqMan low-density array for plasma or exosomes. Exosomal miR-215 and plasma miR-215 were downregulated in the STOP-IM group compared to the control, indicating that the biological relevance of the plasma miR-215 level is equivalent to that of the exosomal level. Next, we performed real-time quantitative RT-PCR in 20 STOP-IM patients, 32 patients with UMRD on continued IM therapy (IM group and 28 healthy volunteers. The plasma miRNA-215 level was significantly downregulated in the STOP-IM group (p < 0.0001; we determined the cut-off level and divided the IM group patients into two groups according to whether the plasma miR-215 was downregulated or not. The IM group patients with a low plasma miR-215 level had a significantly higher total IM intake, compared to the patients with elevated miR-215 levels (p = 0.0229. Functional annotation of miR-215 target genes estimated by the Database for Annotation, Visualization and Integrated Discovery (DAVID bioinformatic tools involved cell cycle, mitosis, DNA repair and cell cycle checkpoint. Our study suggests a possible role of miR-215 in successful IM discontinuation.

  7. Analysis of ~21.5 d Period in Ionospheric and Solar Indices during 2011

    Directory of Open Access Journals (Sweden)

    YAO Yibin

    2017-01-01

    Full Text Available By using Fourier transform, the spectrum of total electron content(TEC data, relative sunspot number(RSSN, solar extreme ultraviolet(EUV flux in 0.1~50 nm and 26~34 nm were performed to study the ~27 d period in solar-terrestrial environment. A~21.5 d period was found in TEC and solar indices, while geomagnetic indices showed no sign of this period. We infer that the ~21.5 d period could combined effects of solar rotation and active region evolution. Results of the past few solar cycles show that 21~23 d of quasi-periodic signal will appear in the rising phase of a solar cycle. Using the solar active regions located in the[-10°, 10°] slice, it is further confirmed that the ~21.5 d period observed in 2011 may be caused by the joint effects of solar active region complex and solar rotation. GIM data were used to study the global distribution of the ~27 d period oscillation.

  8. Effective treatment of experimental U-87MG human glioblastoma in nude mice with a targeted cytotoxic bombesin analogue, AN-215

    OpenAIRE

    Szereday, Z; Schally, A V; Nagy, A; Plonowski, A; Bajo, A M; Halmos, G; Szepeshazi, K; Groot, K

    2002-01-01

    Some brain tumours, such as glioblastomas express high levels of receptors for bombesin/gastrin releasing peptide. We investigated whether bombesin/gastrin releasing peptide receptors found in glioblastoma cell lines can be utilised for targeting of a cytotoxic bombesin analogue, AN-215 consisting of a potent derivative of doxorubicin, 2-pyrrolino-doxorubicin (AN-201) linked to a bombesin-like peptide carrier. This study reports the effect of AN-215 on the growth of U-87MG human glioblastomas...

  9. Stem cell factor and interleukin-2/15 combine to enhance MAPK-mediated proliferation of human natural killer cells

    Science.gov (United States)

    Benson, Don M.; Yu, Jianhua; Becknell, Brian; Wei, Min; Freud, Aharon G.; Ferketich, Amy K.; Trotta, Rossana; Perrotti, Danilo; Briesewitz, Roger

    2009-01-01

    Stem cell factor (SCF) promotes synergistic cellular proliferation in combination with several growth factors, and appears important for normal natural killer (NK)–cell development. CD34+ hematopoietic precursor cells (HPCs) require interleukin-15 (IL-15) for differentiation into human NK cells, and this effect can be mimicked by IL-2. Culture of CD34+ HPCs or some primary human NK cells in IL-2/15 and SCF results in enhanced growth compared with either cytokine alone. The molecular mechanisms responsible for this are unknown and were investigated in the present work. Activation of NK cells by IL-2/15 increases expression of c-kit whose kinase activity is required for synergy with IL-2/15 signaling. Mitogen-activated protein kinase (MAPK) signaling intermediaries that are activated both by SCF and IL-2/15 are enhanced in combination to facilitate earlier cell-cycle entry. The effect results at least in part via enhanced MAPK-mediated modulation of p27 and CDK4. Collectively the data reveal a novel mechanism by which SCF enhances cellular proliferation in combination with IL-2/15 in primary human NK cells. PMID:19060242

  10. Effective treatment of experimental U-87MG human glioblastoma in nude mice with a targeted cytotoxic bombesin analogue, AN-215.

    Science.gov (United States)

    Szereday, Z; Schally, A V; Nagy, A; Plonowski, A; Bajo, A M; Halmos, G; Szepeshazi, K; Groot, K

    2002-04-22

    Some brain tumours, such as glioblastomas express high levels of receptors for bombesin/gastrin releasing peptide. We investigated whether bombesin/gastrin releasing peptide receptors found in glioblastoma cell lines can be utilised for targeting of a cytotoxic bombesin analogue, AN-215 consisting of a potent derivative of doxorubicin, 2-pyrrolino-doxorubicin (AN-201) linked to a bombesin-like peptide carrier. This study reports the effect of AN-215 on the growth of U-87MG human glioblastomas xenografted into nude mice. High affinity binding of AN-215 to U-87MG tumours was characterised by an IC(50) value of 4.0+/-0.1 nM, as determined by radioreceptor assays. mRNA analyses revealed the presence of mRNA for BN receptor subtypes 1 and 2. Treatment with AN-215 significantly (P<0.05) extended tumour doubling time from 4.54+/-0.2 days to 8.18+/-1.8 days and inhibited tumour growth as demonstrated by a 69.6% reduction in final tumour volume (P<0.001) and a 64.6% decrease in tumour weight as compared to controls. Cytotoxic radical AN-201 at the same dose was ineffective. The antitumour effect of AN-215 could be blocked by pretreatment with an excess of a bombesin antagonist, indicating that the action of this cytotoxic analogue is receptor-mediated. Our results suggest that patients with inoperable brain tumours such as malignant gliomas may benefit from targeted chemotherapy based on cytotoxic bombesin analogue AN-215. Copyright 2002 Cancer Research UK

  11. Space charge in drift chambers operated with the Xe, CO$_{2}$(15\\%) mixture

    CERN Document Server

    AUTHOR|(CDS)2070213; Blume, C; Braun-Munzinger, P; Bucher, D; Busch, O; Catanescu, V; Ciobanu, M; Daues, H W; Emschermann, D; Fateev, O V; Foka, Y; Garabatos, C; Gunji, T; Herrmann, N; Inuzuka, M; Kislov, E; Lindenstruth, V; Ludolphs, W; Mahmoud, T; Petracek, V; Petrovici, M; Rusanov, I R; Sandoval, A; Santo, R; Schicker, R; Simon, R S; Smykov, L P; Soltveit, H K; Stachel, J; Stelzer, H; Tsiledakis, G; Vulpescu, B; Wessels, J P; Windelband, B; Xu, C; Zaudtke, O; Zanevsky, Yu; Yurevich, V; 10.1016/j.nima.2004.01.076

    2004-01-01

    Using prototype modules of the ALICE Transition Radiation Detector (TRD) we investigate space-charge effects and the dependence of the pion rejection performance on the incident angle of the ionizing particle. The average pulse height distributions in the drift chambers operated with the Xe, CO //2(15%) mixture provide quantitative information on the gas gain reduction due to space charge accumulating during the drift of the primary ionization. Our results demonstrate that the pion rejection performance of a TRD is better for tracks which are not at normal incidence to the anode wires. We present detailed simulations of detector signals, which reproduce the measurements and lend strong support to our interpretation of the measurements in terms of space-charge effects.

  12. Relationship between serum cholesterol and body mass index in Nigeria schoolchildren aged 2-15 years.

    Science.gov (United States)

    Nwaiwu, Obiyo; Ibe, Bede C

    2015-04-01

    Non-communicable disease is becoming a public health problem that it is already present in more affluent countries. The aim of this study was to determine the relationship between body mass index (BMI) and total serum cholesterol with its lipoprotein fractions in children aged 2-15 years. Serum cholesterol was estimated using the enzymatic spectrophotometer cholesterol oxidase/peroxidase method. BMI was calculated as weight (kg)/height (m(2)). Total cholesterol and low-density lipoprotein were positively co-related with BMI (p cholesterol from known BMI values were developed. There is a positive correlation between BMI and serum cholesterol. BMI which is non-invasive is recommended as a screening tool for cardiovascular risk in settings where serum cholesterol cannot be routinely estimated. © The Author [2015]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Mejoras en el apuntado del telescopio de 2,15 mts de CASLEO

    Science.gov (United States)

    Aballay, J. L.; Casagrande, A. R.; Pereyra, P. F.; Marún, A. H.

    Con el objeto de optimizar el funcionamiento del telescopio de 2,15 mts. de CASLEO, se están eliminando los motores de calar, de guía y mecánica asociada. Para ésto, se están diseñando dos electrónicas que gobernarán, solamente, el motor de slew y el de tracking. Con el control del motor de slew se realizarán las funciones de slew y calar, controlando desde una PC la placa que maneja las rampas de velocidad. De este modo, el movimiento será programado y por lo tanto, más suave y preciso. Con el control del motor de tracking, a través de un generador de frecuencias programable desde una PC, se proveerá los movimientos necesarios para el tracking y guía.

  14. Self-biased 215 MHz magnetoelectric NEMS resonator for ultra-sensitive DC magnetic field detection.

    Science.gov (United States)

    Nan, Tianxiang; Hui, Yu; Rinaldi, Matteo; Sun, Nian X

    2013-01-01

    High sensitivity magnetoelectric sensors with their electromechanical resonance frequencies NEMS) resonator with an electromechanical resonance frequency of 215 MHz based on an AlN/(FeGaB/Al2O3) × 10 magnetoelectric heterostructure for detecting DC magnetic fields. This magnetoelectric NEMS resonator showed a high quality factor of 735, and strong magnetoelectric coupling with a large voltage tunable sensitivity. The admittance of the magnetoelectric NEMS resonator was very sensitive to DC magnetic fields at its electromechanical resonance, which led to a new detection mechanism for ultra-sensitive self-biased RF NEMS magnetoelectric sensor with a low limit of detection of DC magnetic fields of ~300 picoTelsa. The magnetic/piezoelectric heterostructure based RF NEMS magnetoelectric sensor is compact, power efficient and readily integrated with CMOS technology, which represents a new class of ultra-sensitive magnetometers for DC and low frequency AC magnetic fields.

  15. Space charge in drift chambers operated with the Xe,CO2(15%) mixture

    CERN Document Server

    Andronic, A

    2004-01-01

    Using prototype modules of the ALICE Transition Radiation Detector we investigate space charge effects and the dependence of the pion rejection performance on the incident angle of the ionizing particle. The average pulse height distributions in the drift chambers operated with the Xe,CO2(15%) mixture provide quantitative information on the gas gain reduction due to space charge accumulating during the drift of the primary ionization. Our results demonstrate that the pion rejection performance of a TRD is better for tracks which are not at normal incidence to the anode wires. We present detailed simulations of detector signals, which reproduce the measurements and lend strong support to our interpretation of the measurements in terms of space charge effects.

  16. 48 CFR 52.215-20 - Requirements for Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data.

    Science.gov (United States)

    2010-10-01

    ... Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data. 52.215-20 Section 52.215-20... Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data. As prescribed in 15.408(l), insert the following provision: Requirements for Certified Cost or Pricing Data and Data Other Than...

  17. 22 CFR 215.10 - Disclosure of record to person other than the individual to whom it pertains.

    Science.gov (United States)

    2010-04-01

    ... the United States for a civil or criminal law enforcement activity authorized by law: Provided, The... Information Act (5 U.S.C. 552); (3) For a routine use as defined in § 215.2; (4) To the Bureau of the Census for purposes of planning or carrying out a census or survey or related activity pursuant to the...

  18. Zum 215. Gebutstag von Admiral Ferdinand Baron von Wrangell : (29. Dezember 1797 - 25. 25. Mai 1870) / Peter Krienitz

    Index Scriptorium Estoniae

    Krienitz, Peter

    2012-01-01

    Admiral Ferdinand Baron von Wrangellist tema 215. sünniaastapäeva puhul. Silmapaistavast Kirde-Siberi uurijast. Tema poliitilisest tegevusest ja elust Roela mõisas. Ferdinand Baroni poolt seatud viisil tähistati jõulusid Roelas kuni 1944. aasta lõpuni.

  19. 215 GHz VLBI observations: Detection of fringes on the 1147 KM baseline Pico Veleta-Plateau de Bure

    NARCIS (Netherlands)

    Greve, A.; Torres, M.; Wink, J. E.; Grewing, M.; Wild, W.; Alcolea, J.; Barcia, A.; Colomer, F.; de Vincente, P.; Gomez-Gonzalez, J.; Lopez-Fernandez, I.; Graham, D. A.; Krichbaum, T. P.; Schwartz, R.; Standke, K. J.; Witzel, A.; Baudry, A.

    1995-01-01

    In a VLBI test experiment between the IRAM 3Om telescope at Pico Veleta,Spain, and one 15-m telescope of the IRAM interferometer on Plateau de Bure, France, we detected fringes at 215 GHz with signal to noise ratios between 6 8 and 10.2. On this 1147km long distance, of 0.28-0.43 milli arcseconds

  20. Hierarchical Cu4V2.15O9.38 micro-/nanostructures: a lithium intercalating electrode material

    Science.gov (United States)

    Zhou, Liang; Cui, Wangjun; Wu, Jiamin; Zhao, Qingfei; Li, Hexing; Xia, Yongyao; Wang, Yunhua; Yu, Chengzhong

    2011-03-01

    Hierarchical Cu4V2.15O9.38 micro-/nanostructures have been prepared by a facile ``forced hydrolysis'' method, from an aqueous peroxovanadate and cupric nitrate solution in the presence of urea. The hierarchical architectures with diameters of 10-20 µm are assembled from flexible nanosheets and rigid nanoplates with widths of 2-4 µm and lengths of 5-10 µm in a radiative way. The preliminary electrochemical properties of Cu4V2.15O9.38 have been investigated for the first time and correlated with its structure. This material delivers a large discharge capacity of 471 mA h g-1 above 1.5 V, thus making it an interesting electrode material for primary lithium ion batteries used in implantable cardioverter defibrillators.Hierarchical Cu4V2.15O9.38 micro-/nanostructures have been prepared by a facile ``forced hydrolysis'' method, from an aqueous peroxovanadate and cupric nitrate solution in the presence of urea. The hierarchical architectures with diameters of 10-20 µm are assembled from flexible nanosheets and rigid nanoplates with widths of 2-4 µm and lengths of 5-10 µm in a radiative way. The preliminary electrochemical properties of Cu4V2.15O9.38 have been investigated for the first time and correlated with its structure. This material delivers a large discharge capacity of 471 mA h g-1 above 1.5 V, thus making it an interesting electrode material for primary lithium ion batteries used in implantable cardioverter defibrillators. Electronic supplementary information (ESI) available: SEM images of hierarchical Cu4V2.15O9.38, CV curves of the electrode and discharge profiles of the cell made from Cu4V2.15O9.38 hierarchical structures, XRD pattern and SEM images of layered vanadium oxide hydrate, structure model of Cu4V2.15O9.38. See DOI: 10.1039/c0nr00657b

  1. Quantification of regional myocardial blood flow using dynamic H2(15)O PET and factor analysis.

    Science.gov (United States)

    Ahn, J Y; Lee, D S; Lee, J S; Kim, S K; Cheon, G J; Yeo, J S; Shin, S A; Chung, J K; Lee, M C

    2001-05-01

    Because the use of factor analysis has been proposed for extracting pure physiologic temporal or spatial information from dynamic nuclear medicine images, factor analysis should be capable of robustly estimating regional myocardial blood flow (rMBF) using H2(15)O PET without additional C15O PET, which is a cumbersome procedure for patients. Therefore, we measured rMBF using time-activity curves (TACs) obtained from factor analysis of dynamic myocardial H2(15)O PET images without the aid of C15O PET. H2(15)O PET of six healthy dogs at rest and during stress was performed simultaneously with microsphere studies using 85Sr, 46Sc, and 113SN: We performed factor analysis in two steps after reorienting and masking the images to include only the cardiac region. The first step discriminated each factor in the spatial distribution and acquired the input functions, and the second step extracted regional-tissue TACS: Image-derived input functions obtained by factor analysis were compared with those obtained by the sampling method. rMBF calculated using a compartmental model with tissue TACs from the second step of the factor analysis was compared with rMBF measured by microsphere studies. Factor analysis was successful for all the dynamic H2(15)O PET images. The input functions obtained by factor analysis were nearly equal to those obtained by arterial blood sampling, except for the expected delay. The correlation between rMBF obtained by factor analysis and rMBF obtained by microsphere studies was good (r = 0.95). The correlation between rMBF obtained by the region-of-interest method and rMBF obtained by microsphere studies was also good (r = 0.93). rMBF can be measured robustly by factor analysis using dynamic myocardial H2(15)O PET images without additional C15O blood-pool PET.

  2. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  3. Autoguía para el telescopio 2,15 mts de CASLEO

    Science.gov (United States)

    Aballay, J. A.; Casagrande, A. R.; Pereyra, P. F.; Marún, A. H.

    Se está desarrollando un sistema de autoguía para el telescopio de 2,15 mts. El mismo se realizará aprovechando el Offset Guider. Al ocular móvil de éste se vinculará alguna cámara digital (ST4-ST7-CH250) para lograr la visión del objeto. El funcionamiento del equipo será el siguiente: primero, dadas las coordenadas del objeto a observar, se tomarán las coordenadas del telescopio para que, a través de una base de datos, se determine un campo de objetos que sirvan para la cámara de visión, luego, la PC obtendrá el offset entre la estrella de observación y la estrella seleccionada como guía, este valor será trasladado a los motores que posicionarán en forma automática el ocular. Una vez que la estrella es visualizada en la cámara (monitor de PC ) se correrá el programa que guiará el telescopio automáticamente.

  4. Enkele gedagtes oor Matteus se gebruikmaking van die Ou Testament in Matteus 2:15

    Directory of Open Access Journals (Sweden)

    A. B. du Toit

    1986-01-01

    Full Text Available Some thoughts on Matthew's usage of the Old Testament in Matthew 2:15 To make general statements on Old Testament quotations in the New is extremely hazardous. Therefore one citation only is pinpointed. The micro-context of Matthew's citation of Hosea 11:1 shows that a very close relationship between Jesus and Israel is established and that the sojourn in Egypt is doubly divinely sanctioned. An analysis of the quotation within the wider gospel context not only confirms this but also shows that Matthew uses it in a very sophisticated way. He intends 'theologizing' Jesus' childhood movements, showing them to be part of God's plan for his Messiah. This may also have an apologetic undertone. The quotation is in another sense christologically important: It forms part of a chain of Christological pronouncements. Jesus' identity can, however, only be revealed by God himself. We cannot endorse Matthew's usage of the Old Testament quotation in Hosea 11:1, but we can appreciate how he came to his understanding of it. His association of Jesus with Israel must have played a major role. More information on the Wirkungsgeschichte of this text in Early Judaism would probably have furthered our understanding.

  5. Foco Nasmyth para el telescopio 2,15mts. de CASLEO

    Science.gov (United States)

    Casagrande, A. R.

    En principio, este proyecto intenta lograr el mayor aprovechamiento posible del instrumental que se dispone, buscando la manera de optimizar y hacer más eficiente el servicio que brinda el CASLEO a la comunidad astronómica. El mismo consiste en utilizar dispositivos ya existentes en el telescopio, y darle una utilidad. Tal es el caso del camino óptico destinado al foco Coude. Si tenemos en cuenta que disponemos de un tercer espejo Coude, con todos sus mecanismos automatizados, (actualmente sin uso), una distancia apropiada del plano focal, el espacio y el lugar físico necesario para instalar un periférico, es posible la habilitación de un foco Nasmyth en el telescopio 2,15mts. El hecho de contar con este nuevo foco, redundará en importantes beneficios. En primer lugar, posibilitará la observación, casi simultánea, con dos instrumentos. Otro aspecto a tener en cuenta, es que disminuirá el frecuente cambio del instrumental periférico, motivo este que degrada su ideal puesta a punto. Por último, también de interés, es de destacar su escaso costo de ejecución.

  6. Biopsy of human morula-stage embryos: outcome of 215 IVF/ICSI cycles with PGS.

    Directory of Open Access Journals (Sweden)

    Elena E Zakharova

    Full Text Available Preimplantation genetic diagnosis (PGD is commonly performed on biopsies from 6-8-cell-stage embryos or blastocyst trophectoderm obtained on day 3 or 5, respectively. Day 4 human embryos at the morula stage were successfully biopsied. Biopsy was performed on 709 morulae from 215 ICSI cycles with preimplantation genetic screening (PGS, and 3-7 cells were obtained from each embryo. The most common vital aneuploidies (chromosomes X/Y, 21 were screened by fluorescence in situ hybridization (FISH. No aneuploidy was observed in 72.7% of embryos, 91% of those developed to blastocysts. Embryos were transferred on days 5-6. Clinical pregnancy was obtained in 32.8% of cases, and 60 babies were born. Patients who underwent ICSI/PGS treatment were compared with those who underwent standard ICSI treatment by examining the percentage of blastocysts, pregnancy rate, gestational length, birth height and weight. No significant differences in these parameters were observed between the groups. Day 4 biopsy procedure does not adversely affect embryo development in vitro or in vivo. The increased number of cells obtained by biopsy of morulae might facilitate diagnostic screening. There is enough time after biopsy to obtain PGD results for embryo transfer on day 5-6 in the current IVF cycle.

  7. TOGp, the Human Homolog of XMAP215/Dis1, Is Required for Centrosome Integrity, Spindle Pole Organization, and Bipolar Spindle Assembly

    OpenAIRE

    Cassimeris, Lynne; Morabito, Justin

    2004-01-01

    The XMAP215/Dis1 MAP family is thought to regulate microtubule plus-end assembly in part by antagonizing the catastrophe-promoting function of kin I kinesins, yet XMAP215/Dis1 proteins localize to centrosomes. We probed the mitotic function of TOGp (human homolog of XMAP215/Dis1) using siRNA. Cells lacking TOGp assembled multipolar spindles, confirming results of Gergely et al. (2003. Genes Dev. 17, 336–341). Eg5 motor activity was necessary to maintain the multipolar morphology. Depletion of...

  8. Improved energy of the 21.5 keV M1 + E2 nuclear transition in {sup 151}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); National University, Institute of Applied Physics, Tashkent (Uzbekistan); Kovalik, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Filosofov, D.V.; Perevoshchikov, L.L. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Rysavy, M. [Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Baimukhanova, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Institute of Nuclear Physics, Almaty (Kazakhstan)

    2016-05-15

    Using internal conversion electron spectroscopy, improved energy 21 541.5±0.5 eV was determined for the 21.5 keV M1+E2 nuclear transition in {sup 151}Eu populated in the electron capture decay of {sup 151}Gd. This value was found to agree well with the present adopted value but is much more accurate. A value of 0.0305±0.0011 derived for the E2 admixture parameter vertical stroke δ(E2/M1) vertical stroke from the measured conversion electron line intensities corresponds to the present adopted value. A possible effect of nuclear structure on the multipolarity of the 21.5 keV transition was also investigated. (orig.)

  9. Road to Grid Parity through Deployment of Low-Cost 21.5% N-Type Si Solar Cells

    Energy Technology Data Exchange (ETDEWEB)

    Velundur, Vijay [Suniva, Norcross, GA (United States)

    2017-04-19

    This project seeks to develop and deploy differentiated 21.5% efficient n-type Si solar cells while reaching the SunShot module cost goal of ≤ $0.50/W. This objective hinges on development of enabling low cost technologies that simplify the manufacturing process and reduce overall processing costs. These comprise of (1) Boron emitter formation and passivation; (2) Simplified processing process for emitter and BSF layers; and (3) Advanced metallization for the front and back contacts.

  10. Neuroligin 2 R215H Mutant Mice Manifest Anxiety, Increased Prepulse Inhibition, and Impaired Spatial Learning and Memory

    Directory of Open Access Journals (Sweden)

    Chia-Hsiang Chen

    2017-11-01

    Full Text Available Neuroligin 2 (NLGN2 is a postsynaptic adhesion protein that plays an essential role in synaptogenesis and function of inhibitory neuron. We previously identified a missense mutation R215H of the NLGN2 in a patient with schizophrenia. This missense mutation was shown to be pathogenic in several cell-based assays. The objective of this study was to better understand the behavioral consequences of this mutation in vivo. We generated a line of transgenic mice carrying this mutation using a recombinant-based method. The mice were subjected to a battery of behavioral tests including open field locomotor activity assay, prepulse inhibition (PPI assay, accelerated rotarod test, novel location and novel recognition tests, elevated plus-maze (EPM test, and Morris water maze test. The transgenic animals were viable and fertile, but the Nlgn2 R215H knock-in (KI homozygous mice showed growth retardation, anxiety-like behavior, increased PPI, and impaired spatial learning and memory. There was no significant interaction between sex and genotype in most behavioral tests; however, we observed a significant interaction between sex and genotype in EPM test in this study. Also, we found that the Nlgn2 R215H homozygous KI mice did not express the NLGN2 protein, resembling Nlgn2 knockout mice. Our results demonstrate that Nlgn2 R215H KI homozygous mice manifest several behavioral abnormalities similar to those found in psychiatric patients carrying NLGN2 mutations, indicating that dysfunction of NLGN2 contributes to the pathogenesis of certain psychiatric symptoms commonly present in various mental disorders, not limited to schizophrenia.

  11. Neuroligin 2 R215H Mutant Mice Manifest Anxiety, Increased Prepulse Inhibition, and Impaired Spatial Learning and Memory.

    Science.gov (United States)

    Chen, Chia-Hsiang; Lee, Pin-Wei; Liao, Hsiao-Mei; Chang, Pi-Kai

    2017-01-01

    Neuroligin 2 ( NLGN2 ) is a postsynaptic adhesion protein that plays an essential role in synaptogenesis and function of inhibitory neuron. We previously identified a missense mutation R215H of the NLGN2 in a patient with schizophrenia. This missense mutation was shown to be pathogenic in several cell-based assays. The objective of this study was to better understand the behavioral consequences of this mutation in vivo . We generated a line of transgenic mice carrying this mutation using a recombinant-based method. The mice were subjected to a battery of behavioral tests including open field locomotor activity assay, prepulse inhibition (PPI) assay, accelerated rotarod test, novel location and novel recognition tests, elevated plus-maze (EPM) test, and Morris water maze test. The transgenic animals were viable and fertile, but the Nlgn2 R215H knock-in (KI) homozygous mice showed growth retardation, anxiety-like behavior, increased PPI, and impaired spatial learning and memory. There was no significant interaction between sex and genotype in most behavioral tests; however, we observed a significant interaction between sex and genotype in EPM test in this study. Also, we found that the Nlgn2 R215H homozygous KI mice did not express the NLGN2 protein, resembling Nlgn2 knockout mice. Our results demonstrate that Nlgn2 R215H KI homozygous mice manifest several behavioral abnormalities similar to those found in psychiatric patients carrying NLGN2 mutations, indicating that dysfunction of NLGN2 contributes to the pathogenesis of certain psychiatric symptoms commonly present in various mental disorders, not limited to schizophrenia.

  12. Retrospective analysis of the clinical behavior of oral hairy leukoplakia in 215 HIV-seropositive patients

    Directory of Open Access Journals (Sweden)

    Daniela Assis do VALE

    Full Text Available Abstract Oral manifestations are common findings in human immunodeficiency virus (HIV infected patients and frequently influence the overall health. Oral hairy leukoplakia (OHL is strongly associated with HIV infection demonstrating its relationship with the individual’s immune status and progression of immunosuppression. This study aims to retrospectively evaluate OHL in HIV patients, analyzing its incidence, demographic aspects and possible changes in clinical and epidemiological profile of the disease over 17 years. The records of 1600 HIV-infected patients were reviewed. The data were correlated and analyzed, considering HIV exposure category, age, gender, harmful habits, CD4 level, use and type of antiretroviral. OHL was observed in 215 (13.4% patients. Most were men in the fourth decade of life, 171 (79.5% and 112 (52,1% respectively, but an increase in the incidence of OHL among female patients and those in the fifth decade of life was observed. Tobacco smoking was the most frequent harmful habit reported by 114 (68% patients. OHL occurred mostly in patients with CD4 counts between 200 and 500 cells/mm3 35 (55.5%. The lower incidence of OHL was found among patients using at least one non-nucleoside reverse transcriptase inhibitor (NNRTI. OHL is related to CD4 count, use of ARVT and tobacco smoking and is also more prevalent in men in the fourth decade of life. These characteristics were recognized in absolute values, but when verifying the behavior over the years we noticed that the incidence of OHL is decreasing and its epidemiological characteristics changing.

  13. Improved CYP3A4 Molecular Models Accurately Predict Phe215 Requirement for Raloxifene Dehydrogenation Selectivity

    Science.gov (United States)

    Moore, Chad D.; Shahrokh, Kiumars; Sontum, Stephen F.; Cheatham, Thomas E.; Yost, Garold S.

    2010-01-01

    The use of molecular modeling in conjunction with site-directed mutagenesis has extensively been used to study substrate orientation within cytochrome P450 active sites, and to identify potential residues involved in positioning and catalytic mechanisms of these substrates. However, because docking studies utilize static models to simulate dynamic P450 enzymes, the effectiveness of these studies are highly dependent on accurate enzyme models. This study employed a cytochrome P450 3A4 (CYP3A4) crystal structure (PDB code:1W0E) to predict the sites of metabolism of the known CYP3A4 substrate raloxifene. In addition, partial charges were incorporated into the P450 heme moiety to investigate the effect of the modified CYP3A4 model on metabolite prediction with the ligand-docking program Autodock. Dehydrogenation of raloxifene to an electrophilic di-quinone methide intermediate has been linked to the potent inactivation of CYP3A4. Active site residues involved in the positioning and/or catalysis of raloxifene supporting dehydrogenation were identified with the two models, and site-directed mutagenesis studies were conducted to validate the models. The addition of partial charges to the heme moiety increased accuracy of the docking studies, increasing the number of conformations predicting dehydrogenation, and facilitating the identification of substrate/active site residue interactions. Based on the improved model, the Phe215 residue was hypothesized to play an important role in orienting raloxifene for dehydrogenation through a combination of electrostatic and steric interactions. Substitution of this residue with glycine or glutamine significantly decreased dehydrogenation rates without concurrent changes in the rates of raloxifene oxygenation. Thus, the improved structural model predicted novel enzyme/substrate interactions that control the selective dehydrogenation of raloxifene to its protein-binding intermediate. PMID:20812728

  14. Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Fabao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); You, Xiaona [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Chi, Xiumei [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Wang, Tao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Ye, Lihong [Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); Niu, Junqi, E-mail: junqiniu@yahoo.com.cn [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Zhang, Xiaodong, E-mail: zhangxd@nankai.edu.cn [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China)

    2014-02-07

    Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells.

  15. Cámara CCD Directa con el Telescopio de 2.15 m del CASLEO: algunos diagnósticos

    Science.gov (United States)

    Cellone, S. A.

    Se efectuaron algunas pruebas con la cámara CCD (+ Reductor Focal) instalada en el foco Cassegrain del Telescopio de 2.15 m del Complejo Astronómico El Leoncito (CASLEO). Las conclusiones más significativas son: Los tiempos de exposición efectivos difieren de los nominales en una fracción apreciable de segundo. En exposiciones de menos de 3 segundos, la iluminación no es pareja en todo el detector. En consecuencia, se recomiendan los pasos a seguir por los astrónomos tanto durante la observación como en la reducción de sus datos.

  16. A phase I, randomized, single-dose study evaluating the pharmacokinetic equivalence of biosimilar ABP 215 and bevacizumab in healthy adult men.

    Science.gov (United States)

    Markus, Richard; Chow, Vincent; Pan, Zhiying; Hanes, Vladimir

    2017-10-01

    This study compared the pharmacokinetic (PK) profiles of the proposed biosimilar ABP 215 with bevacizumab in healthy males. In this randomized, single-blind, single-dose, three-arm, parallel-group study, healthy subjects were randomized to receive ABP 215 (n = 68), bevacizumab (US) (n = 67), or bevacizumab (EU) (n = 67) 3 mg/kg intravenously. Primary endpoints were area under the serum concentration-time curve from time 0 extrapolated to infinity (AUCinf) and the maximum observed concentration (C max). Secondary endpoints included safety and immunogenicity. AUCinf and C max were similar across the three groups. Geometric means ratio (GMR) for C max and AUCinf, respectively, was 0.98 and 0.99 for ABP 215 versus bevacizumab (US); 1.03 and 0.96 for ABP 215 versus bevacizumab (EU); and 1.05 and 0.97 for bevacizumab (US) versus bevacizumab (EU). The 90% confidence intervals for the GMRs of AUCinf and C max were within the prespecified standard PK bioequivalence criteria of 0.80 to 1.25. The incidence of adverse events (AEs) was 47.1, 32.8, and 61.2% in the ABP 215, bevacizumab (US) and bevacizumab (EU) groups, respectively. When analyzed by investigational site, the incidence and severity of AEs were comparable in the ABP 215 and bevacizumab groups. There were no AEs leading to study discontinuation. No binding or neutralizing anti-drug anti-bodies was detected. This study demonstrated the PK similarity of ABP 215 to both bevacizumab (US) and bevacizumab (EU), and of bevacizumab (US) to bevacizumab (EU). Safety and tolerability were comparable between treatments and no subject developed binding or neutralizing anti-drug anti-bodies.

  17. Limited ability of humoral immune responses in control of viremia during infection with SIVsmmD215 strain

    Energy Technology Data Exchange (ETDEWEB)

    Ribiero, Ruy M [Los Alamos National Laboratory

    2009-01-01

    To investigate the impact of humoral immunity on SIV replication, 11 rhesus macaques (RMs) were inoculated with the neutralization-sensitive strain SIVsmmD215. Seven RMs were treated every three weeks, with 50 mglkg of an anti-CD20 antibody (Rituxan, gift from Genentech) starting from day -7 p.i., as follows: four RMs were treated for two months, and three were treated for five months. The remaining four RMs were used as controls. Three RMs were completely depleted of CD20 cells. Four RMs only partially depleted CD20 cells in the LNs and intestine. The efficacy of tissue CD20 depletion predicted the ablation of antibody production, with SIVsmm seroconversion being delayed in the animals with complete tissue CD20 depletion, and neutralizing antibody production being significantly delayed and at low levels in all CD20-depleted RMs. There was no significant difference in acute or chronic VLs between CD20-depleted RMs and control monkeys, with a tendency for lower set-point VLs in CD20-depleted RMs. At 6 weeks p.i., cellular immune responses were significantly stronger in CD20 depleted RMs than in controls. After two years p.i., there was no significant difference in survival between CD20-depleted and control RMs. We concluded that CD20 depletion plays no significant role in the control of SIV replication or disease progression in SIVsmmD215-infected RMs.

  18. Adaptation of the fish juvenile growth test (OECD TG 215, 2000) to the marine species Dicentrarchus labrax.

    Science.gov (United States)

    Tornambè, A; Manfra, L; Canepa, S; Oteri, F; Martuccio, G; Cicero, A M; Magaletti, E

    2018-02-01

    The OECD TG 215 method (2000) (C.14 method of EC Regulation 440/2008) was developed on the rainbow trout (Oncorynchus mykiss) to assess chronic toxicity (28d) of chemicals on fish juveniles. It contemplates to use other well documented species identifying suitable conditions to evaluate their growth. OECD proposes the European sea bass (Dicentrarchus labrax, L. 1758) as Mediterranean species among vertebrates recommended in the OECD guidelines for the toxicity testing of chemicals. In this context, our study is aimed to proposing the adaptation of the growth test (OECD TG 215, 2000) to D. labrax. For this purpose toxicity tests were performed with sodium dodecyl sulfate, a reference toxicant commonly used in fish toxicity assays. The main aspects of the testing procedure were reviewed: fish size (weight), environmental conditions, dilution water type, experimental design, loading rate and stocking density, feeding (food type and ration), test validity criteria. The experience gained from growth tests with the sea bass allows to promote its inclusion among the species to be used for the C.14 method. Copyright © 2016. Published by Elsevier Inc.

  19. Modulation of Pulmonary Vascular Remodeling in Hypoxia: Role of 15-LOX-2/15-HETE-MAPKs Pathway

    Directory of Open Access Journals (Sweden)

    Xiufeng Yu

    2015-04-01

    Full Text Available Background: We have previously shown that 15-hydroxyeicosatetraenoic acid (15-HETE plays a critical role in pulmonary hypertension (PH-associated vascular remodeling. However, the signaling mechanisms remain unclear. The purpose of this study was to investigate the role of 15-lipoxygenase-2 (15-LO-2/15-HETE-mitogen-activated protein kinases (MAPKs pathway in hypoxia-induced pulmonary vascular remodeling and the underlying mechanisms. Methods: The arterial wall thickness was measured by hematoxylin and eosin (HE staining in distal pulmonary arteries isolated from normal and PAH patient-derived lungs. The protein expression of phosphorylated extracellular signal-regulated kinase (p-ERK and phosphorylated p38 mitogen-activated protein kinases (p-p38MAPK were measured by Western blot in the lungs of PAH patients and hypoxia-induced rats. The apoptosis of cultured rat pulmonary arterial smooth muscle cells (PASMCs was determined by Terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL and Flow cytometry. The cell proliferation and cell cycle in PASMCs following hypoxia were analyzed by bromodeoxyuridine incorporation and flow cytometry, respectively. Results: Our results showed that the levels of p-ERK and p-p38MAPK were both drastically elevated in lungs from human patients and hypoxic rats. The HE staining revealed that the medial wall thickness was higher in patients with PAH than normal humans. In cultured PASMCs, Hypoxia stimulated the cell proliferation, the cell cycle progression, and subsequently promoted cell differentiation and cell migration leading to the suppressed cell apoptosis. Furthermore, MAPKs- induced cell proliferation and anti-apoptosis in PASMCs is 15-LO-2/15HETE activation-dependent. Conclusion: Our study indicates that hypoxia-induced pulmonary vascular remodeling is associated with increased levels of 15-LO-2 and 15-HETE. 15-LO-2/15-HETE stimulates the cell proliferation and anti-apoptosis in PASMCs through

  20. “Remotion” Total Wrist Arthroplasty: Preliminary Results of a Prospective International Multicenter Study of 215 Cases

    DEFF Research Database (Denmark)

    Herzberg, Guillaume; Boeckstyns, Michel Ernest Henri; Sorensen, Allan Ibsen

    2012-01-01

    This study reports the current results of an international multicenter study of one last generation total wrist arthroplasty (TWA) ("ReMotion," Small Bone Innovation, Morristown, PA). The two first authors (G.H. and M.B.) built a Web-based prospective database including clinical and radiological...... preoperative and postoperative reports of "ReMotion" TWA at regular intervals. The cases of 7 centers with more than 15 inclusions were considered for this article. A total of 215 wrists were included. In the rheumatoid arthritis (RA; 129 wrists) and nonrheumatoid arthritis (non-RA; 86 wrists) groups......, there were respectively 5 and 6% complications requiring implant revision with a survival rate of 96 and 92%, respectively, at an average follow-up of 4 years. Within the whole series, only one dislocation was observed in one non-RA wrist. A total of 112 wrists (75 rheumatoid and 37 nonrheumatoid) had more...

  1. MiR-21-5p in urinary extracellular vesicles is a novel biomarker of urothelial carcinoma.

    Science.gov (United States)

    Matsuzaki, Kyosuke; Fujita, Kazutoshi; Jingushi, Kentaro; Kawashima, Atsunari; Ujike, Takeshi; Nagahara, Akira; Ueda, Yuko; Tanigawa, Go; Yoshioka, Iwao; Ueda, Koji; Hanayama, Rikinari; Uemura, Motohide; Miyagawa, Yasushi; Tsujikawa, Kazutake; Nonomura, Norio

    2017-04-11

    Extracellular vesicles are lipid bilayer vesicles containing protein, messengerRNA and microRNA. Cancer cell-derived extracellular vesicles may be diagnostic and therapeutic targets. We extracted extracellular vesicles from urine of urothelial carcinoma patients and the control group to identify cancer-specific microRNAs in urinary extracellular vesicles as new biomarkers. microRNA from urinary extracellular vesicles extracted from 6 urothelial carcinoma patients and 3 healthy volunteers was analyzed. We verified candidate microRNAs in an independent cohort of 60 urinary extracellular vesicles samples. To normalize the microRNA expression level in extracellular vesicles, we examined the following in extracellular vesicles: protein concentration, CD9 intensity, amounts of whole miRNAs, RNA U6B small nuclear expression and the creatinine concentration of original urine correlating with the counts of extracted extracellular vesicles measured by the NanoSight™ system. From the microarray results 5 microRNAs overexpressed in urinary extracellular vesicles of urothelial carcinoma patients were identified. Creatinine concentration of original urine correlated most with particle counts of extracellular vesicles, indicating that creatinine could be a new tool for normalizing microRNA expression. MiR-21-5p was the most potent biomarker in urinary extracellular vesicles (sensitivity, 75.0%; specificity, 95.8%) and was also overexpressed in urinary extracellular vesicles from urothelial carcinoma patients with negative urine cytology. For the subgroup with negative urine cytology, the sensitivity was 75.0% and specificity was 95.8%. MiR-21-5p in urinary extracellular vesicles could be a new biomarker of urothelial carcinoma, especially for urothelial carcinoma patients with negative urine cytology.

  2. 48 CFR 52.215-21 - Requirements for Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing...

    Science.gov (United States)

    2010-10-01

    ... Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data-Modifications. 52.215-21... Requirements for Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data... Pricing Data and Data Other Than Certified Cost or Pricing Data—Modifications (OCT 2010) (a) Exceptions...

  3. XMAP215 polymerase activity is built by combining multiple tubulin-binding TOG domains and a basic lattice-binding region.

    Science.gov (United States)

    Widlund, Per O; Stear, Jeffrey H; Pozniakovsky, Andrei; Zanic, Marija; Reber, Simone; Brouhard, Gary J; Hyman, Anthony A; Howard, Jonathon

    2011-02-15

    XMAP215/Dis1 family proteins positively regulate microtubule growth. Repeats at their N termini, called TOG domains, are important for this function. While TOG domains directly bind tubulin dimers, it is unclear how this interaction translates to polymerase activity. Understanding the functional roles of TOG domains is further complicated by the fact that the number of these domains present in the proteins of different species varies. Here, we take advantage of a recent crystal structure of the third TOG domain from Caenorhabditis elegans, Zyg9, and mutate key residues in each TOG domain of XMAP215 that are predicted to be important for interaction with the tubulin heterodimer. We determined the contributions of the individual TOG domains to microtubule growth. We show that the TOG domains are absolutely required to bind free tubulin and that the domains differentially contribute to XMAP215's overall affinity for free tubulin. The mutants' overall affinity for free tubulin correlates well with polymerase activity. Furthermore, we demonstrate that an additional basic region is important for targeting to the microtubule lattice and is critical for XMAP215 to function at physiological concentrations. Using this information, we have engineered a "bonsai" protein, with two TOG domains and a basic region, that has almost full polymerase activity.

  4. Characterization of osteoclasts from patients harboring a G215R mutation in ClC-7 causing autosomal dominant osteopetrosis type II

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Schaller, Sophie

    2004-01-01

    Autosomal dominant osteopetrosis II (ADOII) is a relatively benign disorder caused by a missense mutation in the ClCN7 gene. In this study, we characterize the osteoclasts from patients with ADOII, caused by a G215R mutation, and investigate the effect on osteoclast function in vitro. Osteoclasts...

  5. Mutagenic study of codons 74 and 215 of the human immunodeficiency virus type 1 reverse transcriptase, which are significant in nucleoside analog resistance.

    Science.gov (United States)

    Lacey, S F; Larder, B A

    1994-05-01

    Mutation in the human immunodeficiency virus type 1 reverse transcriptase (RT) at codon 215 has been shown to play a significant role in resistance to zidovudine (AZT). Substitution of threonine with tyrosine or phenylalanine alone confers decreased susceptibility to the inhibitor. In this study we constructed a panel of 10 viruses with different amino acids at this codon, including 7 novel mutants, and assessed their susceptibilities to AZT. The majority of the new mutants were AZT sensitive, whereas the Thr-215-->Trp mutant was partially resistant (threefold less susceptible). A combination of the Thr-215-->Trp with the other AZT resistance mutations Lys-70-->Arg and Met-41-->Leu gave additive resistance. The Thr-215-->Phe virus was less AZT resistant than the Thr-215-->Tyr mutant, both on its own and when each was combined with the Met-41-->Leu mutant. These observations confirm the general hypothesis that increased bulk of the amino acid side chains at this position confers decreased AZT sensitivity. A leucine-to-valine substitution at codon 74 has previously been found to confer dideoxynucleoside resistance. We constructed mutants with five novel amino acid substitutions (Ala, Gly, Glu, Met, and Asp) at codon 74. Of these, only one (that with the Met substitution) retained enough RT activity to yield viable virus. It thus appears that there are severe structure-function constraints on the amino acid side chains at this position in the enzyme. The activities of the Leu-74-->Ala and Leu-74-->Met RT enzymes expressed in Escherichia coli appeared to have reduced susceptibility to ddGTP compared with the wild-type enzyme. The mutants described in this work may prove useful for correlation with structural studies of the human immunodeficiency virus type 1 RT.

  6. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Simultaneous Separation of Actinium and Radium Isotopes from a Proton Irradiated Thorium Matrix.

    Science.gov (United States)

    Mastren, Tara; Radchenko, Valery; Owens, Allison; Copping, Roy; Boll, Rose; Griswold, Justin R; Mirzadeh, Saed; Wyant, Lance E; Brugh, Mark; Engle, Jonathan W; Nortier, Francois M; Birnbaum, Eva R; John, Kevin D; Fassbender, Michael E

    2017-08-15

    A new method has been developed for the isolation of (223,224,225)Ra, in high yield and purity, from a proton irradiated (232)Th matrix. Herein we report an all-aqueous process using multiple solid-supported adsorption steps including a citrate chelation method developed to remove >99.9% of the barium contaminants by activity from the final radium product. A procedure involving the use of three columns in succession was developed, and the separation of (223,224,225)Ra from the thorium matrix was obtained with an overall recovery yield of 91 ± 3%, average radiochemical purity of 99.9%, and production yields that correspond to physical yields based on previously measured excitation functions.

  8. The release of dissolved actinium to the ocean: A global comparison of different end-members

    Science.gov (United States)

    Geibert, W.; Charette, M.; Kim, G.; Moore, W.S.; Street, J.; Young, M.; Paytan, A.

    2008-01-01

    The measurement of short-lived 223Ra often involves a second measurement for supported activities, which represents 227Ac in the sample. Here we exploit this fact, presenting a set of 284 values on the oceanic distribution of 227Ac, which was collected when analyzing water samples for short-lived radium isotopes by the radium delayed coincidence counting system. The present work compiles 227Ac data from coastal regions all over the northern hemisphere, including values from ground water, from estuaries and lagoons, and from marine end-members. Deep-sea samples from a continental slope off Puerto Rico and from an active vent site near Hawaii complete the overview of 227Ac near its potential sources. The average 227Ac activities of nearshore marine end-members range from 0.4??dpm m- 3 at the Gulf of Mexico to 3.0??dpm m- 3 in the coastal waters of the Korean Strait. In analogy to 228Ra, we find the extension of adjacent shelf regions to play a substantial role for 227Ac activities, although less pronounced than for radium, due to its weaker shelf source. Based on previously published values, we calculate an open ocean 227Ac inventory of 1.35 * 1018??dpm 227Acex in the ocean, which corresponds to 37??moles, or 8.4??kg. This implies a flux of 127??dpm m-2 y- 1 from the deep-sea floor. For the shelf regions, we obtain a global inventory of 227Ac of 4.5 * 1015??dpm, which cannot be converted directly into a flux value, as the regional loss term of 227Ac to the open ocean would have to be included. Ac has so far been considered to behave similarly to Ra in the marine environment, with the exception of a strong Ac source in the deep-sea due to 231Paex. Here, we present evidence of geochemical differences between Ac, which is retained in a warm vent system, and Ra, which is readily released [Moore, W.S., Ussler, W. and Paull, C.K., 2008-this issue. Short-lived radium isotopes in the Hawaiian margin: Evidence for large fluid fluxes through the Puna Ridge. Marine Chemistry]. Another potential mechanism of producing deviations in 227Ac/228Ra and daughter isotope ratios from the expected production value of lithogenic material is observed at reducing environments, where enrichment in uranium may occur. The presented data here may serve as a reference for including 227Ac in circulation models, and the overview provides values for some end-members that contribute to the global Ac distribution. ?? 2007 Elsevier B.V. All rights reserved.

  9. Words in melody: an H(2)15O PET study of brain activation during singing and speaking.

    Science.gov (United States)

    Jeffries, K J; Fritz, J B; Braun, A R

    2003-04-15

    We used H(2)15O PET to characterize the interaction of words and melody by comparing brain activity measured while subjects spoke or sang the words to a familiar song. Relative increases in activity during speaking vs singing were observed in the left hemisphere, in classical perisylvian language areas including the posterior superior temporal gyrus, supramarginal gyrus, and frontal operculum, as well as in Rolandic cortices and putamen. Relative increases in activity during singing were observed in the right hemisphere: these were maximal in the right anterior superior temporal gyrus and contiguous portions of the insula; relative increases associated with singing were also detected in the right anterior middle temporal gyrus and superior temporal sulcus, medial and dorsolateral prefrontal cortices, mesial temporal cortices and cerebellum, as well as in Rolandic cortices and nucleus accumbens. These results indicate that the production of words in song is associated with activation of regions within right hemisphere areas that are not mirror-image homologues of left hemisphere perisylvian language areas, and suggest that multiple neural networks may be involved in different aspects of singing. Right hemisphere mechanisms may support the fluency-evoking effects of singing in neurological disorders such as stuttering or aphasia.

  10. The 21.5-kDa isoform of myelin basic protein has a non-traditional PY-nuclear-localization signal

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Graham S.T.; Seymour, Lauren V. [Molecular and Cellular Biology, University of Guelph, Guelph, Ontario (Canada); Boggs, Joan M. [Molecular Structure and Function, Research Institute, Hospital for Sick Children, and Laboratory Medicine and Pathobiology, University of Toronto, Toronto, Ontario (Canada); Harauz, George, E-mail: gharauz@uoguelph.ca [Molecular and Cellular Biology, University of Guelph, Guelph, Ontario (Canada)

    2012-06-15

    Highlights: Black-Right-Pointing-Pointer Full-length 21.5-kDa MBP isoform is translocated to the nucleus. Black-Right-Pointing-Pointer We hypothesized that the exon-II-encoded sequence contained the NLS. Black-Right-Pointing-Pointer We mutated this sequence in RFP-tagged constructs and transfected N19-cells. Black-Right-Pointing-Pointer Abolition of two key positively-charged residues resulted in loss of nuclear-trafficking. Black-Right-Pointing-Pointer The 21.5-kDa isoform of classic MBP contains a non-traditional PY-NLS. -- Abstract: The predominant 18.5-kDa classic myelin basic protein (MBP) is mainly responsible for compaction of the myelin sheath in the central nervous system, but is multifunctional, having numerous interactions with Ca{sup 2+}-calmodulin, actin, tubulin, and SH3-domains, and can tether these proteins to a lipid membrane in vitro. The full-length 21.5-kDa MBP isoform has an additional 26 residues encoded by exon-II of the classic gene, which causes it to be trafficked to the nucleus of oligodendrocytes (OLGs). We have performed site-directed mutagenesis of selected residues within this segment in red fluorescent protein (RFP)-tagged constructs, which were then transfected into the immortalized N19-OLG cell line to view protein localization using epifluorescence microscopy. We found that 21.5-kDa MBP contains two non-traditional PY-nuclear-localization signals, and that arginine and lysine residues within these motifs were involved in subcellular trafficking of this protein to the nucleus, where it may have functional roles during myelinogenesis.

  11. Parametric image of myocardial blood flow generated from dynamic H2(15)O PET using factor analysis and cluster analysis.

    Science.gov (United States)

    Lee, J S; Lee, D S; Ahn, J Y; Cheon, G J; Kim, S-K; Yeo, J S; Park, K S; Chung, J-K; Lee, M C

    2005-09-01

    Algorithm-based parametric imaging of myocardial blood flow (MBF), as measured by H2(15)O PET, has been the goal of many research efforts. A method for generating parametric images of regional MBF by factor and cluster analysis on H2(15)O dynamic myocardial PET was validated by its comparison with gold-standard MBF values determined invasively using radiolabelled microspheres. Right and left ventricular blood pool activities and their factor images were obtained by the application of factor analysis to dynamic frames. By subtraction of the factor images multiplied by their corresponding values on the factors from the original dynamic images for each frame, pure tissue dynamic images were obtained, from which arterial blood activities were excluded. Cluster analysis that averaged pixels having time-activity curves with the same shape was applied to pure tissue images to generate parametric MBF images. The usefulness of this method for quantifying regional MBF was evaluated using canine experiment data. H2(15)O PET scans and microsphere studies were performed on seven dogs at rest and after pharmacological stress. The image qualities and the contrast of parametric images obtained using the proposed method were significantly improved over either the tissue factor images or the parametric images obtained using a conventional method. Regional MBFs obtained using the proposed method correlated well with those obtained by the region of interest method (r = 0.94) and by the microsphere technique (r = 0.90). A non-invasive method is presented for generating parametric images of MBF from H2(15)O PET, using factor and cluster analysis.

  12. Community-based IEC campaign. TFR has dropped to 2.15 in Binh Thanh District, Ho Chi Minh City.

    Science.gov (United States)

    Nguyen Ngoc Lich

    1995-01-01

    Binh Thanh District of Ho Chin Minh City in 1989 had a crude birth rate (CBR) of 20.3 per 1000 population and an average of 5.5 persons per household. The rate of total fertility (TFR) in the district was one of the highest among the city's 18 districts in 1990. Concerned about these demographics, the Binh Thanh District Committee for Population and Family Planning reviewed the family planning program with the goal of developing a special information, education, and communication (IEC) campaign. The following incentive scheme for sterilization was developed: each poor entrepreneur in need of seed money for new business ventures who allows himself to be sterilized receives dong 120,000 (US$11) from the National Committee for Population and Family Planning and dong 220,000 from the District Committee for Population and Family Planning to buy medicine and supplementary food. An IEC room was established in each commune health center to disseminate the relevant information. The results of the campaign have been positive, with 910 people requesting sterilization in 1994, 34% of whom were male. Over the period January-April 1995, the proportion of male sterilization increased dramatically, such that men accounted for 68% of the 153 people who underwent sterilization. The district now ranks the lowest among the 18 districts with regard to the percentage of couples with three children, the CBR is 15.3/1000, TFR is 2.15, the contraceptive prevalence rate is 68%, and sterilization is the fourth most popular method of contraception (13%) behind the IUD (37%), condom (30%), and oral pill (18.5%).

  13. [Local efficiency of percutaneous radiotherapy in lung cancer. Analysis of 215 repeated bronchoscopies in relation to applied radiation dosage].

    Science.gov (United States)

    Schwegler, N; Vrh, N; Kern, T; Notter, M; Frey, M; Grossenbacher, M; Hausmann, M; Pfenninger, T; Ragaz, A; Schmid, R; Siebenschein, R; Keller, R

    1996-02-01

    During a locoregional radiotherapy with curative attempts of lung cancer patients bronchoscopic examinations with biopsies and/or cytologic lavages were repeated to assess the accuracy of limiting the total dose to 60 Gy. In order of the applied dose macroscopic changements of the endoluminal tumor and microscopic elimination should be made out. The correlation between macro- and microscopical regression should allow a statement about reliability of single results. The clinical course and a conventional thoracic X-ray examination seemed to be a to large-meshed screen to evaluate the effect at the end of therapy. The aim was to improve the criterias of success and to adapt and optimize the radiation dose individually. The prospective, together with the pneumologists, defined treatment concept included the repetition of bronchoscopic evaluations after the application of 60 Gy and 80 Gy. These radiation doses from 60 Gy up to 80 Gy have been given with a shrinking-field technique to the mediastinum and the primary. In order to record statistically the optical tumor changements we were urged to create a so-called bT-score. The structure of this score was orientated towards the periphery of the tracheobronchial tree. Hundred and forty-four patients with endoscopically and histologically verified bronchogenic carcinomas were treated. On the subjects 215 re-bronchoscopies accomplished with biopsies were performed and allowed to analyze the macro- and microscopical behavior under treatment. A histological/cytological elimination of tumor was achieved after 60 Gy in 35.1%, after 80 Gy in 62.3%. Macroscopically no tumor was visible after 60 Gy in 43.6%, after 80 Gy in 82%. A correlation between identical micro- and macroscopical observations was only seen in 61%, respectively in 71%. The escalation of the radiation dose from 60 Gy up to 80 Gy with shrinked fields could increase the local tumor sterilization rate by 1.8 times from 35.1% to 62.3%. The refining and completion

  14. “Remotion” Total Wrist Arthroplasty: Preliminary Results of a Prospective International Multicenter Study of 215 Cases

    Science.gov (United States)

    Herzberg, Guillaume; Boeckstyns, Michel; Sorensen, Allan Ibsen; Axelsson, Peter; Kroener, Karsten; Liverneaux, Philippe; Obert, Laurent; Merser, Soren

    2012-01-01

    This study reports the current results of an international multicenter study of one last generation total wrist arthroplasty (TWA) (“ReMotion,” Small Bone Innovation, Morristown, PA). The two first authors (G.H. and M.B.) built a Web-based prospective database including clinical and radiological preoperative and postoperative reports of “ReMotion” TWA at regular intervals. The cases of 7 centers with more than 15 inclusions were considered for this article. A total of 215 wrists were included. In the rheumatoid arthritis (RA; 129 wrists) and nonrheumatoid arthritis (non-RA; 86 wrists) groups, there were respectively 5 and 6% complications requiring implant revision with a survival rate of 96 and 92%, respectively, at an average follow-up of 4 years. Within the whole series, only one dislocation was observed in one non-RA wrist. A total of 112 wrists (75 rheumatoid and 37 nonrheumatoid) had more than 2 years of follow-up (minimum: 2 years, maximum: 8 years). In rheumatoid and non-RA group, visual analog scale (VAS) pain score improved by 48 and 54 points, respectively, and QuickDASH score improved by 20 and 21 points, respectively, with no statistical differences. Average postoperative arc of wrist flexion–extension was 58 degrees in rheumatoid wrists (loss of 1 degree) compared with 63 degrees in non-RA wrists (loss of 9 degrees) with no statistical differences. Grip strength improved respectively by 40 and 19% in rheumatoid and non-RA groups (p = 0.033). Implant loosening was observed in 4% of the rheumatoid wrists and 3% of the non-RA wrists with no statistical differences. A Web-based TWA international registry was presented. Our results suggest that the use of the “ReMotion” TWA is feasible in the midterm both for rheumatoid and non-RA patients. This is a significant improvement compared with the previous generation TWA. The level of evidence for this study is IV. PMID:23904975

  15. CFTR depletion results in changes in fatty acid composition and promotes lipogenesis in intestinal Caco 2/15 cells.

    Directory of Open Access Journals (Sweden)

    Geneviève Mailhot

    2010-05-01

    Full Text Available Abnormal fatty acid composition (FA in plasma and tissue lipids frequently occurs in homozygous and even in heterozygous carriers of cystic fibrosis transmembrane conductance regulator (CFTR mutations. The mechanism(s underlying these abnormalities remained, however, poorly understood despite the potentially CFTR contributing role.The aim of the present study was to investigate the impact of CFTR depletion on FA uptake, composition and metabolism using the intestinal Caco-2/15 cell line. shRNA-mediated cftr gene silencing induced qualitative and quantitative modifications in FA composition in differentiated enterocytes as determined by gas-liquid chromatography. With the cftr gene disruption, there was a 1,5 fold increase in the total FA amount, largely attributable to monounsaturated and saturated FA compared to controls. The activity of delta-7 desaturase, estimated by the 16:1(n-7/16:0, was significantly higher in knockdown cells and consistent with the striking elevation of the n-7 FA family. When incubated with [14C]-oleic acid, CFTR-depleted cells were capable of quick incorporation and export to the medium concomitantly with the high protein expression of L-FABP known to promote intracellular FA trafficking. Accordingly, lipoprotein vehicles (CM, VLDL, LDL and HDL, isolated from CFTR knockdown cells, exhibited higher levels of radiolabeled FA. Moreover, in the presence of [14C]-acetate, knockdown cells exhibited enhanced secretion of newly synthesized phospholipids, triglycerides, cholesteryl esters and free FA, thereby suggesting a stimulation of the lipogenic pathway. Conformably, gene expression of SREBP-1c, a key lipogenic transcription factor, was increased while protein expression of the phosphorylated and inactive form of acetylCoA carboxylase was reduced, confirming lipogenesis induction. Finally, CFTR-depleted cells exhibited lower gene expression of transcription factors (PPARalpha, LXRalpha, LXRbeta and RXRalpha

  16. Resultados del tratamiento de 215 tumores pancreáticos y periampulares en el Hospital "Hermanos Ameijeiras"

    Directory of Open Access Journals (Sweden)

    José Luis González González

    Full Text Available Introducción. el cáncer pancreático es una de las neoplasias más letales, ocupa el quinto lugar en frecuencia en occidente y tiene una supervivencia asociada inferior al 20 % al año y al 3 % a los 5 años. La única posibilidad de curación la brindan intervenciones quirúrgicas de gran envergadura que conllevan una alta tasa de morbilidad y mortalidad. Objetivo: caracterizar a los pacientes según variables demográficas, enfermedades asociadas y manifestaciones clínicas, e identificar estudios de mayor valor para el diagnóstico y la relación entre las variables perioperatorias y la aparición de complicaciones, mortalidad hospitalaria y evolucion posoperatoria. Métodos. se realizó un estudio observacional, longitudinal y prospectivo con pacientes con tumores pancreáticos y periampulares que fueron tratados en el Servicio de Cirugía General del Hospital Clínico Quirúrgico "Hermanos Ameijeiras" entre enero de 2006 y diciembre de 2011. Resultados. hubo un total de 215 pacientes con tumores de páncreas: 178 lesiones periampulares y 37 lesiones del cuerpo y la cola de páncreas. Se resecaron 24 lesiones pancreáticas distales y fueron intervenidos quirúrgicamente 153 pacientes con lesiones periampulares, de las cuales se resecaron 83. Se realizaron 78 pancreatoduodenectomías cefálicas y la localización más frecuente fue la ampolla de Vater (36 pacientes, 50,7 %, seguida de la cabeza del páncreas (26 pacientes, 36,6 %. Hubo complicaciones en el 66,2 % de los pacientes. La mortalidad perioperatoria fue del 4,2 % y la hospitalaria del 23,9 %. Conclusiones. los tumores periampulares fueron más frecuentes entre los 50 y 69 años. La enfermedad asociada más frecuente fue la hipertensión arterial, y la ictericia, el síntoma fundamental. La colangiopancreatografía retrógrada endoscópica fue el examen de mayor sensibilidad. La mortalidad hospitalaria estuvo relacionada con las enfermedades asociadas, el tiempo quirúrgico, la

  17. Cleavage of the BRCT tandem domains of nibrin by the 657del5 mutation affects the DNA damage response less than the Arg215Trp mutation.

    Science.gov (United States)

    Mendez, Gina; Cilli, Domenica; Berardinelli, Francesco; Viganotti, Mara; Ascenzi, Paolo; Tanzarella, Caterina; Antoccia, Antonio; di Masi, Alessandra

    2012-10-01

    The Nijmegen breakage syndrome (NBS) is a genetic disorder caused by mutations in NBN gene and characterized by chromosomal instability and hypersensitivity to ionizing radiations (IR). The N-terminus of nibrin (NBN) contains a tandem breast cancer 1 (BRCA1) carboxy-terminal (BRCT) domain that represents one of the major mediators of phosphorylation-dependent protein-protein interactions in processes related to cell cycle checkpoint and DNA repair functions. Patients with NBS compound heterozygous for the 657del5 hypomorphic mutation and for the Arg215Trp missense mutation (corresponding to the 643C>T gene mutation) display a clinical phenotype more severe than that of patients homozygous for the 657del5 mutation. Here, we show that both the 657del5 and Arg215Trp mutations, occurring within the tandem BRCT domains of NBN, although not altering the assembly of the MRE11/RAD50/NBN (MRN) complex, affect the MRE11 IR-induced nuclear foci (IRIF) formation and the DNA double-strand break (DSB) signaling via the phosphorylation of both ataxia-telangiectasia-mutated (ATM) kinase and ATM downstream targets (e.g., SMC1 and p53). Remarkably, data obtained indicate that the cleavage of the BRCT tandem domains of NBN by the 657del5 mutation affects the DNA damage response less than the Arg215Trp mutation. Indeed, the 70-kDa NBN fragment, arising from the 657del5 mutation, maintains the capability to interact with MRE11 and γ-H2AX and to form IRIF. Altogether, the role of the tandem BRCT domains of NBN in the localization of the MRN complex at the DNA DSB and in the activation of the damage response is highlighted. Copyright © 2012 International Union of Biochemistry and Molecular Biology, Inc.

  18. Conformational stability and activity analysis of two hydroxymethylbilane synthase mutants, K132N and V215E, with different phenotypic association with acute intermittent porphyria

    Science.gov (United States)

    Bustad, Helene J.; Vorland, Marta; Rønneseth, Eva; Sandberg, Sverre; Martinez, Aurora; Toska, Karen

    2013-01-01

    The autosomal dominantly inherited disease AIP (acute intermittent porphyria) is caused by mutations in HMBS [hydroxymethylbilane synthase; also known as PBG (porphobilinogen) deaminase], the third enzyme in the haem biosynthesis pathway. Enzyme-intermediates with increasing number of PBG molecules are formed during the catalysis of HMBS. In this work, we studied the two uncharacterized mutants K132N and V215E comparative with wt (wild-type) HMBS and to the previously reported AIP-associated mutants R116W, R167W and R173W. These mainly present defects in conformational stability (R116W), enzyme kinetics (R167W) or both (R173W). A combination of native PAGE, CD, DSF (differential scanning fluorimetry) and ion-exchange chromatography was used to study conformational stability and activity of the recombinant enzymes. We also investigated the distribution of intermediates corresponding to specific elongation stages. It is well known that the thermostability of HMBS increases when the DPM (dipyrromethane) cofactor binds to the apoenzyme and the holoenzyme is formed. Interestingly, a decrease in thermal stability was measured concomitant to elongation of the pyrrole chain, indicating a loosening of the structure prior to product release. No conformational or kinetic defect was observed for the K132N mutant, whereas V215E presented lower conformational stability and probably a perturbed elongation process. This is in accordance with the high association of V215E with AIP. Our results contribute to interpret the molecular mechanisms for dysfunction of HMBS mutants and to establish genotype–phenotype relations for AIP. PMID:23815679

  19. Construction of novel pJRD215-derived plasmids using chloramphenicol acetyltransferase (cat gene as a selection marker for Acidithiobacillus caldus.

    Directory of Open Access Journals (Sweden)

    Rui Wang

    Full Text Available Acidithiobacillus caldus, a Gram-negative, chemolithotrophic sulfur-oxidizing bacterium, is widely applied in bioleaching. The absence of an ideal selection marker has become a major obstacle to achieve high efficiency of the gene transfer system for A. caldus. Plasmid pJRD215, widely used in Acidithiobacillus spp., has severe drawbacks in molecular manipulations and potential biosafety issues due to its mobility. Therefore, finding a new selection marker and constructing new plasmids have become an urgent and fundamental work for A. caldus.Effective inhibitory effect of chloramphenicol on the growth of A. caldus was elucidated for the first time. The P2-cat gene cassette, including a chloramphenicol acetyltransferase gene (cat from plasmid pACBSR and a promoter (P2 upstream of the tetracycline resistance gene on pBR322, was designed, chloramphenicol acetyltransferase was expressed in A. caldus, and the enzyme activity was assessed. A new vector pSDU1 carrying the replication and mobilization regions derived from pJRD215, the P2-cat gene cassette and a multiple cloning site from pUC19 was successfully constructed. Compared with pJRD215, pSDU1 had a 27-fold increase in electrotransformation efficiency (30.43±0.88×104 CFU/μg DNA for pSDU1 and 1.09±0.11×104 CFU/μg DNA for pJRD215, better carrying capacity and could offer more convenience for the restriction enzyme digestion. In addition, the generated plasmid pSDU1Δmob, a novel non-mobilizable derivative of pSDU1 lacking some DNA sequences involved in the mobilization process, had increased copy number in A. caldus and lost its mobility for biosafety considerations. Both pSDU1 and pSDU1Δmob exhibited stable maintenance in A. caldus within 50 passages. However, further deletion of orfEF region involved in regulating repAC operon resulted in a negative effect on transformation efficiency, copy number and stability of plasmid pSDU1ΔmobΔorfEF in A. caldus.Chloramphenicol was proved to be an

  20. Generation of parametric image of regional myocardial blood flow using H(2)(15)O dynamic PET and a linear least-squares method.

    Science.gov (United States)

    Lee, Jae Sung; Lee, Dong Soo; Ahn, Ji Young; Yeo, Jeong Seok; Cheon, Gi Jeong; Kim, Seok-Ki; Park, Kwang Suk; Chung, June-Key; Lee, Myung Chul

    2005-10-01

    Although a parametric image of myocardial blood flow (MBF) can be obtained from H(2)(15)O PET using factor and cluster analysis, this approach is limited when factor analysis fails to extract each cardiac component. In this study, a linear least-squares (LLS) method for estimating MBF and generating a MBF parametric image was developed to overcome this limitation. The computer simulation was performed to investigate the statistical properties of the LLS method, and MBF values obtained from the MBF parametric images in dogs were compared with those obtained using the conventional region of interest (ROI) and invasive microsphere methods. A differential model equation for H(2)(15)O in the myocardium was modified to incorporate the partial-volume and spillover effect. The equation was integrated from time 0 to each PET sampling point to obtain a linearlized H(2)(15)O model equation. The LLS solution of this equation was estimated and used to calculate the MBF, the perfusable tissue fraction (PTF), and the arterial blood volume fraction (V(a)). A computer simulation was performed using the input function obtained from canine experiments and the tissue time-activity curves contaminated by various levels of Poisson noise. The parametric image of the MBF, PTF, and V(a) was constructed using the PET data from dogs (n = 7) at rest and after pharmacologic stress. The regional MBF from the parametric image was compared with those produced by the ROI method using a nonlinear least-squares (NLS) estimation and an invasive radiolabeled microsphere technique. The simulation study showed that the LLS method was better than the NLS method in terms of statistical reliability, and the parametric images of the MBF, PTF, and V(a) using the LLS method had good image quality and contrast. The regional MBF values using the parametric image showed a good correlation with those using the ROI method (y = 0.84x + 0.40; r = 0.99) and the microsphere technique (y = 0.95x + 0.29; r = 0.96). The

  1. Photoselective Vaporesection of the Prostate with a Front-firing Lithium Triborate Laser: Surgical Technique and Experience After 215 Procedures.

    Science.gov (United States)

    Gong, Yong-Guang; Liu, Run-Ming; Gao, Rui

    2015-06-01

    Although photoselective vaporization of the prostate (PVP) is considered one of the most promising alternatives to transurethral radical prostatectomy, a longer operative time, an unsatisfactory tissue removal rate, and the absence of postoperative pathology samples remain the main criticisms for this procedure. To describe the novel technique of photoselective vaporesection of the prostate (PVRP) with a front-firing lithium triborate (LBO) laser and to report our initial experience. This is a prospective study of 215 patients undergoing PVRP between November 2011 and March 2013. Their average age, prostate size, and International Prostate Symptom Score (IPSS) were 70.3 ± 7.3 yr, 70.4 ± 34.0 ml, and 24.9 ± 5.0, respectively. The operative technique is detailed in the accompanying video. Perioperative data were collected. The patients were followed up at 3, 6, 12 mo after PVRP, and functional outcomes and complications were assessed. The mean operation time was 44.1 ± 22.6 min. The mean hemoglobin decrease was 0.37 ± 0.21 g/dl. The catheterization time was 23.9 ± 15.2 h and the postoperative hospital stay was 1.8 ± 0.8 d. Significant improvements were observed in maximum flow, IPSS, and postvoid residual urine at each follow-up time point. Compared to preoperative values, prostate volume and serum prostate-specific antigen fell by 67% and 63%, respectively, at 3 mo after PVRP. No major complications were noted. Application of a hemostat for a front-firing LBO laser makes it easy to handle intractable intraoperative bleeding. The main limitation of this study is the short follow-up period. The influence of PVRP on sexual function and the learning curve remain to be evaluated. PVRP is a novel technique that is effective and safe for treatment of benign prostatic hyperplasia. This technique retains the excellent hemostatic property of LBO lasers and has a short operation time and a high tissue removal rate. The problem of the lack of postoperative tissue samples

  2. Systemic delivery of small interfering RNA targeting the interleukin-2/15 receptor β chain prevents disease progression in experimental arthritis.

    Directory of Open Access Journals (Sweden)

    Tiantian Zhang

    Full Text Available The role of interleukin (IL-15 in the pathogenesis of rheumatoid arthritis (RA is well established; however, systemic knockdown of IL-15 receptor (IL-15R for reduction in inflammation at local sites has not been demonstrated. In this study, the therapeutic effect of intravenously administered siRNA targeting the β chain of IL-15R which is shared by the receptor for IL-2 was examined in rats with adjuvant-induced arthritis (AA. Polyethylenimine (PEI-complexed siRNA nanoparticles could easily accumulate in arthritic paws of AA rats. In the paws, the nanoparticles were avidly taken up by macrophages and to a lesser extent by T cells. Weekly administered IL-2/15Rβ siRNA polyplexes were capable of decreasing disease progression in AA rats, with striking inhibition of clinical, radiologic, and histologic features of RA. The observed therapeutic effect was associated with reduced expression of proinflammatory mediators in the inflamed joints. Thus, this study provides evidence that IL-2/15Rβ could be targeted for the treatment of RA.

  3. Prognostic value of the neutrophil-to-lymphocyte ratio in the ARQ 197-215 second-line study for advanced hepatocellular carcinoma.

    Science.gov (United States)

    Personeni, Nicola; Giordano, Laura; Abbadessa, Giovanni; Porta, Camillo; Borbath, Ivan; Daniele, Bruno; Van Laethem, Jean-Luc; Van Vlierberghe, Hans; Trojan, Jörg; De Toni, Enrico N; Gasbarrini, Antonio; Lencioni, Monica; Lamar, Maria E; Wang, Yunxia; Shuster, Dale; Schwartz, Brian; Santoro, Armando; Rimassa, Lorenza

    2017-02-28

    The ARQ 197-215 study randomized patients to tivantinib or placebo and pre-specified efficacy analyses indicated the predictive value of MET expression as a marker of benefit from tivantinib in hepatocellular carcinoma (HCC). We aimed to explore the neutrophil-to-lymphocyte ratio (NLR) in 98 ARQ 197-215 patients with available absolute neutrophil count and absolute lymphocyte count at baseline. The cut-off value used to define high versus low NLR was 3.0. In univariate analysis, high NLR was associated with hazard ratio (HR) for overall survival (OS) of 1.58 [95% confidence interval (CI) 1.01; 2.47; P 3 (P = 0.03) and presence of vascular invasion (P = 0.017) were negatively associated with OS. After adjustment for vascular invasion, NLR independently predicted survival in both the placebo and the tivantinib cohort. For OS, no interaction was detected between NLR status and treatment (Pinteraction = 0.40). Baseline NLR is an independent prognostic biomarker in patients with HCC and compensated liver function who are candidate for second-line treatments.

  4. Phase separation of myelin sheath in Triton X-114 solution: predominant localization of the 21.5-kDa isoform of myelin basic protein in the lipid raft-associated domain.

    Science.gov (United States)

    Uruse, Michihiro; Yamamoto, Masahiro; Sugawa, Makoto; Matsuura, Keiko; Sato, Yurie; Seiwa, Chika; Watanabe, Kenji; Aiso, Sadakazu; Asou, Hiroaki

    2014-04-01

    Myelin basic protein (MBP) isoforms in the myelin sheath are known to have distinct intracellular expression patterns, which are profoundly related to functional specificity. Determining the differential localization of MBP isoforms is therefore important for understanding their pathophysiological roles. In this study, we have developed a new method for phase separation of myelin. The non-ionic detergent Triton X-114 is used to solubilize myelin sheath which then undergoes phase separation to yield four fractions. The lipid raft-associated proteins and lipids in each fraction were analysed by immunoblotting and lipid analysis, respectively. The present method gives two lipid raft-enriched fractions, one of them was found to contain only lipid raft-associated galactocerebroside and cholesterol as the major lipids. The 21.5-kDa MBP isoforms (21.5 MBP), both unphosphorylated and phosphorylated, were exclusively contained in this fraction. Phosphorylated 21.5 MBP (21.5 pMBP) has been shown to specifically disappear from demyelinated loci. The present analytical method clearly indicated that disappearance of 21.5 pMBP corresponded to demyelination and its reappearance corresponded to prevention of demyelination. Demyelination was also associated with aging and was prevented by the myelin-protecting herbal medicine, Chinpi, a type of dried citrus peel.

  5. Investigation of 70SiO2-15CaO-10P2O5-5Na2O Glass Composition for Bone Regeneration Applications

    Directory of Open Access Journals (Sweden)

    Vikas Anand

    2014-11-01

    Full Text Available Glass with the composition 70SiO2-15CaO -10P2O5-5Na2O has been prepared by using sol gel technique. Bioactive behavior of the glass sample has been checked by in vitro study using TRIS simulated body fluid. Bioactive properties of the sample has been analyzed by using XRD, Raman, FE-SEM, EDX and Brunauer Emmett Teller studies. pH study has been conducted to check the non- acidic nature of the glass sample. Drug delivery behavior of the sample has been estimated by using gentamicin as an antibiotic. Reported sample has been found to be potential candidate for bone regeneration applications.

  6. Optimized antimicrobial peptide (Bacitracin) production by immobilized and free cells and of Bacillus Spp GU215 using Wood chips and silicon polymer beads.

    Science.gov (United States)

    Amin, Adnan; Khan, Muhammad Ayaz; Ahmad, Taufeeq

    2013-11-01

    The immobilization of bacillus spp. GU215 on silicon polymer beads, wood chips was performed and antibiotic peptide (bacitracin) production, optimization of parameters were investigated. The immobilized cells presented elevated levels of activity than free cells. The silicon polymer based cells showed widest zones of inhibitions (18mm) in 72 hours and 4% concentration of glucose, PH 8 and 30°C, whereas a marginal decrease in the activity (14mm) was noticed in case of wood chips based immobilization systems and least stable immobilization in 72 hours incubation time, 4% glucose concentration, PH 8 and 30°C. This study illustrates that the silicon polymer based beads facilitate a strong interactions with bacitracin producing cells and render them suitable for excessive and long time production of antibiotic.

  7. EXOPLANET CHARACTERIZATION BY PROXY: A TRANSITING 2.15 R{sub Circled-Plus} PLANET NEAR THE HABITABLE ZONE OF THE LATE K DWARF KEPLER-61

    Energy Technology Data Exchange (ETDEWEB)

    Ballard, Sarah; Charbonneau, David; Fressin, Francois; Torres, Guillermo; Irwin, Jonathan; Newton, Elisabeth [University of Washington, Seattle, WA 98195 (United States); Desert, Jean-Michel; Crepp, Justin R.; Shporer, Avi [California Institute of Technology, Pasadena, CA 91125 (United States); Mann, Andrew W. [Institute for Astronomy, University of Hawai' i, Honolulu, HI 96822 (United States); Ciardi, David R. [NASA Exoplanet Science Institute/Caltech, Pasadena, CA 91125 (United States); Henze, Christopher E.; Bryson, Stephen T.; Howell, Steven B. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Horch, Elliott P. [Southern Connecticut State University, New Haven, CT 06515 (United States); Everett, Mark E., E-mail: sarahba@uw.edu [National Optical Astronomy Observatory, Tucson, AZ 85719 (United States)

    2013-08-20

    We present the validation and characterization of Kepler-61b: a 2.15 R{sub Circled-Plus} planet orbiting near the inner edge of the habitable zone of a low-mass star. Our characterization of the host star Kepler-61 is based upon a comparison with a set of spectroscopically similar stars with directly measured radii and temperatures. We apply a stellar prior drawn from the weighted mean of these properties, in tandem with the Kepler photometry, to infer a planetary radius for Kepler-61b of 2.15 {+-} 0.13 R{sub Circled-Plus} and an equilibrium temperature of 273 {+-} 13 K (given its period of 59.87756 {+-} 0.00020 days and assuming a planetary albedo of 0.3). The technique of leveraging the physical properties of nearby ''proxy'' stars allows for an independent check on stellar characterization via the traditional measurements with stellar spectra and evolutionary models. In this case, such a check had implications for the putative habitability of Kepler-61b: the planet is 10% warmer and larger than inferred from K-band spectral characterization. From the Kepler photometry, we estimate a stellar rotation period of 36 days, which implies a stellar age of >1 Gyr. We summarize the evidence for the planetary nature of the Kepler-61 transit signal, which we conclude is 30,000 times more likely to be due to a planet than a blend scenario. Finally, we discuss possible compositions for Kepler-61b with a comparison to theoretical models as well as to known exoplanets with similar radii and dynamically measured masses.

  8. Microbiological transformations. Part 48 : Enantioselective biohydrolysis of 2-, 3- and 4-pyridyloxirane at high substrate concentration using the Agrobacterium radiobacter AD1 epoxide hydrolase and its Tyr215Phe mutant

    NARCIS (Netherlands)

    Genzel, Y; Archelas, A; Lutje Spelberg, Jeffrey H.; Janssen, DB; Furstoss, R

    2001-01-01

    The epoxide hydrolase (EH) from Agrobacterium radiobacter AD1 wild type (ArWT) and its Tyr215Phe mutant were compared for the biocatalyzed hydrolytic kinetic resolution (BHKR) of 2-, 3- and 4-pyridyloxirane. The radioselectivity of the oxirane ring opening as well as the substrate concentration

  9. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  10. Structure of the San Bernardino Basin Along Two Seismic Transects: Rialto-Colton Fault to the San Andreas Fault and Along the I-215 Freeway (I-10 to SR30)

    Science.gov (United States)

    Catchings, R.D.; Rymer, M.J.; Goldman, M.R.; Gandhok, G.; Steedman, C.E.

    2008-01-01

    In this report, we present seismic data and acquisition parameters for two seismic profiles acquired in the San Bernardino, California area in May and October 2003. We refer to these seismic profiles as the San Bernardino Regional (SBR) and San Bernardino High-Resolution (SBHR) seismic profiles. We present both un-interpreted and interpreted seismic images so that the structure of the area can independently interpreted by others. We explain the rationale for our interpretations within the text of this report, and in addition, we provide a large body of supporting evidence. The SBR seismic profile extended across the San Bernardino Basin approximately N30?E from the town of Colton to the town of Highland. The data were acquired at night when the signal-to-noise ratios were reasonably good, and for the larger shots, seismic energy propagated across the ~20-km-long array. Tomographic velocity data are available to depths of about 4 km, and low-fold reflection data are available to depths in excess of 5 km. The SBR seismic data reveal an asymmetric, fault-bound basin to about 5 km depth. The SBHR seismic profile trended along the I-215 freeway from its intersection with the Santa Ana River to approximately State Road 30 in San Bernardino. Seismic data acquired along the I-215 freeway provide detailed images, with CDP spacing of approximately 2.5 m along an approximately 8.2-km-long profile; shot and geophone spacing was 5 m. For logistical reasons, the high-resolution (SBHR) seismic data were acquired during daylight hours on the shoulder of the I-215 freeway and within 5 to 10 m of high-traffic volumes, resulting in low signal-to-noise ratios. The limited offset at which refracted first-arrivals could be measured along the SBHR seismic profile limited our measurements of tomographic refraction velocities to relatively shallow (< 150 m) depths. The SBHR reflection data reveal a basin with complex structural details within the upper kilometer. The two seismic profiles

  11. Estimation of arterial input by a noninvasive image derived method in brain H215O PET study: confirmation of arterial location using MR angiography.

    Science.gov (United States)

    Islam, Muhammad Muinul; Tsujikawa, Tetsuya; Mori, Tetsuya; Kiyono, Yasushi; Okazawa, Hidehiko

    2017-03-31

    A noninvasive method to estimate input function directly from H215O brain PET data for measurement of cerebral blood flow (CBF) was proposed in this study. The image derived input function (IDIF) method extracted the time-activity curves (TAC) of the major cerebral arteries at the skull base from the dynamic PET data. The extracted primordial IDIF showed almost the same radioactivity as the arterial input function (AIF) from sampled blood at the plateau part in the later phase, but significantly lower radioactivity in the initial arterial phase compared with that of AIF-TAC. To correct the initial part of the IDIF, a dispersion function was applied and two constants for the correction were determined by fitting with the individual AIF in 15 patients with unilateral arterial stenoocclusive lesions. The area under the curves (AUC) from the two input functions showed good agreement with the mean AUCIDIF/ AUCAIF ratio of 0.92 ± 0.09. The final products of CBF and arterial-to-capillary vascular volume (V0) obtained from the IDIF and AIF showed no difference, and had with high correlation coefficients. Creative Commons Attribution license.

  12. SPECTRUM OF CERVICAL LESIONS IN CIMS, BILASPUR: A 5 YEAR RETROSPECTIVE STUDY OF 215 CASES IN A TERTIARY HOSPITAL OF CENTRAL INDIA

    Directory of Open Access Journals (Sweden)

    Sadhna

    2015-10-01

    Full Text Available BACKGROUND AND OBJEC TIVE: Cancer of the cervix is a leading cause of morbidity and mortality among women W orld W ide. Therefore to curb the disease there is need of awareness of this disease. This study is aimed to categorize the premalignant and malignant lesions at the earliest, to reduce the mortality and morbidity. It also aimed to know the incidence of malignancies at our set up and to calculate distribution of patient in relation to parity and symptoms. DESIGN AND SETTING: Study included 215 patients with complain of white dis charge per vagina, per vaginal bleeding and backache attending the gynecology OPD over a period of 05 years. PATIENT AND METHODS: Patients were subjected to cervical biopsy and biopsies were sent to pathology department. Detailed clinical history, age, age at marriage, parity and socio - economic status was obtained. RESULT: Result were classified histopathological l y as inflammatory lesions 70 cases, polypoidal lesion were 30, LSIL accounted for 32 cases and HSIL were 20 cases and 30 were malignant lesions. U nder malignant category moderately differentiated squamous cell carcinoma was the commonest. Maximum numbers of patients were subjected to cervical biopsies in 3 rd decade of life. Malignancies were common in 3 rd & 4 th decade of life. Most of the cases were of parity 4. CONCLUSION : Tissue biopsy is a valuable diagnostic procedure on which surgeons and radiologists still rely.

  13. THE KINETIC AND MECHANISM OF CRYSTALLIZATION OF MGGEO3 IN 65GEO2-15PBO-10MGF2-10MGO GLASS SYSTEM

    Directory of Open Access Journals (Sweden)

    M. Nouri

    2017-09-01

    Full Text Available In this study, the crystallization behavior of a 65GeO2-15PbO-10MgF2-10MgO glass (prepared by the conventional melt quenching technique has been investigated. The microstructure and crystallization behaviors of this glass were characterized using X-ray diffraction (XRD, scanning electron microscopy (SEM, non-isothermal differential thermal analysis (DTA and Fourier transform infrared spectroscopy (FTIR. The results demonstrated that a fully glassy phase can successfully be prepared by the conventional melt quenching technique exhibiting one-stage crystallization on heating, i.e., the glassy phase transforms into crystalline MgGeO3 and Pb5GeO7 phases. The activation energy for the crystallization, evaluated from the Kissinger equation, was approximately 202±5 kJ/mole using the peak temperature of the exothermic reaction. The Avrami exponent or reaction order, n, indicates the nucleation rate in this glass to increase with time and the crystallization to be governed by a three-dimensional interface-controlled growth.

  14. Effects of Nitrogen Segregation and Solubility on the Formation of Nitrogen Gas Pores in 21.5Cr-1.5Ni Duplex Stainless Steel

    Science.gov (United States)

    Zhu, Hong-Chun; Jiang, Zhou-Hua; Li, Hua-Bing; Feng, Hao; Zhang, Shu-Cai; Liu, Guo-Hai; Zhu, Jun-Hui; Wang, Peng-Bo; Zhang, Bin-Bin; Fan, Guang-Wei; Li, Guo-Ping

    2017-10-01

    The nitrogen gas pore-formation mechanism was discussed with regard to the solidification of 21.5Cr-1.5Ni duplex stainless steels (DSSs) by considering nitrogen segregation and solubility. The segregation behavior of nitrogen was investigated with phase transformation using experimental detection methods and Thermo-Calc software calculations. The process associated with the formation of gas pores was illustrated clearly. The factors that influenced the formation of gas pores, including shrinkage, nitrogen content, solidification pressure, and alloying elements (Mn and Cr), were discussed in detail. The formation of nitrogen-rich phases [austenite phase (FCC), AlN, and hexagonal close packed] is beneficial to eliminate nitrogen segregation and suppressing gas pore formation. The nitrogen-depleted phase (ferrite phase (BCC)) exhibits an opposite effect. Regular gas pores are initially formed in locations consisting of the austenite phase. As the gas pores lengthen, ferrite and austenite phases alternately form around the gas pores. Solidification shrinkage can promote the formation of irregular gas pores at the centerline of the ingots. Increasing the nitrogen content is favorable to the formation of gas pores. Increasing solidification pressure is effective with regard to suppressing the formation of gas pore defects in DSSs. Increasing the Mn content can reduce the likelihood of gas pore formation; this can be attributed to the increased nitrogen solubility in the residual liquid surrounding the dendrites and the formation tendency of the nitrogen-rich phase. Increasing the Cr content exhibits a dual effect on gas pore formation, which is caused by the increased nitrogen solubility and segregation in the residual liquid.

  15. NuSTAR study of hard X-ray morphology and spectroscopy of PWN G21.5–0.9

    Energy Technology Data Exchange (ETDEWEB)

    Nynka, Melania; Hailey, Charles J.; Gotthelf, Eric V.; Mori, Kaya; Perez, Kerstin [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Reynolds, Stephen P. [Physics Department, NC State University, Raleigh, NC 27695 (United States); An, Hongjun [Department of Physics, McGill University, Rutherford Physics Building, 3600 University Street, Montreal, Quebec H3A 2T8 (Canada); Baganoff, Frederick K. [Center for Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139-4307 (United States); Boggs, Steven E.; Krivonos, Roman; Zoglauer, Andreas [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Craig, William W. [Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); Grefenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Wik, Daniel R.; Zhang, William W. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-07-01

    We present NuSTAR high-energy X-ray observations of the pulsar wind nebula (PWN)/supernova remnant G21.5–0.9. We detect integrated emission from the nebula up to ∼40 keV, and resolve individual spatial features over a broad X-ray band for the first time. The morphology seen by NuSTAR agrees well with that seen by XMM-Newton and Chandra below 10 keV. At high energies, NuSTAR clearly detects non-thermal emission up to ∼20 keV that extends along the eastern and northern rim of the supernova shell. The broadband images clearly demonstrate that X-ray emission from the North Spur and Eastern Limb results predominantly from non-thermal processes. We detect a break in the spatially integrated X-ray spectrum at ∼9 keV that cannot be reproduced by current spectral energy distribution models, implying either a more complex electron injection spectrum or an additional process such as diffusion compared to what has been considered in previous work. We use spatially resolved maps to derive an energy-dependent cooling length scale, L(E)∝E{sup m} with m = –0.21 ± 0.01. We find this to be inconsistent with the model for the morphological evolution with energy described by Kennel and Coroniti. This value, along with the observed steepening in power-law index between radio and X-ray, can be quantitatively explained as an energy-loss spectral break in the simple scaling model of Reynolds, assuming particle advection dominates over diffusion. This interpretation requires a substantial departure from spherical magnetohydrodynamic, magnetic-flux-conserving outflow, most plausibly in the form of turbulent magnetic-field amplification.

  16. Association between the TERT Genetic Polymorphism rs2853676 and Cancer Risk: Meta-Analysis of 76,108 Cases and 134,215 Controls.

    Directory of Open Access Journals (Sweden)

    Jin-Lin Cao

    Full Text Available Several recent studies have identified that the TERT genetic polymorphism rs2853676 is associated with cancer risk, but presented inconsistent results. We investigated these inconclusive results by performing a meta-analysis to systematically evaluate the association.We conducted a search in PubMed, Google Scholar and ISI Web of Science to select studies on the association between TERT rs2853676 and cancer risk. We conducted a stratified analysis using cancer type, ethnicity and source of controls. We calculated the odds ratios (OR and 95% confidence intervals (CI. Article quality, heterogeneity, sensitivity, publication bias and statistical power were also assessed.26 articles covering 76,108 cases and 134,215 controls met our inclusion criteria. A significant association between TERT rs2853676 allele A and cancer susceptibility was demonstrated under a per-allele risk analysis (OR = 1.08, 95% CI = 1.04-1.13. Stratification analysis revealed an increased cancer risk in subgroups of glioma, lung cancer and ovarian cancer. No significant increase was found in melanoma, breast cancer, pancreatic cancer and colorectal cancer. In a subgroup analysis of lung cancer, a statistically significant increase was only observed in adenocarcinoma. Moreover, a stratified analysis performed for ethnic groups revealed that the significant increase was only observed in Caucasians, whereas a non-significant increase was found in Asians.This meta-analysis suggests that the TERT genetic polymorphism rs2853676 is associated with increased risk of glioma, lung adenocarcinoma and ovarian cancer among Caucasians. Further functional studies are warranted to validate this association and investigate further.

  17. Brucella Omp25 Upregulates miR-155, miR-21-5p, and miR-23b to Inhibit Interleukin-12 Production via Modulation of Programmed Death-1 Signaling in Human Monocyte/Macrophages

    Directory of Open Access Journals (Sweden)

    Beibei Cui

    2017-06-01

    Full Text Available Brucella spp. infection results in compromised Type1 (Th1 cellular immune response. Several reports have described an immunomodulatory function for Brucella major outer membrane protein Omp25. However, the mechanism by which Omp25 modulates macrophage dysfunction has not been defined. Herein, we reported that Omp25-deficient mutant of Brucella suis exhibited an enhanced ability to induce interleukin (IL-12 whereas ectopic expression of Omp25 protein inhibited TLR agonists-induced IL-12 p70 production through suppression of both IL-12 p40 and p35 subunit expression in THP-1 cells. In addition, Omp25 significantly upregulated miR-155, -23b and -21-5p, as well as the immunomodulator molecule programmed death-1 (PD-1 in monocyte/macrophages. The upregulation of miR-155 and -23b correlated temporally with decreased TAB2 levels, IκB phosphorylation and IL-12 p40 levels by targeting TAB2 and il12B 3′ untranslated region (UTR, respectively, while miR-21-5p increase directly led to the reduction of lipopolysaccharide (LPS/R848-induced IL-12 p35 protein by targeting il12A 3′UTR. Consistent with this finding, reduction of miR-155 and -23b attenuated the inhibitory effects of Omp25 on LPS/R848-induced IL-12 p40 expression at both transcriptional and posttranscriptional levels, while reduction of miR-21-5p attenuated the inhibitory effects of Omp25 on LPS/R848-induced IL-12 p35 expression at the posttranscriptional level, together significantly enhanced IL-12 p70 production upon LPS/R848 stimulation. We also found that blocking PD-1 signaling decreased the expression of miR-155, -23b and -21-5p induced by Omp25 and enhanced IL-12 production in monocyte/macrophages. Altogether, these data demonstrate that Brucella Omp25 induces miR-155, -23b and -21-5p to negatively regulate IL-12 production at both transcriptional and posttranscriptional levels via regulation of PD-1 signaling, which provides an entirely new mechanism underlying monocyte

  18. Elisante 215-222.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    The bole's high inulin fraction (24-. 36%) is of particular significance due to its chemical functionality and relative ease of fermentation. utilisationThe objective of this study was to identify properties and pertinent characteristics for developing industrially viable methods of extracting inulin from sisal bole in a readily utilisable ...

  19. 215 - 222_Tijjani_Nematodes

    African Journals Online (AJOL)

    pc

    conical flask was corked tightly then manually and vigorously shaken for four minutes to dissolve the gelatinous egg matrices. The suspension now containing free eggs was poured over 200-mesh sieve nested upon 500-mesh sieve. The 500-mesh sieve containing the eggs was rinsed gently under cool gentle stream of tap ...

  20. Effects of vasopressin and analogue [d(CH2)1(5), Tyr (Me)2, Val4, delta 3Pro7)] AVP on learning and memory in rats chronically treated with ethanol.

    Science.gov (United States)

    Car, H; Borawska, M H; Wiśniewski, K

    1994-03-01

    Rats with impaired active and passive avoidance induced by chronic administration of ethanol were studied. Vasopressin (AVP) and analogue (d(CH2)1(5), Tyr (Me)2, Val4, delta 3Pro7] AVP (icv, 2 micrograms) eliminated the toxic effect of ethanol, and analogue AVP improved retrieval of passive avoidance situation in both control and postalcohol groups of rats. Chronically administered ethanol markedly depressed the ability to learn. AVP administered icv markedly delayed extinction of conditioned avoidance situation in both groups of rats, and did not influence acquisition in this test. Analogue AVP has no influence on extinction and acquisition in the control and post-alcohol groups of rats.

  1. Shielding properties of 80TeO2-5TiO2-(15-x) WO3-xAnOm glasses using WinXCom and MCNP5 code

    Science.gov (United States)

    Dong, M. G.; El-Mallawany, R.; Sayyed, M. I.; Tekin, H. O.

    2017-12-01

    Gamma ray shielding properties of 80TeO2-5TiO2-(15-x) WO3-xAnOm glasses, where AnOm is Nb2O5 = 0.01, 5, Nd2O3 = 3, 5 and Er2O3 = 5 mol% have been achieved. Shielding parameters; mass attenuation coefficients, half value layers, and macroscopic effective removal cross section for fast neutrons have been computed by using WinXCom program and MCNP5 Monte Carlo code. In addition, by using Geometric Progression method (G-P), exposure buildup factor values were also calculated. Variations of shielding parameters are discussed for the effect of REO addition into the glasses and photon energy.

  2. Phase development in partial-melt processing of silver-clad Bi{sub 2.15}Sr{sub 1.83}Ca{sub 1.02}Cu{sub 2}O{sub x} tapes

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Ming; Delaney, W.E.; Lanagan, M.T.; Olson, S.R.; Goretta, K.C.

    1996-03-01

    Ag-clad Bi{sub 2.15}Sr{sub 1.83}Ca{sub 1.02}Cu{sub 2}O{sub x} tapes were fabricated by the powder-in-tube method and heated in air to maximum temperatures of 880--895{degrees}C. The tapes were characterized by differential thermal analysis, scanning electron microscopy, energy-dispersive X-ray analysis, and X-ray diffraction. Microstructures of tapes that were heated at 885--895{degrees}C were similar, and, at a given temperature, remained stable for up to 1.0 h, which was the longest time used. The most significant microstructural features in specimens quenched from the melt were voids of up to {approx}400 {mu}m in diameter. CuO was a minor phase in the melt, but grew significantly upon cooling to become the major nonsuperconducting phase when solidification was complete.

  3. Small-angle neutron scattering study of the flux-line lattice in a single crystal of Bi2.15Sr1.95CaCu2O8+x

    DEFF Research Database (Denmark)

    Yethiraj, M.; Mook, H.A.; Forgan, E.M.

    1994-01-01

    as the temperature is increased above a field‐dependent melting temperature. Diffracted intensity due to the vortex lattice also falls off as the applied field is increased. It is believed that this is a manifestation of the transition of the three‐dimensional flux lines into two‐dimensional pancake vortices......A flux‐line lattice (FLL) was observed in a single crystal of Bi2.15Sr1.95CaCu2O8+x (BSCCO) using small‐angle neutron scattering methods. The sample has a superconducting transition at 85 K. The flux‐line lattice is observed to melt, evidenced by the rapid disappearance of diffracted intensity...

  4. The G215R mutation in the Cl-/H+-antiporter ClC-7 found in ADO II osteopetrosis does not abolish function but causes a severe trafficking defect.

    Directory of Open Access Journals (Sweden)

    Patrick Schulz

    Full Text Available BACKGROUND: ClC-7 is a ubiquitous transporter which is broadly expressed in mammalian tissues. It is implied in the pathogenesis of lysosomal storage disease and osteopetrosis. Because of its endosomal/lysosomal localization it is still poorly characterized. METHODOLOGY/PRINCIPAL FINDINGS: An electrophysiological characterization of rat ClC-7 using solid-supported membrane-based electrophysiology is presented. The measured currents show the characteristics of ClC-7 and confirm its function as a Cl(-/H(+-antiporter. We have used rat ClC-7 in CHO cells as a model system to investigate the functionality and cellular localization of the wt transporter and its variant G213R ClC-7 which is the analogue of human G215R ClC-7 responsible for autosomal dominant osteopetrosis type II. Our study shows that rat G213R ClC-7 is functional but has a localization defect in CHO cells which prevents it from being correctly targeted to the lysosomal membrane. The electrophysiological assay is tested as a tool for drug discovery. The assay is validated with a number of drug candidates. It is shown that ClC-7 is inhibited by DIDS, NPPB and NS5818 at micromolar concentrations. CONCLUSIONS/SIGNIFICANCE: It is suggested that the scenario found in the CHO model system also applies to the human transporter and that mislocalization rather than impaired functionality of G215R ClC-7 is the primary cause of the related autosomal dominant osteopetrosis type II. Furthermore, the robust solid-supported membrane-based electrophysiological assay is proposed for rapid screening for potential ClC-7 inhibitors which are discussed for treatment of osteoporosis.

  5. La Propuesta de Enmienda a la Constitución 215/2000 Como Retroceso Juridico en la Protección del Derecho Fundamental de los Pueblos Indígenas a la Tierra

    Directory of Open Access Journals (Sweden)

    Marília Aguiar Ribeiro do Nascimento

    2015-12-01

    Full Text Available A lo largo de la historia, es posible verificar la lucha de los pueblos indígenas por la tierra. Desde finales del siglo XX, sus reclamaciones son cada vez más presentes, lo que puede ser confirmado por los cambios en la legislación. En efecto, el derecho a la tierra es ahora garantizado por el derecho nacional y internacional. En la práctica, la efectividad de este derecho no es tarea fácil. El objetivo de este articulo es analizar en qué medida el derecho a la tierra está protegido en el derecho internacional y nacional en Brasil y estudiar la propuesta de enmienda a la constitucion 215/2000 y su relacion con el derecho a la consulta previa de los pueblos indigenas. La investigación es de carácter cualitativo: son revisados y analizados diferentes documentos, legislación nacional y internacional y jurisprudencia al respecto. Se puede observar que hay una legislación nacional y internacional que garantizan el derecho a la tierra de los pueblos indigenas. Sin embargo, la propuesta de enmienda a la constitución PEC 215/2000 que esta siendo discutida, transfiere la facultad de demarcar las tierras y anular las demarcaciones ya homologadas al Poder legislativo. Esta propuesta viola directamente la garantia de consulta previa de los pueblos indigenas, prevista en el artículo 231 de la Constitución y la Convención 169 de la OIT.

  6. Oceanographic profile data collected from sound velocimeter - moving vessel profiler casts aboard BLAKE as part of project OPR-J377-KR2-15 in the Gulf of Mexico from 2015-06-03 to 2015-10-30 (NCEI Accession 0139358)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0139358 includes physical and profile data collected aboard the BLAKE during project OPR-J377-KR2-15 in the Gulf of Mexico from 2015-06-03 to...

  7. Quand la liberté de lire est menacée : la lutte de la Campaign for Reader Privacy contre l’article 215 de la loi USA PATRIOT.

    Directory of Open Access Journals (Sweden)

    Cécile Cottenet

    2008-05-01

    Full Text Available De nombreuses associations et mouvements militant pour les libertés individuelles se sont créés ou consolidés au lendemain des attentats du 11 septembre 2001, après le passage de la loi USA PATRIOT. L’un de ces mouvements, porté par les acteurs du monde du livre — libraires, bibliothécaires, éditeurs, écrivains — a très rapidement vu le danger d’une loi permettant l’intrusion de l’Etat dans la vie privée. Cette coalition, sous la bannière Campaign for Reader Privacy, a choisi pour cible l’article 215 de la loi, et mis en œuvre un véritable réseau de militants afin que celui-ci soit amendé et que soit rétabli la protection de la confidentialité des lectures des Américains. Cet article se propose d’examiner les enjeux qui ont fédéré les membres de cette coalition, et d’éclairer la nécessité impérieuse qui a poussé ces associations à se battre jusque dans les couloirs du Congrès pour le droit à la confidentialité de l’information.Many associations and movements for the defense of individual liberties have emerged or grown in the wake of 9/11 and the passing of the USA PATRIOT Act. One of these movements, led by actors of the book industry—booksellers, librarians, publishers, writers—rapidly saw the danger of an act that authorizes the government to intrude into private lives. Under the banner “Campaign for Reader Privacy”, this coalition has chosen to target section 215 of the USA PATRIOT Act. In order to amend this section and to restore the protection of the privacy of Americans’ readings, it has developed a network of militants. This article examines the reasons that pushed the different associations to coalesce and tries to shed some light on the imperious necessity to fight for a fundamental right in American life, the privacy of personal information.

  8. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells.

    Science.gov (United States)

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok

    2016-08-05

    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  9. Synthesis, structure, semiconductive and photoluminescent properties of [{Eu(NC5H4COOH3(H2O2}(1.5ZnCl4•(2H2O]n

    Directory of Open Access Journals (Sweden)

    YA-PING XU

    2009-07-01

    Full Text Available A novel bimetallic 4f–3d metal-isonicotinic acid inorganic–organic hybrid complex [{Eu(NC5H4COOH3(H2O2}(1.5ZnCl4•(2H2O]n (1 was synthesized via a hydrothermal reaction and structurally characterized by single-crystal X-ray diffraction. Complex 1 crystallizes in the space group C2/c of the monoclinic system with eight formula units in a cell: a = 23.878(8 Å, b = 20.573(6 Å, c = 15.358(5 Å, β = 127.276(5°, V = 6003(3 Å3, C18H23Cl6EuN3O10Zn1.5, Mr = 904.11 g/mol, r = 2.001 g/cm3, S = 1.077, μ(MoKα = 3.846 mm-1, F(000 = 3536, R = 0.0270 and wR = 0.0672. Complex 1 has a characteristic, one-dimensional polycationic chain-like structure. A photoluminescent investigation revealed that the title complex displays intense emissions in the orange and red regions. The luminescence spectra show that the red emission is stronger than the orange emission. Optical absorption spectra of 1 revealed the presence of an optical gap of 3.56 eV.

  10. FT-ICR study on hydrogenation of niobium cluster cations Nbn+ (n=2-15) in seeded supersonic jet and multiple-collision-induced dissociation of NbnHm+ hydrides

    Science.gov (United States)

    Vakhtin, Andrei B.; Sugawara, Ko-ichi

    1999-12-01

    Hydrogenation of niobium cluster cations Nbn+ (n=2-15) in a seeded supersonic jet of H2/He and multiple-collision-induced dissociation (MCID) of the resulting NbnHm+ hydrides have been studied using a Fourier transform ion cyclotron resonance (FT-ICR) mass spectrometer. The nascent NbnHm+ hydrides trapped in the FT-ICR cell have broad m distributions with no apparent prevalence of odd or even m. A pulse of argon applied to the trapped clusters causes a dramatic squeezing of the initial m distribution (through the collision-induced removal of weakly bound H2 molecules), favoring several particular hydrides for each cluster size n, e.g., Nb7H8+, Nb7H11+, and Nb7H12+ for n=7. The maximum m values of these stable hydrides are close to the stoichiometric composition of NbH2 for the clusters with nMCID of the NbnHm+ clusters occurs through the sequential desorption of H2 molecules yielding NbnH+ and Nbn+ as final dissociation products for odd and even m, respectively. Based on the experiments on the MCID of Nb12H18+, an explanation is suggested for different reactivities of the Nb12+ clusters toward H2 in the ICR and fast-flow-reactor experiments.

  11. Paleomagnetism of Basaltic Lava Flows in Coreholes ICPP 213, ICPP-214, ICPP-215, and USGS 128 Near the Vadose Zone Research Park, Idaho Nuclear Technology and Engineering Center, Idaho National Engineering and Environmental Laboratory, Idaho

    Science.gov (United States)

    Champion, Duane E.; Herman, Theodore C.

    2003-01-01

    A paleomagnetic study was conducted on basalt from 41 lava flows represented in about 2,300 ft of core from coreholes ICPP-213, ICPP-214, ICPP-215, and USGS 128. These wells are in the area of the Idaho Nuclear Technology and Engineering Center (INTEC) Vadose Zone Research Park within the Idaho National Engineering and Environmental Laboratory (INEEL). Paleomagnetic measurements were made on 508 samples from the four coreholes, which are compared to each other, and to surface outcrop paleomagnetic data. In general, subhorizontal lines of correlation exist between sediment layers and between basalt layers in the area of the new percolation ponds. Some of the basalt flows and flow sequences are strongly correlative at different depth intervals and represent important stratigraphic unifying elements. Some units pinch out, or thicken or thin even over short separation distances of about 1,500 ft. A more distant correlation of more than 1 mile to corehole USGS 128 is possible for several of the basalt flows, but at greater depth. This is probably due to the broad subsidence of the eastern Snake River Plain centered along its topographic axis located to the south of INEEL. This study shows this most clearly in the oldest portions of the cored sections that have differentially subsided the greatest amount.

  12. Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

    Energy Technology Data Exchange (ETDEWEB)

    Hohloch, Karin; Lankeit, H.K.; Truemper, L. [Georg August University, Hematology and Oncology, Goettingen (Germany); Zinzani, P.L. [University of Bologna, Institute of Hematology and Medical Oncology ' ' L. e A. Seragnoli' ' , Bologna (Italy); Scholz, C.W. [Charite, University Berlin, Hematology, Oncology and Tumor Immunology, Berlin (Germany); Lorsbach, M.; Windemuth-Kieselbach, C. [Alcedis GmbH, Giessen (Germany)

    2014-08-15

    Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

  13. 47 CFR 87.215 - Supplemental eligibility.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES AVIATION SERVICES... entities, and to nongovernmental organizations (NGOs) that are authorized to apply for the license by a... applications submitted by NGOs must be accompanied by a new, written certification of support (for the NGO...

  14. 2 CFR 215.44 - Procurement procedures.

    Science.gov (United States)

    2010-01-01

    ....44 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... characteristics or minimum acceptable standards. (iv) The specific features of “brand name or equal” descriptions... expected to exceed the small purchase threshold, specifies a “brand name” product. (4) The proposed award...

  15. Reference: 215 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available trimental effects by various DNA damaging agents. A tolerance pathway that has been predicted to be present in higher...rev3, was inhibited by long-term UV-B. These results suggest that a TLS mechanism exists in a higher plant a

  16. 48 CFR 1852.215-84 - Ombudsman.

    Science.gov (United States)

    2010-10-01

    ... ombudsman will maintain strict confidentiality as to the source of the concern. The existence of the... ombudsman, the Director of the Contract Management Division, at202-358-0445, facsimile 202-358-3083, e-mail...

  17. 22 CFR 215.14 - Specific exemptions.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF...: Provided, however, That if any individual is denied any right, privilege, or benefit to which he or she... exemptions, are set forth below: (1) Criminal Law Enforcement Records. If the 5 U.S.C. 552a(j)(2) exemption...

  18. Case 215: voriconazole-induced periostitis.

    Science.gov (United States)

    Tailor, Tina D; Richardson, Michael L

    2015-03-01

    History A 74-year-old woman presented with multifocal bone pain, including pain in multiple ribs, bilateral shoulders, and bilateral hips. The pain began several months before presentation and was quite severe, ultimately necessitating control with narcotics. At examination, strength in both lower extremities was slightly reduced, sensation and reflexes were intact, and range of motion was full, though painful. There were no notable constitutional symptoms of fever or weight loss. Laboratory work-up was remarkable for elevated alkaline phosphatase level (277 U/L [4.6 mkat/L]). The patient had undergone left lung transplantation 8 years prior for pulmonary fibrosis. A thorough pulmonary work-up for the cause of fibrosis, which included gathering an exposure, occupational, allergy, and previous infectious history, and a rheumatoid work-up were negative. The patient's posttransplantation course was complicated by bronchiolitis obliterans from chronic rejection and by recent pulmonary embolism, for which she was undergoing anticoagulation therapy at the time of presentation. Additionally, the patient experienced repeated pulmonary infections with Aspergillus, leading to multiple hospitalizations and long-term antifungal prophylaxis with voriconazole. A bone scan from an outside hospital was reviewed, and further imaging was performed.

  19. 31 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE WITHHOLDING OF DISTRICT OF COLUMBIA, STATE, CITY AND...) Possesses powers and performs functions comparable to those associated with municipalities, (ii) Is closely... Bureau of the Census; and (2) Within the political boundaries of which five hundred or more persons are...

  20. 7 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Education, Hospitals, and Other Non-Profit Organizations. 7 CFR part 3019 covers requirements for awards and... individual children's program eligibility information obtained through the free milk eligibility process for... Department to administer the Program. State Children's Health Insurance Program (SCHIP) means the State...

  1. 215 ECONOMIC CONTRIBUTION OF CASSAVA PRODUCTION (A ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Jun 1, 2010 ... Cost of production was found to be N7, 310.11 per hectare. Furthermore the study revealed a net farm income of N14, 042.27 and a return on Naira invested as 0.92. .... Unit price of variable and fixed units ... physical product (output of cassava) will increase by .... and Statement of Account, Abuja, Nigeria.

  2. 215 ECONOMIC CONTRIBUTION OF CASSAVA PRODUCTION (A ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Jun 1, 2010 ... Department of Agricultural Economics and Extension, Kano University of Science & Technology, P.M.B 3244,. Wudil Kano State, Nigeria musatukur@yahoo.com. ABSTRACT. The study determined the economics of cassava production in Kuje Area Council FCT. Simple ... with trace of vitamins and minerals.

  3. Publications | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... and research? (open access). National development plans focus upon energy and water separately, often not integrating the other sector''s resource use. This contributes to programme failures in the long run. Research is needed to inform and assist government in making the right decisions around renewable energies.

  4. 49 CFR 372.215 - Ravenswood, WV.

    Science.gov (United States)

    2010-10-01

    ... commercially a part of Ravenswood, W. Va., within which transportation by motor vehicle in interstate or... Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS EXEMPTIONS, COMMERCIAL...

  5. 24 CFR 91.215 - Strategic plan.

    Science.gov (United States)

    2010-04-01

    ... environment and expanding economic opportunities, principally for low-income and moderate-income persons. (g...-poverty strategy. The consolidated plan must provide a concise summary of the jurisdiction's goals, programs, and policies for reducing the number of poverty-level families and how the jurisdiction's goals...

  6. 7 CFR 1160.215 - Assessment exemption.

    Science.gov (United States)

    2010-01-01

    ... the organic farm or organic handling operation certificate provided by a USDA-accredited certifying... described in § 1160.211(a) who operates under an approved National Organic Program (NOP) (7 CFR part 205) system plan; processes only products that are eligible to be labeled as 100 percent organic under the NOP...

  7. 36 CFR 2.15 - Pets.

    Science.gov (United States)

    2010-07-01

    ... dogs accompanying visually impaired persons or hearing ear dogs accompanying hearing-impaired persons... superintendent. (b) In park areas where hunting is allowed, dogs may be used in support of these activities in... section does not apply to dogs used by authorized Federal, State and local law enforcement officers in the...

  8. 2 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... administered under procurement laws and regulations. (f) Cash contributions means the recipient's cash outlay... limited to, trademarks, copyrights, patents and patent applications and such property as loans, notes and... financial assistance when provided by any legal agreement, even if the agreement is called a contract, but...

  9. 22 CFR 215.13 - General exemptions.

    Science.gov (United States)

    2010-04-01

    ... the activities of prosecutors, courts, correctional, probation, pardon, or parole authorities, and... disposition of criminal charges, sentencing, confinement, release, and parole and probation status; (2...

  10. 49 CFR 397.215 - Waiver notice.

    Science.gov (United States)

    2010-10-01

    ..., political subdivision thereof, or Indian tribe shall mail a copy of the application and any subsequent..., political subdivision thereof, or Indian tribe determines that compliance with paragraph (a) of this section... required by paragraph (a) of this section is not impracticable, or that notice should be published in the...

  11. 24 CFR 884.215 - Lease requirements.

    Science.gov (United States)

    2010-04-01

    ...) contain a provision permitting termination upon 30 days advance written notice by either party. (b... grounds of race, color, creed, religion, sex, or national origin. d. The Lessor shall provide the... to the tenant or any determination by a court of the rights and liabilities of the parties. (6...

  12. 75 FR 68728 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T...

    Science.gov (United States)

    2010-11-09

    ...: Flight controls; and 32: Landing gear. Reason (e) The mandatory continuing airworthiness information... product. The MCAI describes the unsafe condition as: Seven cases of on-ground hydraulic accumulator screw cap or end cap failure have been experienced * * * resulting in loss of the associated hydraulic...

  13. Publications | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of out-of-pocket expenditures on families and barriers to use of maternal and child health services in Asia and the Pacific : evidence from national household surveys of healthcare use and expenditures; summary technical report ... It assesses entrepreneurial environment and level of entrepreneurial activity.

  14. 36 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... information upon which review of an appeal is conducted, consisting of the transmittal letter, the appeal...—An individual's or organization's current physical mailing address. An e-mail address is insufficient... seeking review of a decision. Appeal Deciding Officer—The Secretary of Agriculture (USDA) or the USDA or...

  15. Publications | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... water resources development in South Africa : quantifying the costs, benefits and risks associated with planning and management alternatives; final scientific report (restricted access).

  16. 12 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... individual's minor children, and any of the individual's children (including adults) residing in the... the bank's allowance for loan and lease losses not included in the bank's Tier 2 capital for purposes... States, whether or not the branch is insured (within the meaning of 12 U.S.C. 1813(s)) and regardless of...

  17. 33 CFR 104.215 - Vessel Security Officer (VSO).

    Science.gov (United States)

    2010-07-01

    ... board and in port. (iv) Protection of the marine environment: (A) Understanding of vessel personnel's responsibility to preserve the marine environment; and (B) Basic working knowledge of pollution prevention... security plan; (ii) Assessing security risk, threat and vulnerability; (iii) Undertaking regular...

  18. 46 CFR 10.215 - Medical and physical requirements.

    Science.gov (United States)

    2010-10-01

    .... (v) Keystone Telebinocular. (vi) SAMCTT (School of Aviation Medicine Color Threshold Tester). (vii... examination. The color sense must be determined to be satisfactory when tested by any of the following methods or an alternative test approved by the Coast Guard, without the use of color-sensing lenses: (i...

  19. 48 CFR 252.215-7000 - Pricing adjustments.

    Science.gov (United States)

    2010-10-01

    ... clauses entitled “Price Reduction for Defective Cost or Pricing Data—Modifications,” “Subcontractor Cost or Pricing Data,” and “Subcontractor Cost or Pricing Data—Modifications,” means the aggregate increases and/or decreases in cost plus applicable profits. (End of clause) ...

  20. 38 CFR 41.215 - Relation to other audit requirements.

    Science.gov (United States)

    2010-07-01

    ... GAO to conduct or arrange for additional audits (e.g., financial audits, performance audits, evaluations, inspections, or reviews) nor authorize any auditee to constrain Federal agencies from carrying... with this part shall be in lieu of any financial audit required under individual Federal awards. To the...

  1. 48 CFR 215.404-71-4 - Facilities capital employed.

    Science.gov (United States)

    2010-10-01

    ... improving productivity. (b) Contract facilities capital estimates. The contracting officer shall estimate... acquired under the prospective contract; (ii) Should analyze the productivity improvements and other... manufacturing is done in an environment characterized by outdated, inefficient, and labor-intensive capital...

  2. 48 CFR 215.404-71-5 - Cost efficiency factor.

    Science.gov (United States)

    2010-10-01

    ... loaded labor hours (i.e., cost per labor hour, including all direct and indirect costs) or other productivity measures may provide the basis for assessing the effectiveness of the contractor's cost reduction... asset utilization or improved productivity. (c) When selecting the percentage to use for this special...

  3. 12 CFR 347.215 - Exemptions from deposit insurance requirement.

    Science.gov (United States)

    2010-01-01

    ... activity designed to attract the attention of the general public; and (E) A foreign bank that has more than... economy, including the international trade finance sector of the United States economy, whether the...

  4. Dicty_cDB: CHC215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-04 AF305694_1( AF305694 |pid:none) Kaposi's sarcoma-associated herpes... 47 7e-04 BT036468_1( BT036468...0.001 AF192756_1( AF192756 |pid:none) Kaposi's sarcoma-associated herpes... 45 0.002 AF360120_1( AF360120...45 0.002 U93872_83( U93872 |pid:none) Kaposi's sarcoma-associated herpesvir... 45 0.003 protein update

  5. 22 CFR 215.12 - Penalties and remedies.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF... any determination relating to the qualifications, character, rights, or opportunities of, or benefits... for actual damages of no less than $1,000, the costs of the action, and attorneys' fees. (d) Criminal...

  6. Dicty_cDB: SFB215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2001. 6. 1 Translated Amino Acid sequence IYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQVLTLD G...Amino Acid sequence (All Frames) Frame A: IYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQVLTLD G

  7. 20 CFR 725.215 - Determination of dependency; surviving spouse.

    Science.gov (United States)

    2010-04-01

    ... miner's desertion or other reasonable cause; or (d) The individual is the natural parent of the miner's son or daughter; or (e) The individual had legally adopted the miner's son or daughter while the individual was married to the miner and while such son or daughter was under the age of 18; or (f) The...

  8. Dicty_cDB: CFJ215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s vinifera cDNA clone VVB158G03 5, mRNA sequence. 64 5e-07 2 CA813481 |CA813481.1 CA48LN10IF-E8 Cabernet Sau...8.2 CA32EN0002_IIIbF_E01 Cabernet Sauvignon Leaf - CA32EN Vitis vinifera cDNA clone CA32EN0002_IIIbF_E01 5',...514038 |CF514038.1 CAbud0007_IVF_G07 Vitis vinifera cv. cabernet sauvignon (Clone 8) Bud - CABUD Vitis vinif

  9. Hardness Analysis. Training Module 5.215.2.77.

    Science.gov (United States)

    Bonte, John L.; Davidson, Arnold C.

    This document is an instructional module package prepared in objective form for use by an instructor familiar with hardness analysis using the EDTA method and the calculation of hardness given metal ion concentrations and a factor table. Included are objectives, an instructor guide, student handouts, and transparency masters. A video tape is also…

  10. 18 CFR 157.215 - Underground storage testing and development.

    Science.gov (United States)

    2010-04-01

    ... the average working pressure on such maximum days taken at a central measuring point where the total volume injected or withdrawn is measured; (iii) Results of any tracer program by which leakage of gas may... the gas bubble. This map need not be filed if there is no material change from the map previously...

  11. 50 CFR 600.215 - Council nomination and appointment procedures.

    Science.gov (United States)

    2010-10-01

    ... specifically related to the education or protection of consumers of marine resources; or (vi) Teaching... furnish to the appropriate governor's office a current resume, or equivalent, describing career history... nominees. (c) Nominees to the Gulf of Mexico Fishery Management Council. (1) The Governors of States...

  12. Dicty_cDB: VSF215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (c... 122 3e-27 AY891413_1( AY891413 |pid:none) Synthetic construct Homo sapiens c... 122 3e-27 DQ479425_1( DQ479425 |pid:none) Synth...etic construct calcium sensor... 122 3e-27 DQ457005_1( DQ457005 |pid:none) Synthe...ens cDNA, FLJ96792, highl... 122 3e-27 AY894058_1( AY894058 |pid:none) Synthetic construct Homo sapiens c......tic construct plasmid pN1-4n... 122 3e-27 AK315694_1( AK315694 |pid:none) Homo sapi

  13. 2 CFR Appendix A to Part 215 - Contract Provisions

    Science.gov (United States)

    2010-01-01

    ... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER... or articles ordinarily available on the open market, or contracts for transportation or transmission of intelligence. 5. Rights to Inventions Made Under a Contract or Agreement—Contracts or agreements...

  14. 48 CFR 1352.215-76 - Cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... after considering such factors as: (A) Degree of risk; (B) Nature of the work to be performed; (C) Joint venture responsibilities; (D) Extent of offeror's investment; (E) Subcontracting of work; and (F) Other... subcontracting costs were analyzed. (c) Audit Reports. If the offeror or any subcontractor has been audited by a...

  15. 48 CFR 1352.215-70 - Proposal preparation.

    Science.gov (United States)

    2010-10-01

    ... escalation is included, state the degree (percent) and methodology. Direct labor or levels of effort are to... be limited to, the following: (A) Salary/wage information with associated payroll expenses, for...

  16. 7 CFR 215.6 - Use of funds.

    Science.gov (United States)

    2010-01-01

    ... fiscal year. (b) Whoever embezzles, willfully misapplies, steals, or obtains by fraud any funds, assets... property have been embezzled, willfully misapplied, stolen, or obtained by fraud, shall be subject to the...

  17. 7 CFR 215.13 - Management evaluations and audits.

    Science.gov (United States)

    2010-01-01

    ...) In conducting management evaluations, reviews or audits for any fiscal year, the State agency, FNS... evidence of violations of criminal law or civil fraud statutes. (Secs. 805 and 819, Pub. L. 97-35, 95 Stat...

  18. Dicty_cDB: AFA215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sion library, 48 hours NaCl treatment prescreened for removal of highly abundant transcripts Mesembryanthemu...ant Lambda Uni-Zap XR expression library, 48 hours NaCl treatment prescreened for removal

  19. 2 CFR 215.73 - Collection of amounts due.

    Science.gov (United States)

    2010-01-01

    ... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER... Government. If not paid within a reasonable period after the demand for payment, the Federal awarding agency...

  20. 37 CFR 1.215 - Patent application publication.

    Science.gov (United States)

    2010-07-01

    ... the Office file wrapper of the application before technical preparations for publication of the application have begun. Technical preparations for publication of an application generally begin four months... on the application transmittal sheet or the application data sheet (§ 1.76). Assignee information may...

  1. DNA tests for strawberry: perpetual flowering - Bx215

    Science.gov (United States)

    Perpetual flowering strawberries have great economic value to the fresh market industry. Floral initiation in strawberry is largely determined by photoperiod, temperature, and genetics. Commercially grown strawberries are generally classified as remontant (repeated or perpetual flowering, day neutr...

  2. 48 CFR 215.404-71-2 - Performance risk.

    Science.gov (United States)

    2010-10-01

    ... contract administration offices or other DoD field offices; (ii) The management involvement expected on the... officer may assign a higher than normal value when there is a high degree of management effort. Indicators... requires an unusually low degree of management involvement. ...

  3. Dicty_cDB: CHS215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 145 3e-95 9 DQ060426 |DQ060426.1 Cryptosporidium andersoni strain zzca heat shock protein 70-like gene,...172 2e-84 4 AY954892 |AY954892.1 Cryptosporidium andersoni strain HenanZhzhca heat shock protein 70 gene...123 8e-84 9 AY954893 |AY954893.1 Cryptosporidium andersoni strain changchunca heat shock protein 70 gene...129 3e-83 9 AY954894 |AY954894.1 Cryptosporidium andersoni strain bjcm heat shock protein 70 gene, partial

  4. 2 CFR 215.23 - Cost sharing or matching.

    Science.gov (United States)

    2010-01-01

    ....23 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Financial and Program Management... classroom supplies. Value assessed to donated supplies included in the cost sharing or matching share shall...

  5. 2 CFR 215.14 - Special award conditions.

    Science.gov (United States)

    2010-01-01

    .... If an applicant or recipient: has a history of poor performance, is not financially stable, has a... writing as to: the nature of the additional requirements, the reason why the additional requirements are...

  6. 48 CFR 1352.215-75 - Evaluation criteria.

    Science.gov (United States)

    2010-10-01

    ...—EXPERIENCE. The offeror's background, experience, and qualifications will be assessed to determine the... non-performance. Factor 3—KEY PERSONNEL. The education, experience, and accomplishments of key... customer satisfaction. The Government reserves the right to assess the past performance of proposed...

  7. 49 CFR 232.215 - Transfer train brake tests.

    Science.gov (United States)

    2010-10-01

    ... coupled between all freight cars; (2) After the brake system is charged to not less than 60 psi as... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRAKE SYSTEM SAFETY STANDARDS FOR FREIGHT AND OTHER NON-PASSENGER... reduction shall be made; and (3) An inspection shall be made to determine that the brakes on each car apply...

  8. Dicty_cDB: SSE215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id sequence kylflivflffifffiylyldkeasymvfk*EKIKEKNKNKKKKKKKKKKEKKKK--- ---VALPILPXIXVITIWLFVGFPLTVVGGIAGRRLS...efiei*nltki Frame B: kylflivflffifffiylyldkeasymvfk*EKIKEKNKNKKKKKKKKKKEKKKK--- ---rritnptxd*xhyhlvicwfpfdrr

  9. Dicty_cDB: AFO215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-70_B02 5', mRN...rom field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-82_F0

  10. Dick Lord Covos Books: Johannesburg, 1998 215 pagcs illustrated ...

    African Journals Online (AJOL)

    of Namibia and Angola; from persistent airport officials who desperately try to enforce customs regulations to laws broken by aviators simply because not to could have results too ghastly to contemplate; from highly publicised and recognised rescue efforts to obscure ones that few have ever heard of; from the joy of another ...

  11. Dicty_cDB: AFI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YTVKNXQKVDXGGSYIKLLPSKLDQSAFDGESEYSIMFGPDVXGASKR--- ---EIQAGNLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDP EAVK...tl*rmxkklixxvhtssyyhpn*inqhsmxnlniplclxqmfxxpqr--- ---EIQAGNLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDP EAVK

  12. 27 CFR 40.215 - Notice for cigarettes.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for cigarettes. 40..., DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES... cigarettes. Every package of cigarettes shall, before removal subject to tax, have adequately imprinted...

  13. Dicty_cDB: VFK215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EGTIVNINSPVSVNVWGGCIGYACXRWALKG FTECLRIXLRGTGVNVLEVIPGETKSEYFQHNGIXXDSFPLLSKFVPKVTVDXVAKGTIK AIXNRKQ...EGTIVNINSPVSVNVWGGCIGYACXRWALKG FTECLRIXLRGTGVNVLEVIPGETKSEYFQHNGIXXDSFPLLSKFVPKVTVDXVAKGTIK AIXNRKQ

  14. 48 CFR 2052.215-71 - Project officer authority.

    Science.gov (United States)

    2010-10-01

    ... Project officer authority. As prescribed in 2015.209-70(a)(2)(i), the contracting officer shall insert the... contracting officer's authorized representative hereinafter referred to as the project officer for this contract is: Name: * Address: * Telephone Number: * (b) Performance of the work under this contract is...

  15. 7 CFR 215.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... children in the United States in (A) nonprofit schools of high school grade and under, except as provided... National School Lunch Act, and (B) nonprofit nursery schools, child care centers, settlement houses, summer... participate in a meal service program authorized under this Act or the National School Lunch Act. (2) The...

  16. All projects related to | Page 215 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Broadband Adoption and Poverty: Evidence and New Research Directions from Latin America. Project ... Region: North and Central America, South America, Mexico. Program: ... While the Arab World has enjoyed substantial economic progress, there has been little improvement in ensuring equitable access to health care.

  17. Dicty_cDB: VFE215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KTQALLTLGFNYVGNNMFFYYNITQYQVSE AYENSLTQCYDYTQGLMYINYINPTSTQRQILVYQPFNHSDGICIDEYSFEPGTDLTKSV ESNVYLFY...KTQALLTLGFNYVGNNMFFYYNITQYQVSE AYENSLTQCYDYTQGLMYINYINPTSTQRQILVYQPFNHSDGICIDEYSFEPGTDLTKSV ESNVYLFY

  18. Publications | Page 215 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  19. Dicty_cDB: SSB215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 48 1e-06 2 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium ...cDNA Curculio glandium cDNA clone curculio3e06 5', mRNA sequence. 46 0.38 1 BQ476622 |BQ476622.1 curculio3e0...6.g Curculio glandium cDNA Curculio glandium cDNA clone curculio3e06 3', mRNA sequence. 46 0.38 1 AC132016 |

  20. Dicty_cDB: CFE215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KASEGGAAAGSETSARK LFQNKVDLGESKSADKKLTTVHQNCITSIVPFKSVGGVVY*fqyxwfrw*hcrmacksx* s*k Translated Amino Acid seq...CAPLLITNQNGWKYSGEMDKASEGGAAAGSETSARK LFQNKVDLGESKSADKKLTTVHQNCITSIVPFKSVGGVVY*fqyxwfrw*hcrmack

  1. 24 CFR 572.215 - Implementation grants-eligible activities.

    Science.gov (United States)

    2010-04-01

    ... related to implementing the affirmative fair housing marketing strategy required under § 572.110. (k...) Homebuyer outreach and selection. Reasonable and necessary costs of marketing the program to potential... donation and before sale to an eligible homebuyer. These costs may include property insurance expenses...

  2. 78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM...

    Science.gov (United States)

    2013-10-31

    ... parts 171-180) with recent changes made to the International Maritime Dangerous Goods Code (IMDG), the International Civil Aviation Organization's Technical Instructions for the Safe Transport of Dangerous Goods by Air (ICAO TI), and the United Nations Recommendations on the Transport of Dangerous Goods--Model...

  3. Acharyya S see Dutta K 775 Ajith Kumar BP see Kumar Rakesh 215 ...

    Indian Academy of Sciences (India)

    Neutrino beam plasma instability. 755. Barbui M see Viesti G. 469. Barillé R. Spatial solitons in nonlinear liquid ... High spin spectroscopy of139Pr. 175. Chatterjee A. Data acquisition for experiments with multi- ... Recent studies in heavy ion induced fission re- actions. 585. Chow Kwok W. Periodic wavetrains for systems of ...

  4. 7 CFR 215.13a - Determining eligibility for free milk in child-care institutions.

    Science.gov (United States)

    2010-01-01

    ... for determining eligibility for free meals and milk under the National School Lunch and School... eligibility for free meals under the National School Lunch and School Breakfast Programs. (2) The method by... discrimination against free milk recipients and no discrimination against any child on the basis of race, color...

  5. Page 1 Graded subrings of C[X, Y] 215 References {1} Anderson ...

    Indian Academy of Sciences (India)

    {1} Anderson D. F. Subrings of k[X, Y] generated by monomials, Can. J. Math, Vol. XXX, No. 1 (1978). 2 : 5. 224. [2] Bourbaki N, Commutative Algebra. Hermann, Addison Wesley Publishers. L3] Gurjar R V and Shastri A R, The fundamental group at infinity of affine surfaces, Commen, Math. Heleetici 59 (1984) 459–484.

  6. 48 CFR 5252.215-9000 - Submission of cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... awarded based upon a determination that there is adequate price competition; therefore, the offeror is not... the proposals, the contracting officer determines that adequate price competition does not exist in... adequate price competition does not exist, the offeror shall provide certified cost or pricing data as...

  7. 48 CFR 2052.215-79 - Contract award and evaluation of proposals.

    Science.gov (United States)

    2010-10-01

    ... numerical (as appropriate) scoring techniques, proposals are evaluated against the evaluation factors... overstated or understated as indicated by the application of cost or price analysis techniques. A proposal... proposals, the level of effort data must be expressed in staff hours. Where a Contractor Spending Plan (CSP...

  8. 33 CFR 105.215 - Security training for all other facility personnel.

    Science.gov (United States)

    2010-07-01

    ..., whether part-time, full-time, temporary, or permanent, must have knowledge of, through training or equivalent job experience, in the following, as appropriate: (a) Relevant provisions of the Facility Security...

  9. Page 1 Microwave response of green vegetation 215 With a view to ...

    Indian Academy of Sciences (India)

    medium is generally computed by using the reciprocity relation e = (1 — Y) (10). **. In active and passive remote sensing studies the microwave response is measured in terms of brightness temperature of the target medium. The brightness tempera-. O 44 x -- SOYA BEAN. () —- GRASS LEAF. O 40 tn —- CORN LEAF.

  10. 25 CFR 39.215 - Can a school receive funding for any part-time students?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a school receive funding for any part-time students... Can a school receive funding for any part-time students? (a) A school can receive funding for the following part-time students: (1) Kindergarten students enrolled in a 2-hour program; and (2) Grade 7-12...

  11. OXY-2-15, a novel variant showing increased ceftazidime hydrolytic activity

    NARCIS (Netherlands)

    Nijhuis, R. H. T.; Oueslati, S.; Zhou, K.; Bosboom, R. W.; Rossen, J. W. A.; Naas, T.

    Objectives: Klebsiella oxytoca is a member of the family of Enterobacteriaceae and often contains the beta-lactamase bla(OXY) gene. Although this beta-lactamase does not naturally hydrolyse ceftazidime, this study describes possible in vivo selection of a clinical K. oxytoca isolate showing

  12. 40 CFR 92.215 - Maintenance of records; submittal of information; right of entry.

    Science.gov (United States)

    2010-07-01

    ...., whether experimental heads were cast and machined according to supplied drawings). In the cases in the..., ignition system components, intake-air pressurization and cooling-system components, cylinders, pistons and piston rings, exhaust smoke control system components, and exhaust aftertreatment devices as applicable...

  13. 40 CFR 94.215 - Maintenance of records; submittal of information; right of entry.

    Science.gov (United States)

    2010-07-01

    ... production engine, a general description of the buildup of the engine (e.g., whether experimental heads were... applicable), intake air pressurization and cooling system components, cylinders, pistons and piston rings...

  14. XTACC3-XMAP215 association reveals an asymmetric interaction promoting microtubule elongation

    DEFF Research Database (Denmark)

    Mortuza, Gulnahar B; Cavazza, Tommaso; Garcia-Mayoral, Maria Flor

    2014-01-01

    chTOG is a conserved microtubule polymerase that catalyses the addition of tubulin dimers to promote microtubule growth. chTOG interacts with TACC3, a member of the transforming acidic coiled-coil (TACC) family. Here we analyse their association using the Xenopus homologues, XTACC3 (TACC3) and XM...

  15. 48 CFR 52.215-1 - Instructions to Offerors-Competitive Acquisition.

    Science.gov (United States)

    2010-10-01

    ... withdrawal of proposals. (1) Unless other methods (e.g., electronic commerce or facsimile) are permitted in... transmitted through an electronic commerce method authorized by the solicitation, it was received at the... numbers of the offeror (and electronic address if available); (iii) A statement specifying the extent of...

  16. Page 1 Topological algebras with C*-enveloping algebras 215 [24 ...

    Indian Academy of Sciences (India)

    (1960). [30] Ruckle W, Sequence Spaces (London Melbourne; Pitman Adv. Publ. Program, Boston) (1981). [31] Turpin Ph., Un remarque surla algebra a inverse continue, C. R. Acad. Sci, Paris. 270 (1970) 1686–1689. [32] Wong Y C, Schwartz spaces, Nuclear spaces and Tensor products, Lecture Notes in Maths. No. 726,.

  17. 215. Evaluación de la terapia local con atorvastatina a altas concentraciones

    Directory of Open Access Journals (Sweden)

    J.M. Garrido Jiménez

    2010-01-01

    Conclusiones: el tratamiento con atorvastatina a altas concentraciones ejerce diferentes efectos sobre la viabilidad, proliferación y funcionalidad celular dependiendo del estado basal de las células endoteliales, siendo las células previamente activadas las que presentan niveles óptimos de viabilidad y funcionalidad.

  18. 215. Evaluación de la terapia local con atorvastatina a altas concentraciones

    OpenAIRE

    Garrido Jiménez, J.M.; Miguelena Hycka, J.; Prada Arrondo, P.; García Andrade, I.; Muñoz Pérez, R.; Oliva de Anquín, E.; Celemín Canorrea, D.; Epeldegui Torre, A.; Sánchez-Montesinos, I.; Roda Murillo, O.; Esteban Molina, M.

    2010-01-01

    Los efectos pleiotrópicos de las estatinas convierten a este grupo farmacológico en un coadyuvante ideal para la optimización de los procedimientos de revascularización y regeneración tisular. El objetivo de este estudio es identificar sus potenciales beneficios sobre el endotelio vascular, determinando los efectos que la atorvastatina a altas concentraciones genera en la biodinámica endotelial, utilizando un modelo experimental de activación endotelial mediante ácido lisofosfatídico (LPA). ...

  19. 24 CFR 598.215 - What are the purpose and content of the strategic plan?

    Science.gov (United States)

    2010-04-01

    ... the economic development advantages of energy efficiency and use of renewable energy resources, and... statement of the strategies the community proposes to use to achieve the strategic plan goals, and the... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false What are the purpose and content of...

  20. ABCA7 p.G215S as potential protective factor for Alzheimer's disease

    NARCIS (Netherlands)

    Sassi, C. (Celeste); M.A. Nalls (Michael); Ridge, P.G. (Perry G.); J.R. Gibbs (J Raphael); Ding, J. (Jinhui); M.K. Lupton (Michelle); C. Troakes (Claire); Lunnon, K. (Katie); S. Al-Sarraj (Safa); K. Brown (Kristelle); C. Medway (Christopher); Clement, N. (Naomi); Lord, J. (Jenny); J.C. Turton (James); J. Bras (Jose); Almeida, M.R. (Maria R.); P. Passmore (Peter); D. Craig (David); J.A. Johnston (Janet); McGuinness, B. (Bernadette); S. Todd (Stephen); R. Heun (Reinhard); H. Kölsch (Heike); P.G. Kehoe (Patrick); E.R.L.C. Vardy (Emma); N.M. Hooper (Nigel Mark); D. Mann (David); S. Pickering-Brown (Stuart); Brown, K. (Kristelle); Lowe, J. (James); K. Morgan (Kevin); A.D. Smith (David); G.K. Wilcock (Gordon); D.R. Warden (Donald); C. Holmes (Clive); H. Holstege (Henne); E. Louwersheimer (Eva); W.M. van der Flier (Wiesje); P. Scheltens (Philip); J.C. van Swieten (John); Santana, I. (Isabel); C.R. Oliveira (Catarina Resende); Morgan, K. (Kevin); J. Powell (John); J.S.K. Kauwe (John); C. Cruchaga (Carlos); A.M. Goate (Alison M.); A. Singleton (Andrew); R. Guerreiro (Rita); Hardy, J. (John)

    2016-01-01

    textabstractGenome-wide association studies (GWASs) have been effective approaches to dissect common genetic variability underlying complex diseases in a systematic and unbiased way. Recently, GWASs have led to the discovery of over 20 susceptibility loci for Alzheimer's disease (AD). Despite the

  1. 5 CFR 919.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security...

  2. 29 CFR 1471.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq...

  3. 7 CFR 3017.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  4. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  5. 21 CFR 1404.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  6. 2 CFR 180.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  7. 31 CFR 19.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq...

  8. 22 CFR 1508.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  9. 22 CFR 1006.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  10. 29 CFR 98.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  11. 34 CFR 85.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  12. PS2-15: Coding for Obesity in a Health Plan Claims Database

    OpenAIRE

    Shainline, Michael; Carter, Shelley; Von Worley, Ann; Gunter, Margaret

    2010-01-01

    Background and Aims: The Centers for Disease Control estimated the obesity rate in New Mexico for 2008 to be 25.2%. Sources estimate the following associations between obesity and type 2 diabetes (80%); cardiovascular disease (70%); hypertension (26 %). Yet obesity is infrequently coded as a secondary diagnosis among providers submitting claims. This study examines the frequency with which obesity is documented on claims forms, the relationship between age, gender, and obesity coding, and the...

  13. 215 mandible fractures in 120 children: demographics, treatment, outcomes, and early growth data.

    Science.gov (United States)

    Smith, Darren M; Bykowski, Michael R; Cray, James J; Naran, Sanjay; Rottgers, S Alex; Shakir, Sameer; Vecchione, Lisa; Schuster, Lindsay; Losee, Joseph E

    2013-06-01

    Optimal management of pediatric mandible fractures demands that the practitioner balance reduction and fixation with preservation of growth potential and function. The ideal synthesis of these goals has not yet been defined. The authors catalogue their experience with pediatric mandible fractures at a major pediatric teaching hospital with reference to demographics, injury type, treatment, and outcomes to inform future management of these injuries. Demographics, management, and outcomes of pediatric mandible fractures presenting over 10 years at a pediatric trauma center were assessed. Cephalometric analysis was conducted. Relationships among demographics, fracture type, management, outcomes, and growth were explored. Two hundred fifteen mandible fractures in 120 patients younger than 18 years were analyzed (average follow-up, 19.5 months). The condylar head and neck were fractured most frequently. Operative management was significantly more likely for children older than 12 years (pcephalometric analysis between our cohort and age- and sex-matched controls (p>0.05). This study reports the demographics, treatment, and early follow-up of a sizable cohort of pediatric mandible fractures. Management principles for these injuries are outlined. Although definitive recommendations must be withheld until longer follow-up is available, the data presented here show that the treatment protocols used at the authors' center have yielded largely uncompromised mandibular function and growth thus far.

  14. 32 CFR 37.215 - What must I conclude about the recipient's commitment and cost sharing?

    Science.gov (United States)

    2010-07-01

    ... example, by a research project's potential for fostering technology to be incorporated into products and... success of the project. You should find evidence of that commitment and interest in the proposal, in the... carrying out a research project under a TIA are to provide at least half of the costs of the project...

  15. 34 CFR 84.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... awareness program to inform employees about— (a) The dangers of drug abuse in the workplace; (b) Your policy... assistance programs; and (d) The penalties that you may impose upon them for drug abuse violations occurring in the workplace. (Authority: E.O.s 12549 and 12689; 20 U.S.C. 1082, 1094, 1221e-3 and 3474; and Sec...

  16. 47 CFR 73.215 - Contour protection for short-spaced assignments.

    Science.gov (United States)

    2010-10-01

    ... station pursuant to 47 CFR 73.211(b)(3): 6 kW ERP/240 meters HAAT—Class A 25 kW ERP/150 meters HAAT—Class B1 50 kW ERP/472 meters HAAT—Class B (b) Applicants requesting short-spaced assignments pursuant to... achieved: (1) The ERP and antenna HAAT of the proposed station in the direction of the contours of other...

  17. 75 FR 32440 - Catalog of Federal Domestic Assistance (CFDA) Number: 84.215J

    Science.gov (United States)

    2010-06-08

    ...-quality full-service community schools, regardless of Title I funding status. Discussion: We appreciate... priority for these schools would prevent support for the development of the highest quality full-service... highlight the importance of providing integrated services in response to identified needs. The commenter...

  18. 48 CFR 215.404-71-3 - Contract type risk and working capital adjustment.

    Science.gov (United States)

    2010-10-01

    ... (other than those under DoD cooperative logistics support arrangements or those made from U.S. Government inventories or stocks) where the contractor can demonstrate that there are substantial risks above those...

  19. 49 CFR Appendix A to Part 215 - Railroad Freight Car Components

    Science.gov (United States)

    2010-10-01

    .... Arch bar type. 2. Truck with cast steel pedestal side frame, short wheel base, and no bolster. H.Truck... identification mark or pattern number. I.1.Truck side frames: A side frame with one of the following pattern... TF-5100 7323 F-420 21362 (cast prior to June 1941) Pittsburgh steel foundry Scullin steel Bettendorf...

  20. 28 CFR 42.215 - Other actions authorized under the JSIA.

    Science.gov (United States)

    2010-07-01

    ... discriminatory conduct on the basis of race, color, religion, national origin, or sex in any program or activity... or would violate the provisions of this subpart or section 815(c)(1) of the JSIA and neither party... relief authorized by this subsection will not be granted unless the party making application for such...

  1. 36 CFR 215.12 - Decisions and actions not subject to appeal.

    Science.gov (United States)

    2010-07-01

    ... objection process of § 219.32 or the administrative appeal and review procedures of part 217 in effect prior... 10, section 18. (c) Preliminary findings made during planning and/or analysis processes on a project... to either the objection process of § 219.32 or the administrative appeal and review procedures of...

  2. Psychological stress and testicular function: a cross-sectional study of 1,215 Danish men

    National Research Council Canada - National Science Library

    Nordkap, Loa; Jensen, Tina Kold; Hansen, Åse Marie; Lassen, Tina Harmer; Bang, Anne Kirstine; Joensen, Ulla Nordström; Blomberg Jensen, Martin; Skakkebæk, Niels Erik; Jørgensen, Niels

    2016-01-01

    .... Participants completed a questionnaire on health and lifestyle, including a four-item questionnaire about self-rated stress, had a physical examination performed, delivered a semen sample, and had a blood sample drawn. Semen parameters...

  3. 32 CFR 215.9 - Providing military resources to civil authorities.

    Science.gov (United States)

    2010-07-01

    ... facilities. (2) Requests for personnel to be used in a direct law enforcement role are not within the purview... equipment may not be used in a direct law enforcement role. (3) Repair parts and POL items are classified... the General Counsel of the DoD, the Assistant Secretary of Defense (Installations and Logistics), and...

  4. 29 CFR 215.3 - Employees represented by a labor organization.

    Science.gov (United States)

    2010-07-01

    ... appropriate, protective arrangements shall be the product of negotiation/discussion, pursuant to these... Transit Administration for technical advice as to the validity of objections. (5) If the Department of... new terms and conditions acceptable to the parties. At the end of the designated negotiation...

  5. P2-15: EEG Analysis on Story Change in TV Drama

    Directory of Open Access Journals (Sweden)

    Chung-Yeon Lee

    2012-10-01

    Full Text Available The human brain naturally recognizes a change of environment or atmosphere without great effort, and this is essential for interactive communication in social life and a specific reaction in an emergency situation. Most studies have investigated change detection of the brain with conditional experimental paradigms rather than the performance of everyday tasks. However, naturally occurring sensory stimuli are multimodal and dynamic. In an effort to study the relationship between users' induced physiological responses and changes of environment and atmosphere under more naturalistic and ecological conditions, we performed a basic experiment using audio-visual movies and electroencephalogram (EEG measurement. 8 healthy subjects were asked to watch a television sitcom without any responses, and their EEG signals were recorded simultaneously with 126 electrodes mounted in an elastic electrode cap. Time-frequency analysis of EEG revealed distinctive neural oscillations at the point of story change in the movie. This result could be used for applications in brain-computer interfaces, and provides a reference to cognitive impairment studies such as Attention Deficit Disorder (ADD or Attention-Deficit/Hyperactivity Disorder (ADHD.

  6. 48 CFR 52.215-10 - Price Reduction for Defective Certified Cost or Pricing Data.

    Science.gov (United States)

    2010-10-01

    ... raise the following matters as a defense: (i) The Contractor or subcontractor was a sole source supplier... best of the Contractor's knowledge and belief, the Contractor is entitled to the offset in the amount...

  7. 48 CFR 1552.215-72 - Instructions for the Preparation of Proposals.

    Science.gov (United States)

    2010-10-01

    .... These hours do not include management at a level higher than project management, e.g., corporate and day... for which the salary is applicable; (C) List of other research Projects or proposals for which... each work year are direct (i.e., productive working hours) and how many are indirect (i.e., paid...

  8. Experimental validation of depletion calculations with VESTA 2.1.5 using JEFF-3.2

    Science.gov (United States)

    Haeck, Wim; Ichou, Raphaëlle

    2017-09-01

    The removal of decay heat is a significant safety concern in nuclear engineering for the operation of a nuclear reactor both in normal and accidental conditions and for intermediate and long term waste storage facilities. The correct evaluation of the decay heat produced by an irradiated material requires first of all the calculation of the composition of the irradiated material by depletion codes such as VESTA 2.1, currently under development at IRSN in France. A set of PWR assembly decay heat measurements performed by the Swedish Central Interim Storage Facility (CLAB) located in Oskarshamm (Sweden) have been calculated using different nuclear data libraries: ENDF/B-VII.0, JEFF-3.1, JEFF-3.2 and JEFF-3.3T1. Using these nuclear data libraries, VESTA 2.1 calculates the assembly decay heat for almost all cases within 4% of the measured decay heat. On average, the ENDF/B-VII.0 calculated decay heat values appear to give a systematic underestimation of only 0.5%. When using the JEFF-3.1 library, this results a systematic underestimation of about 2%. By switching to the JEFF-3.2 library, this systematic underestimation is improved slighty (up to 1.5%). The changes made in the JEFF-3.3T1 beta library appear to be overcorrecting, as the systematic underestimation is transformed into a systematic overestimation of about 1.5%.

  9. Financing State Governments in Nigeria, 1980-2007 (Pp. 204-215)

    African Journals Online (AJOL)

    Nekky Umera

    variables taken together. Student t-test was used to test for the significance of each explanatory variable contributing to the financing of the state government expenditure profiles in Nigeria because the number of years covered in the research was 28years, which is below thirty. The co-efficient of multiple determinations (R2) ...

  10. Experimental validation of depletion calculations with VESTA 2.1.5 using JEFF-3.2

    Directory of Open Access Journals (Sweden)

    Haeck Wim

    2017-01-01

    Full Text Available The removal of decay heat is a significant safety concern in nuclear engineering for the operation of a nuclear reactor both in normal and accidental conditions and for intermediate and long term waste storage facilities. The correct evaluation of the decay heat produced by an irradiated material requires first of all the calculation of the composition of the irradiated material by depletion codes such as VESTA 2.1, currently under development at IRSN in France. A set of PWR assembly decay heat measurements performed by the Swedish Central Interim Storage Facility (CLAB located in Oskarshamm (Sweden have been calculated using different nuclear data libraries: ENDF/B-VII.0, JEFF-3.1, JEFF-3.2 and JEFF-3.3T1. Using these nuclear data libraries, VESTA 2.1 calculates the assembly decay heat for almost all cases within 4% of the measured decay heat. On average, the ENDF/B-VII.0 calculated decay heat values appear to give a systematic underestimation of only 0.5%. When using the JEFF-3.1 library, this results a systematic underestimation of about 2%. By switching to the JEFF-3.2 library, this systematic underestimation is improved slighty (up to 1.5%. The changes made in the JEFF-3.3T1 beta library appear to be overcorrecting, as the systematic underestimation is transformed into a systematic overestimation of about 1.5%.

  11. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (215-0611-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  12. 12 CFR Appendix to Part 215 - Section 5200 of the Revised Statutes Total Loans and Extensions of Credit

    Science.gov (United States)

    2010-01-01

    ..., business trust, corporation, sovereign government, or agency, instrumentality, or political subdivision... or extensions of credit to the Student Loan Marketing Association shall not be subject to any...

  13. Oahu Hyperspectral Imagery 2000 (215-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  14. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon

    2002-01-01

    . Electroencephalography (EEG) was performed continuously during the experiment. Sleep interviews were performed after each scan. The EEG was scored blindly to determine sleep stage. The sleep interviews revealed a substantial increase in how unrealistic and how leaping the thoughts were during stage-1 sleep. During sleep......This is the first report on the distribution of regional cerebral blood flow (rCBF) changes during stage-1 sleep or somnolence. Two hypotheses were tested: (A) that rCBF differed between the awake relaxed state and stage-1 sleep, (B) that hypnagogic hallucinations frequently experienced at sleep...... onset would be accompanied by measurable changes in rCBF using positron emission tomography (PET). Eight subjects were PET-scanned with (15)O-labeled water injection in three conditions: awake, stage-1 sleep with reportable experiences and stage-1 sleep without reportable experiences...

  15. Oahu Hyperspectral Imagery 2000 (215-0611-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  16. SU-G-JeP2-15: Proton Beam Behavior in the Presence of Realistic Magnet Fields

    Energy Technology Data Exchange (ETDEWEB)

    Santos, D M; Wachowicz, K [Cross Cancer Institute, Edmonton, AB (Canada); Fallone, B G [Cross Cancer Institute, Edmonton, AB (Canada); MagnetTx Oncology Solutions, Edmonton, AB (Canada)

    2016-06-15

    Purpose: To investigate the effects of magnetic fields on proton therapy beams for integration with MRI. Methods: 3D magnetic fields from an open-bore superconducting MRI model (previously developed by our group) and 3D magnetic fields from an in-house gradient coil design were applied to various mono energetic proton pencil beam (80MeV to 250MeV) simulations. In all simulations, the z-axis of the simulation geometry coincided with the direction of the B0 field and magnet isocentre. In each simulation, the initial beam trajectory was varied. The first set of simulations performed was based on analytic magnetic force equations (analytic simulations), which could be rapidly calculated yet were limited to propagating proton beams in vacuum. The second set is full Monte Carlo (MC) simulations, which used GEANT4 MC toolkit. Metrics such as the beam position and dose profiles were extracted. Comparisons between the cases with and without magnetic fields present were made. Results: The analytic simulations served as verification checks for the MC simulations when the same simulation geometries were used. The results of the analytic simulations agreed with the MC simulations performed in vacuum. The presence of the MRI’s static magnetic field causes proton pencil beams to follow a slight helical trajectory when there were some initial off-axis components. The 80MeV, 150MeV, and 250MeV proton beams rotated by 4.9o, 3.6o, and 2.8o, respectively, when they reached z=0cm. The deflections caused by gradient coils’ magnetic fields show spatially invariant patterns with a maximum range of 0.5mm at z=0cm. Conclusion: This investigation reveals that both the MRI’s B0 and gradient magnetic fields can cause small but observable deflections of proton beams at energies studied. The MRI’s static field caused a rotation of the beam while the gradient coils’ fields effects were spatially invariant. Dr. B Gino Fallone is a co-founder and CEO of MagnetTx Oncology Solutions (under discussions to license Alberta bi-planar linac MR for commercialization)

  17. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon

    2002-01-01

    This is the first report on the distribution of regional cerebral blood flow (rCBF) changes during stage-1 sleep or somnolence. Two hypotheses were tested: (A) that rCBF differed between the awake relaxed state and stage-1 sleep, (B) that hypnagogic hallucinations frequently experienced at sleep ...... onset would be accompanied by measurable changes in rCBF using positron emission tomography (PET). Eight subjects were PET-scanned with (15)O-labeled water injection in three conditions: awake, stage-1 sleep with reportable experiences and stage-1 sleep without reportable experiences...

  18. 48 CFR 252.215-7005 - Evaluation Factor for Employing or Subcontracting With Members of the Selected Reserve.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation Factor for... Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS... documentation may include, but is not limited to— (1) Existing company documentation, such as payroll or...

  19. 20 CFR 645.215 - What must a WtW operating entity that serves noncustodial parent participants do?

    Science.gov (United States)

    2010-04-01

    ... and children who may be at risk of domestic violence, the operating entity must consult with domestic violence prevention and intervention organizations in the development of its WtW project serving... responsibility contracts: (1) Take into account the employment and child support status of the noncustodial...

  20. MiR-21-5p in urinary extracellular vesicles is a novel biomarker of urothelial carcinoma

    OpenAIRE

    Matsuzaki, Kyosuke; Fujita, Kazutoshi; Jingushi, Kentaro; Kawashima, Atsunari; Ujike, Takeshi; Nagahara, Akira; Ueda, Yuko; Tanigawa, Go; Yoshioka, Iwao; Ueda, Koji; Hanayama, Rikinari; Uemura, Motohide; Miyagawa, Yasushi; Tsujikawa, Kazutake; Nonomura, Norio

    2017-01-01

    Background Extracellular vesicles are lipid bilayer vesicles containing protein, messengerRNA and microRNA. Cancer cell-derived extracellular vesicles may be diagnostic and therapeutic targets. We extracted extracellular vesicles from urine of urothelial carcinoma patients and the control group to identify cancer-specific microRNAs in urinary extracellular vesicles as new biomarkers. Materials and methods microRNA from urinary extracellular vesicles extracted from 6 urothelial carcinoma patie...

  1. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon

    2002-01-01

    to other forms of altered awareness, for example, relaxation meditation than to deeper sleep stages. We are of the opinion that stage-1 sleep represents the dreaming state of wakefulness, while rapid eye movement (REM) sleep reflects the dreaming state of the unaware, sleeping brain.......This is the first report on the distribution of regional cerebral blood flow (rCBF) changes during stage-1 sleep or somnolence. Two hypotheses were tested: (A) that rCBF differed between the awake relaxed state and stage-1 sleep, (B) that hypnagogic hallucinations frequently experienced at sleep...... onset would be accompanied by measurable changes in rCBF using positron emission tomography (PET). Eight subjects were PET-scanned with (15)O-labeled water injection in three conditions: awake, stage-1 sleep with reportable experiences and stage-1 sleep without reportable experiences...

  2. 48 CFR 52.215-11 - Price Reduction for Defective Certified Cost or Pricing Data-Modifications.

    Science.gov (United States)

    2010-10-01

    ... or subcontractor was a sole source supplier or otherwise was in a superior bargaining position and... certifies to the Contracting Officer that, to the best of the Contractor's knowledge and belief, the...

  3. 48 CFR 1652.215-70 - Rate Reduction for Defective Pricing or Defective Cost or Pricing Data.

    Science.gov (United States)

    2010-10-01

    ... the following matters as a defense: (i) The Carrier was a sole source supplier or otherwise was in a... Carrier certifies to the Contracting Officer that, to the best of the Carrier's knowledge and belief, the...

  4. Synthetic aperture acoustic imaging of canonical targets with a 2-15 kHz linear FM chirp

    Science.gov (United States)

    Vignola, Joseph F.; Judge, John A.; Good, Chelsea E.; Bishop, Steven S.; Gugino, Peter M.; Soumekh, Mehrdad

    2011-06-01

    Synthetic aperture image reconstruction applied to outdoor acoustic recordings is presented. Acoustic imaging is an alternate method having several military relevant advantages such as being immune to RF jamming, superior spatial resolution, capable of standoff side and forward-looking scanning, and relatively low cost, weight and size when compared to 0.5 - 3 GHz ground penetrating radar technologies. Synthetic aperture acoustic imaging is similar to synthetic aperture radar, but more akin to synthetic aperture sonar technologies owing to the nature of longitudinal or compressive wave propagation in the surrounding acoustic medium. The system's transceiver is a quasi mono-static microphone and audio speaker pair mounted on a rail 5meters in length. Received data sampling rate is 80 kHz with a 2- 15 kHz Linear Frequency Modulated (LFM) chirp, with a pulse repetition frequency (PRF) of 10 Hz and an inter-pulse period (IPP) of 50 milliseconds. Targets are positioned within the acoustic scene at slant range of two to ten meters on grass, dirt or gravel surfaces, and with and without intervening metallic chain link fencing. Acoustic image reconstruction results in means for literal interpretation and quantifiable analyses. A rudimentary technique characterizes acoustic scatter at the ground surfaces. Targets within the acoustic scene are first digitally spotlighted and further processed, providing frequency and aspect angle dependent signature information.

  5. 48 CFR 1452.215-71 - Use and Disclosure of Proposal Information-Department of the Interior.

    Science.gov (United States)

    2010-10-01

    ... Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT SOLICITATION PROVISIONS AND CONTRACT CLAUSES..., which is used for making, preparing, compounding, treating or processing articles or materials which are trade commodities. (2) “Confidential commercial or financial information” means any business information...

  6. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  7. Production of neutron-rich nuclides in the heavy-element region via /sup 3/He-induced reactions

    Energy Technology Data Exchange (ETDEWEB)

    Chu, Y.Y.; Zhou, M.L.

    1982-01-01

    We have measured the production cross sections for /sup 233/Th and /sup 231/Th from the bombardment of /sup 238/U with /sup 3/He ions at 46-, 53-, and 60-MeV at the Brookhaven 60-in. isochronous cyclotron. We have also attempted to observe the decay of /sup 233/Ac produced via /sup 238/U(/sup 3/He,/sup 8/B) or equivalent reactions using 61 MeV /sup 3/He ions by first separating thorium from actinium and then performing chemical purifications on the second thorium sample into which the actinium has decayed. In the four experiments we performed, three gave results consistent with the ..beta.. half-life of /sup 233/Ac somewhat longer than 120 s and the production cross section from this target-projectile combination in the order of 1 to 2 ..mu..b.

  8. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  9. SU-G-IeP2-15: Virtual Insertion of Digital Kidney Stones Into Dual-Source, Dual- Energy CT Projection Data

    Energy Technology Data Exchange (ETDEWEB)

    Ferrero, A; Chen, B; Huang, A; Montoya, J; Yu, L; McCollough, C [Mayo Clinic, Rochester, MN (United States)

    2016-06-15

    Purpose: In order to investigate novel methods to more accurately estimate the mineral composition of kidney stones using dual energy CT, it is desirable to be able to combine digital stones of known composition with actual phantom and patient scan data. In this work, we developed and validated a method to insert digital kidney stones into projection data acquired on a dual-source, dual-energy CT system. Methods: Attenuation properties of stones of different mineral composition were computed using tabulated mass attenuation coefficients, the chemical formula for each stone type, and the effective beam energy at each evaluated tube potential. A previously developed method to insert lesions into x-ray CT projection data was extended to include simultaneous dual-energy CT projections acquired on a dual-source gantry (Siemens Somatom Flash). Digital stones were forward projected onto both detectors and the resulting projections added to the physically acquired sinogram data. To validate the accuracy of the technique, digital stones were inserted into different locations in the ACR CT accreditation phantom; low and high contrast resolution, CT number accuracy and noise properties were compared before and after stone insertion. The procedure was repeated for two dual-energy tube potential pairs in clinical use on the scanner, 80/Sn140 kV and 100/Sn140 kV, respectively. Results: The images reconstructed after the insertion of digital kidney stones were consistent with the images reconstructed from the scanner. The largest average CT number difference for the 4 insert in the CT number accuracy module of the phantom was 3 HU. Conclusion: A framework was developed and validated for the creation of digital kidney stones of known mineral composition, and their projection-domain insertion into commercial dual-source, dual-energy CT projection data. This will allow a systematic investigation of the impact of scan and reconstruction parameters on stone attenuation and dual-energy behavior under rigorously controlled conditions. Dr. McCollough receives research support from Siemens Healthcare.

  10. 48 CFR 215.403-1 - Prohibition on obtaining cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... requirements—(1) Adequate price competition. For acquisitions under dual or multiple source programs: (A) The determination of adequate price competition must be made on a case-by-case basis. Even when adequate price competition exists, in certain cases it may be appropriate to obtain additional information to assist in price...

  11. Comparative Spectra of Oxygen-Rich Versus Carbon-Rich Circumstellar Shells: VY Canis Majoris and IRC(plus)10216 at 215-285 GHz

    Science.gov (United States)

    Tenebaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-01-01

    A sensitive (1sigma rms at 1 MHz resolution approx.3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC +10216 has been conducted to compare the chemistries of oxygen- and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope of the Arizona Radio Observatory with a new Atacama Large Millimeter Array type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules; and in IRC +10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO, and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO(+). Sulfur plays an important role in VY CMa, but saturated/ unsaturated carbon dominates the molecular content of IRC +102.16, producing CH2NH, for example. Although the molecular complexity of IRC +10216 is greater, VY CMa supports a unique "inorganic" chemistry leading to the oxides PO, AlO, and AlOH. Only diatomic and triatomic compounds were observed in VY CMa, while species with four or more atoms are common in IRC +10216, reflecting carbon's ability to form multiple strong bonds, unlike oxygen. In VY CMa, a new water maser (v2 = 2) has been found, as well as vibrationally excited NaCl. Toward IRC +10216, vibrationally excited CCH was detected for the first time.

  12. Reply to comments by Mastalerz, V. on "Shallow gasoff the Rhône prodelta, Gulf of Lions" Marine Geology 234 (215-231)

    Science.gov (United States)

    Garcia-Garcia, Ana; Orange, Daniel L.; Lorenson, T.D.; Radakovitch, Olivier; Tesi, Tommaso; Miserocchi, Stefano; Berne, Serge; Friend, Patrick; Nittrouer, Chuck; Normand, Alain

    2008-01-01

    We really appreciate the interest and comments regarding our manuscript. We hope we address all the lingering issues in this reply. This also gives us the opportunity of publishing an update on our dataset that will complete the original manuscript (see Table 1). We have followed the author pattern in our answers: 1-Gas sampling procedure, 2-Reported gas concentrations results, 3-General remarks, 4-Conclusions.

  13. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-14-135/136 AND MCU-14-214/215/216: FEBRUARY AND MARCH 2014 MONTHLY SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2014-06-30

    SRNL received two sets of SHT samples (MCU-14-135-136 in February 2014 and MCU-14-214-216 in March 2014) for analysis. The samples were analyzed for composition. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar® L trimming at this time. However, the addition of TiDG (suppressor) to the blended solvent is recommended. Evidence of possible (slight) isomerization of the solvent, probably Isopar®L or TiDG degradation products, was observed.

  14. Phylogeographic Analysis of Haplogroup E3b (E-M215) Y Chromosomes Reveals Multiple Migratory Events Within and Out Of Africa

    Science.gov (United States)

    Cruciani, Fulvio; La Fratta, Roberta; Santolamazza, Piero; Sellitto, Daniele; Pascone, Roberto; Moral, Pedro; Watson, Elizabeth; Guida, Valentina; Colomb, Eliane Beraud; Zaharova, Boriana; Lavinha, João; Vona, Giuseppe; Aman, Rashid; Calì, Francesco; Akar, Nejat; Richards, Martin; Torroni, Antonio; Novelletto, Andrea; Scozzari, Rosaria

    2004-01-01

    We explored the phylogeography of human Y-chromosomal haplogroup E3b by analyzing 3,401 individuals from five continents. Our data refine the phylogeny of the entire haplogroup, which appears as a collection of lineages with very different evolutionary histories, and reveal signatures of several distinct processes of migrations and/or recurrent gene flow that occurred in Africa and western Eurasia over the past 25,000 years. In Europe, the overall frequency pattern of haplogroup E-M78 does not support the hypothesis of a uniform spread of people from a single parental Near Eastern population. The distribution of E-M81 chromosomes in Africa closely matches the present area of distribution of Berber-speaking populations on the continent, suggesting a close haplogroup–ethnic group parallelism. E-M34 chromosomes were more likely introduced in Ethiopia from the Near East. In conclusion, the present study shows that earlier work based on fewer Y-chromosome markers led to rather simple historical interpretations and highlights the fact that many population-genetic analyses are not robust to a poorly resolved phylogeny. PMID:15042509

  15. Reciprocal Benefits of Mass-Univariate and Multivariate Modeling in Brain Mapping: Applications to Event-Related Functional MRI, H215O-, and FDG-PET

    Directory of Open Access Journals (Sweden)

    James R. Moeller

    2006-01-01

    Full Text Available In brain mapping studies of sensory, cognitive, and motor operations, specific waveforms of dynamic neural activity are predicted based on theoretical models of human information processing. For example in event-related functional MRI (fMRI, the general linear model (GLM is employed in mass-univariate analyses to identify the regions whose dynamic activity closely matches the expected waveforms. By comparison multivariate analyses based on PCA or ICA provide greater flexibility in detecting spatiotemporal properties of experimental data that may strongly support alternative neuroscientific explanations. We investigated conjoint multivariate and mass-univariate analyses that combine the capabilities to (1 verify activation of neural machinery we already understand and (2 discover reliable signatures of new neural machinery. We examined combinations of GLM and PCA that recover latent neural signals (waveforms and footprints with greater accuracy than either method alone. Comparative results are illustrated with analyses of real fMRI data, adding to Monte Carlo simulation support.

  16. Effects of Lactobacillus formosensis S215T and Lactobacillus buchneri on quality and in vitro ruminal biological activity of condensed tannins in sweet potato vines silage.

    Science.gov (United States)

    Mangwe, M C; Rangubhet, K T; Mlambo, V; Yu, B; Chiang, H I

    2016-11-01

    This study investigated the influence of two microbial inoculants; Lactobacillus formosensis and Lactobacillus buchneri on fermentation quality, chemical composition, aerobic stability and in vitro ruminal biological activity of condensed tannins in sweet potato vines silage. Sweet potato vines were ensiled for 28 and 60 days; without inoculant (CON), with Lact. buchneri (LB) or with Lact. formosensis (LF), both inoculants applied to achieve 1 × 106  CFU g-1 fresh forage. Lactobacillus formosensis silage had lower pH and higher lactic acid than all treatments. Yeasts and moulds were not detected in LB silage after ensiling. Lactobacillus buchneri silage was more aerobically stable than all treatments, whereas LF was more stable than CON silage. In vitro ruminal biological activity of condensed tannins was lower in microbial-inoculated silages than CON after ensiling. Lactobacillus formosensis improved fermentability by reducing silage pH and improved aerobic stability by producing more propionate, which inhibited yeast activity. Lactobacillus buchneri improved aerobic stability of the silage by producing more acetate. Both strains effectively reduced the antinutritional effect of condensed tannins after ensiling. Lactobacillus formosensis has the potential to be used as a silage inoculant because of its ability to improve fermentability and aerobic stability in sweet potato vines silage. © 2016 The Society for Applied Microbiology.

  17. SU-E-J-215: Towards MR-Only Image Guided Identification of Calcifications and Brachytherapy Seeds: Application to Prostate and Breast LDR Implant Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Elzibak, A; Fatemi-Ardekani, A; Soliman, A; Mashouf, S; Safigholi, H; Ravi, A; Morton, G; Song, WY [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Han, D [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); University of California, San Diego, La Jolla, CA (United States)

    2015-06-15

    Purpose: To identify and analyze the appearance of calcifications and brachytherapy seeds on magnitude and phase MRI images and to investigate whether they can be distinguished from each other on corrected phase images for application to prostate and breast low dose rate (LDR) implant dosimetry. Methods: An agar-based gel phantom containing two LDR brachytherapy seeds (Advantage Pd-103, IsoAid, 0.8mm diameter, 4.5mm length) and two spherical calcifications (large: 7mm diameter and small: 4mm diameter) was constructed and imaged on a 3T Philips MR scanner using a 16-channel head coil and a susceptibility weighted imaging (SWI) sequence (2mm slices, 320mm FOV, TR/ TE= 26.5/5.3ms, 15 degree flip angle). The phase images were unwrapped and corrected using a 32×32, 2D Hanning high pass filter to remove background phase noise. Appearance of the seeds and calcifications was assessed visually and quantitatively using Osirix (http://www.osirix-viewer.com/). Results: As expected, calcifications and brachytherapy seeds appeared dark (hypointense) relative to the surrounding gel on the magnitude MRI images. The diameter of each seed without the surrounding artifact was measured to be 0.1 cm on the magnitude image, while diameters of 0.79 and 0.37 cm were measured for the larger and smaller calcifications, respectively. On the corrected phase images, the brachytherapy seeds and the calcifications appeared bright (hyperintense). The diameter of the seeds was larger on the phase images (0.17 cm) likely due to the dipole effect. Conclusion: MRI has the best soft tissue contrast for accurate organ delineation leading to most accurate implant dosimetry. This work demonstrated that phase images can potentially be useful in identifying brachytherapy seeds and calcifications in the prostate and breast due to their bright appearance, which helps in their visualization and quantification for accurate dosimetry using MR-only. Future work includes optimizing phase filters to best identify and delineate seeds and calcifications.

  18. SU-F-J-215: Non-Thermal Pulsed High Intensity Focused Ultrasound Therapy Combined with 5-Aminolevulinic Acid: An in Vivo Pilot Study

    Energy Technology Data Exchange (ETDEWEB)

    Wang, B; He, W; Cvetkovic, D; Chen, L; Ma, C [Fox Chase Cancer Center, Philadelphia, PA (United States)

    2016-06-15

    Purpose: It has recently been shown that non-thermal pulsed high intensity focused ultrasound (pHIFU) has a cell-killing effect. The purpose of the study is to investigate the sonosensitizing effect of 5-Aminolevulinic Acid (5-ALA) in non-thermal pHIFU cancer therapy. Methods: FaDu human head and neck squamous cell carcinoma cells were injected subcutaneously in the flanks of nude mice. After one to two weeks, the tumors reached the volume of 112 ± 8 mm3 and were assigned randomly into a non-thermal pHIFU group (n=9) and a non-thermal sonodynamic therapy (pHIFU after 5-ALA administration) group (n=7). The pHIFU treatments (parameters: 1 MHz frequency; 25 W acoustic power; 0.1 duty cycle; 60 seconds duration) were delivered using an InSightec ExAblate 2000 system with a GE Signa 1.5T MR scanner. The mice in the non-thermal sonodynamic group received 5-ALA tail-vein injection 4 hours prior to the pHIFU treatment. The tumor growth was monitored using the CT scanner on a Sofie-Biosciences G8 PET/CT system. Results: The tumors in this study grew very aggressively and about 60% of the tumors in this study developed ulcerations at various stages. Tumor growth delay after treatments was observed by comparing the treated (n=9 in pHIFU group; n=7 in sonodynamic group) and untreated tumors (n=17). However, no statistically significant differences were found between the non-thermal pHIFU and non-thermal sonodynamic group. The mean normalized tumor volume of the untreated tumors on Day 7 after their first CT scans was 7.05 ± 0.54, while the normalized volume of the treated tumors on Day 7 after treatment was 5.89 ± 0.79 and 6.27 ± 0.47 for the sonodynamic group and pHIFU group, respectively. Conclusion: In this study, no significant sonosensitizing effects of 5-ALA were obtained on aggressive FaDu tumors despite apparent tumor growth delay in some mice treated with non-thermal sonodynamic therapy.

  19. Immunohistochemical changes in the expression of HSP27 in exercised human vastus lateralis muscle”. Acta Physiologica (Oxf). 194(3): 215-22, 2008

    DEFF Research Database (Denmark)

    Folkesson, Mattias; Mackey, A L; Holm, Lars

    2008-01-01

    27 protein in muscle fibres from five of nine subjects. The number of fibres with accumulation of HSP27 in RE ranged from 0% to 32% with a mean of 6.3% of the total number of fibres. CONCLUSION: We conclude that this rapid HSP27 protein relocation after RE is an important player in the cellular...... remodelling of human muscle fibres in response to exercise involving high-force contractions, but not in response to endurance exercises....

  20. More examples of the 15-crown-5...H2O-M-OH2...15-crown-5 motif, M = Al3+, Cr3+ and Pd2+.

    Science.gov (United States)

    Siegler, Maxime A; Prewitt, Jacob H; Kelley, Steven P; Parkin, Sean; Selegue, John P; Brock, Carolyn Pratt

    2010-04-01

    Five structures of co-crystals grown from aqueous solutions equimolar in 15-crown-5 (or 15C5) and [M(H(2)O)(6)](NO(3))(n), M = Al(3+), Cr(3+) and Pd(2+), are reported. The hydrogen-bonding patterns in all are similar: metal complexes including the fragment trans-H(2)O-M-OH(2) alternate with 15C5 molecules, to which they are hydrogen bonded, to form stacks. A literature survey shows that this hydrogen-bonding pattern is very common. In each of the two polymorphs of the compound [Al(H(2)O)(6)](NO(3))(3).15C5.4H(2)O there are two independent cations; one forms hydrogen bonds directly to the 15C5 molecules adjacent in the stack, while the other cation is hydrogen-bonded to two water molecules that act as spacers in the stack. These stacks are then crosslinked by hydrogen bonds formed by the three nitrate counterions and the three lattice water molecules. The hydrogen-bonded stacks in [Cr(H(2)O)(5)(NO(3))](NO(3))(2).1.5(15C5).H(2)O are discrete rather than infinite; each unit contains two Cr(3+) complex cations and three 15C5 molecules. These units are again crosslinked by the uncoordinated nitrate ions and a lattice water molecule. In [Pd(H(2)O)(2)(NO(3))(2)].15C5 the infinite stacks are electrically neutral and are not crosslinked. In [Pd(H(2)O)(2)(NO(3))(2)].2(15C5).2H(2)O.2HNO(3) a discrete, uncharged unit containing one Pd complex and two 15C5 molecules is ;capped off' at either end by a lattice water molecule and an included nitric acid molecule. In all five structures the infinite stacks or discrete units form an array that is at least approximately hexagonal.

  1. 41 CFR 102-118.215 - May my agency pay a TSP any extra fees to pay for the preparation and use of the GBL or GTR?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May my agency pay a TSP... TSP any extra fees to pay for the preparation and use of the GBL or GTR? No, your agency must not pay any additional charges for the preparation and use of the GBL or GTR. Your agency may not pay a TSP a...

  2. Efeito da implantação de rodovias no cerrado brasileiro sobre a fauna de vertebrados - DOI: 10.4025/actascibiolsci.v28i3.215 Effect of the implantation of roads in the brazilian cerrado on the fauna of vertebrates - DOI: 10.4025/actascibiolsci.v28i3.215

    Directory of Open Access Journals (Sweden)

    Zara Faria Sobrinha Guimarães

    2007-11-01

    Full Text Available A fragmentação de hábitat causada pela ação humana vem sendo um dos grandes desafios para a biologia da conservação. A construção de estradas é um mecanismo de fragmentação de alto impacto, removendo a cobertura vegetal original, gerando efeito de borda e alterando a função e estrutura da paisagem, em contraste com a necessidade e o alto valor econômico imposto pela sociedade humana. Neste sentido, este estudo teve como objetivo avaliar o impacto da estrada na comunidade de fauna silvestre do Parque Altamiro de Moura Pacheco associada à presença da rodovia (BR-153/GO-060. Durante um ano de pesquisa, foram registrados 141 animais mortos por atropelamento. Os resultados do presente estudo, conduzido de Agosto/2003 a Julho/2004, foram comparados e analisados com estudo feito entre os anos de 1996 e 1997, tanto ao nível de carcaças encontradas quanto ao nível de ambiente. De acordo com os dados apresentados, reforça-se a necessidade de haver um melhor planejamento ao construir estradas, principalmente próximos a ambientes preservados ou unidades de conservação.The fragmentation of habitat caused by the action human being is comes one of the great challenges for the biology of the conservation. The construction of roads is a mechanism of the fragmentation of high impact, removing the original vegetablel covering, generating edge effect and modifying the function and structure of the landscape, in contrast with the necessity and the high economic value tax for the society human being. In this direction, this study it had as objective to evaluate the impact of the road in the community of wild fauna of the Park Altamiro de Moura Pacheco associated with the presence of the road (BR-153/GO-060. During one year of research, they had been registered 141 animals died for running over The results of the present study, lead of Agosto/2003 the Julho/2004, had been compared and analyzed with made study it enters the years of 1996 and 1997, as much the level of finded species how much the environment level. In accordance with the presented data, it is strengthened necessity to have one better planning when constructing roads, mainly next the preserved environments or units to conservation.

  3. Neutron Flux Depression in the UO{sub 2}-PuO{sub 2}(15 to 30%) Fuel Rods from IVO-FR2-Vg7-Irradiation Experiment; Depresion de flujo neutronico en las barras combustibles de UO2-PuO2(15 al 30%) del experimento de irradiacion IVO-FR2-Vg7

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, J.; Fernandez, J. L.

    1983-07-01

    The thermal-neutron flux depression within a fuel rod has a great influence in the radial temperature profile of the rod, especially for high enrichment fuel. For this reason, a study was made about the UO{sub 2}-PUO{sub 2} (15 to 30% PUO{sub 2}) fuel pins for the KfK-JEN joint irradiation program IVO, in the FR2 reactor. Different methods (diffusion, Bonalumi, successive generations) were compared and a new approach (parabolic approximation) was developed. (Author) 22 refs.

  4. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  5. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  6. A new sisorid catfish of the genus Gagata Bleeker from India

    NARCIS (Netherlands)

    Tilak, R.

    1970-01-01

    CONTENTS Introduction .................. 207 Description................... 207 Sexual dimorphism................. 211 Relationships .................. 211 A key to the species of the allied genera, Gagata Bleeker etc....... 213 Acknowledgements................. 215 References................... 215

  7. La formulación de preguntas: una alternativa metodológica que favorece la reflexión, discusión y construcción de conocimiento. (pág. 210-215

    Directory of Open Access Journals (Sweden)

    Natalia Sánchez Medina

    2010-07-01

    Full Text Available El Área de Ciencias Naturales y Educación Ambiental del Instituto Pedagógico Arturo Ramírez Montúfar (IPARM de la Universidad Nacional de Colombia – Sede Bogotá, corrobora la importancia de generar metodologías y alternativas que contribuyan al desarrollo en los estudiantes de habilidades científicas básicas que les permitan construir explicaciones a los eventos de orden biológico con una mirada propositiva y crítica, basada en el fomento de valores hacia el cuidado y respeto por su ambiente y las otras especies. En este sentido, desde del año 2007, y teniendo como antecedente inmediato las investigaciones de campo y laboratorio desarrolladas por la Línea de Investigación Faunística y Conservación de Artrópodos de la Universidad Pedagógica Nacional, se vienen desarrollando un conjunto de actividades cuyo objetivo principal es fortalecer en los estudiantes el conocimiento biológico de algunas especies de invertebrados como vínculo inmediato para la conservación y preservación de otras formas de vida.

  8. La formulación de preguntas: una alternativa metodológica que favorece la reflexión, discusión y construcción de conocimiento. (pág. 210-215)

    OpenAIRE

    Natalia Sánchez Medina

    2010-01-01

    El Área de Ciencias Naturales y Educación Ambiental del Instituto Pedagógico Arturo Ramírez Montúfar (IPARM) de la Universidad Nacional de Colombia – Sede Bogotá, corrobora la importancia de generar metodologías y alternativas que contribuyan al desarrollo en los estudiantes de habilidades científicas básicas que les permitan construir explicaciones a los eventos de orden biológico con una mirada propositiva y crítica, basada en el fomento de valores hacia el cuidado y respeto por su ambiente...

  9. Caracterización del anticuerpo monoclonal FC-2.15, dirigido contra carcinomas humanos y reactivo con LewisX : Estudio de sus propiedades funcionales in vitro y ex vivo

    OpenAIRE

    Capurro, Mariana Isabel

    1999-01-01

    Este trabajo de Tesis se ha basado en la producción de anticuerpos monoclonales (AMC) dirigidos contra las células troncales de carcinoma mamario humano. la caracterización e identificación de los antígenos (Ag) reconocidos por los mismos y la evaluación de la posible utilidad diagnóstica y terapéutica de dichos AMCs. Para su obtención, se inmunizaron ratones Balb/c con células provenientes de un paciente con un carcinoma de mama agresivo y altamente indiferenciado, negativo para la expresión...

  10. From Soft Power to Economic Diplomacy? A Comparison of the Changing Rationales and Roles of the U. S. and Canadian Federal Governments in International Education. Research & Occasional Paper Series: CSHE.2.15

    Science.gov (United States)

    Trilokekar, Roopa Desai

    2015-01-01

    Through a historical and comparative analysis of international education policy development in Canada and the U.S., this paper will map the similarities and differences in the two countries. It will highlight the contributions and challenges of the government's involvement in international education (IE) in the two federal states and in…

  11. Cationic clathrate of type-III Ge(172-x)P(x)Te(y) (y ≈ 21.5, x ≈ 2y): synthesis, crystal structure and thermoelectric properties.

    Science.gov (United States)

    Kirsanova, Maria A; Mori, Takao; Maruyama, Satofumi; Abakumov, Artem M; Van Tendeloo, Gustaaf; Olenev, Andrei; Shevelkov, Andrei V

    2013-07-15

    A first germanium-based cationic clathrate of type-III, Ge(129.3)P(42.7)Te(21.53), was synthesized and structurally characterized (space group P4(2)/mnm, a = 19.948(3) Å, c = 10.440(2) Å, Z = 1). In its crystal structure, germanium and phosphorus atoms form three types of polyhedral cages centered with Te atoms. The polyhedra share pentagonal and hexagonal faces to form a 3D framework. Despite the complexity of the crystal structure, the Ge(129.3)P(42.7)Te(21.53) composition corresponds to the Zintl counting scheme with a good accuracy. Ge(129.3)P(42.7)Te(21.53) demonstrates semiconducting/insulating behavior of electric resistivity, high positive Seebeck coefficient (500 μV K(-1) at 300 K), and low thermal conductivity (<0.92 W m(-1) K(-1)) within the measured temperature range.

  12. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  13. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  14. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VGI 60 ... Query: 156 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 215 ... VGGFNKDRTPFLKYVDLLGVTYHASTM...ATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK Sbjct: 121 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 180 ...

  15. ORF Alignment: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FYQIYPSLAEQFSIPLIPFFLEQVILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL 215 ... DAFYQIY...PSLAEQFSIPLIPFFLEQVILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL Sbjct: 122 DAFYQIYPSLAEQFSIPLIPFFLEQVILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL 181

  16. The chemistry of the actinide elements, Volume II

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is an exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  17. Chemistry of the actinide elements. Vol. 2. 2. Ed

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Morss, L.R.; Seaborg, G.T. (eds.)

    1986-01-01

    This is a comprehensive, exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven transuranium elements. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermodynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive list of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  18. Chemistry of the actinide elements. Vol. 1, 2nd Ed

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Morss, L.R.; Seaborg, L.R. (eds.)

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven transuranium elements. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermodynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  19. The chemistry of the actinide elements. Volume I

    Energy Technology Data Exchange (ETDEWEB)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements.

  20. Gold-coated lanthanide phosphate nanoparticles for an {sup 225}Ac in vivo alpha generator

    Energy Technology Data Exchange (ETDEWEB)

    McLaughlin, M.F. [Missouri Univ., Columbia, MO (United States). Dept. of Chemistry; Oak Ridge National Lab., TN (United States); Woodward, J.; Boll, R.A.; Rondinone, A.J.; Mirzadeh, S. [Oak Ridge National Lab., TN (United States); Robertson, J.D. [Missouri Univ., Columbia, MO (United States). Dept. of Chemistry

    2013-11-01

    Retaining radioactive daughter products at a clinically relevant target site remains one of the major challenges in development of in vivo {alpha} generators with radionuclides such as {sup 225}Ac and {sup 223}Ra. In this work, we examine the ability of layered nanoparticle constructs to retain {sup 225}Ac and the first decay daughter, {sup 221}Fr. Actinium-225 is cocrystalized in a lanthanide phosphate nanoparticle consisting of varying amounts of La and Gd. Additional lanthanide phosphate layers improve retention capability while an outer layer of gold facilitates the attachment of targeting moieties for in vivo use. Retention of {sup 225}Ac in the nanoparticles is near quantitative while the {sup 221}Fr retention varies from 60-89% as a function of time, the number of layers, and nanoparticle composition. Decay corrected radiochemical yield in the multi-shell syntheses are high (76%) and comparable to or better than existing delivery approaches. (orig.)

  1. Uranium decay products found on Mir space blanket mitt.

    Science.gov (United States)

    Grismore, R; Rosen, A Z; Llewellyn, R A; Taylor, J S

    2001-01-01

    The space blanket mitt which covered the Trek detector on Mir during four years of orbital flight has been measured for gamma radiation with HPGe and multidimensional spectrometers. Difference spectra from very-long-period spectrometer runs on the mitt and on a similar non-deployed mitt from the same manufacturer show that the mitt has acquired small but significant amounts of gamma radioactivity during orbital flight. Twelve gamma-ray peaks have been measured in the difference spectra, including peaks identified as due to 214Bi and 214Pb from the uranium-radium alpha decay series, and others possibly due to the uranium-actinium series. This implies the presence of a sparse population of uranium decay products in lower orbital space which can only have come from nuclear explosions, burned-up satellite nuclear batteries, the solar wind, or supernova fragments in the local interstellar medium.

  2. 76 FR 58150 - Defense Federal Acquisition Regulations Supplement; Discussions Prior to Contract Award (DFARS...

    Science.gov (United States)

    2011-09-20

    ... rule does not duplicate, overlap, or conflict with any other Federal rules. There are no practical...: PART 215--CONTRACTING BY NEGOTIATION 0 1. The authority citation for 48 CFR part 215 continues to read...

  3. 76 FR 38050 - Defense Federal Acquisition Regulation Supplement; Management of Manufacturing Risk in Major...

    Science.gov (United States)

    2011-06-29

    ... collection requirements. The proposed rule does not duplicate, overlap, or conflict with any other Federal... part 215 is amended as follows: PART 215--CONTRACTING BY NEGOTIATION 0 1. The authority citation for 48...

  4. Effect of interfacial friction during forging of solid powder discs of ...

    Indian Academy of Sciences (India)

    Author Affiliations. R K Ranjan1 S Kumar2. Applied Mechanics Department, Birla Institute of Technology, Mesra, Ranchi 835 215, India; Production Engineering Department, Birla Institute of Technology, Mesra, Ranchi 835 215, India ...

  5. An upper bound solution for closed die sinter forging of hexagonal ...

    Indian Academy of Sciences (India)

    Author Affiliations. R K Ranjan1 S Kumar2. Department of Applied Mechanics, Birla Institute of Technology, Mesra, Ranchi 835 215, India; Department of Production Engineering, Birla Institute of Technology, Mesra, Ranchi 835 215, India ...

  6. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  7. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  8. Evaluation of total effective dose due to certain environmentally placed naturally occurring radioactive materials using a procedural adaptation of RESRAD code.

    Science.gov (United States)

    Beauvais, Z S; Thompson, K H; Kearfott, K J

    2009-07-01

    Due to a recent upward trend in the price of uranium and subsequent increased interest in uranium mining, accurate modeling of baseline dose from environmental sources of radioactivity is of increasing interest. Residual radioactivity model and code (RESRAD) is a program used to model environmental movement and calculate the dose due to the inhalation, ingestion, and exposure to radioactive materials following a placement. This paper presents a novel use of RESRAD for the calculation of dose from non-enhanced, or ancient, naturally occurring radioactive material (NORM). In order to use RESRAD to calculate the total effective dose (TED) due to ancient NORM, a procedural adaptation was developed to negate the effects of time progressive distribution of radioactive materials. A dose due to United States' average concentrations of uranium, actinium, and thorium series radionuclides was then calculated. For adults exposed in a residential setting and assumed to eat significant amounts of food grown in NORM concentrated areas, the annual dose due to national average NORM concentrations was 0.935 mSv y(-1). A set of environmental dose factors were calculated for simple estimation of dose from uranium, thorium, and actinium series radionuclides for various age groups and exposure scenarios as a function of elemental uranium and thorium activity concentrations in groundwater and soil. The values of these factors for uranium were lowest for an adult exposed in an industrial setting: 0.00476 microSv kg Bq(-1) y(-1) for soil and 0.00596 microSv m(3) Bq(-1) y(-1) for water (assuming a 1:1 234U:238U activity ratio in water). The uranium factors were highest for infants exposed in a residential setting and assumed to ingest food grown onsite: 34.8 microSv kg Bq(-1) y(-1) in soil and 13.0 microSv m(3) Bq(-1) y(-1) in water.

  9. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 32; Issue 3. Issue front cover thumbnail. Volume 32, Issue 3. June 2009, pages 215-367. pp 215-215. Foreword · S B Krupanidhi H L Bhat · More Details Fulltext PDF. pp 217-225. Molecule-based magnets · J V Yakhmi · More Details Abstract Fulltext PDF.

  10. Untitled

    African Journals Online (AJOL)

    was estimated using the method of Waddell (1956). The absorbance of the extract was measured at. 215nm and 225nm. Normal saline (0.9% NaCl) was used as blank. The absorbance at 225nm was subtracted from that at 215nm. 1f the absorbance at. 215nm exceeded 15, the extract was further diluted. The difference ...

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-1129 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1129 ref|YP_002833499.1| hypothetical protein LS215_2921 [Sulfolobus island...icus L.S.2.15] gb|ACP36854.1| conserved hypothetical protein [Sulfolobus islandicus L.S.2.15] YP_002833499.1 0.031 25% ...

  12. The luminescence properties of Sr2-1.5x-1.5y P2 O7 :xDy3+ ,yCe3+ phosphor for near-UV-based white LEDs synthesized by a chemical co-precipitation method.

    Science.gov (United States)

    Liu, Sha-Sha; Zhu, Da-Chuan; Wang, Jin-Shan; Zhao, Cong; Han, Tao

    2017-07-06

    A series of Sr2 P2 O7 :Dy3+ , Sr2 P2 O7 :Ce3+ and Sr2 P2 O7 :Dy3+ ,Ce3+ phosphors was synthesized via the one-step calcination process for the precursors prepared by co-precipitation methods. The phases, morphology, quantum efficiency and photoluminescence properties of the obtained phosphors were characterized systematically. These results show that the near-spherical particles prepared through calcining the precursors by means of ammonium dibasic phosphate co-precipitation (method 3) have the smallest particle size and strongest emission intensity among the three methods in the paper. With Dy3+ concentration increasing in Sr2 P2 O7 :Dy3+ phosphors, the luminescence intensity first increases, reaches maximum, and then decreases. A similar trend was followed by Sr2 P2 O7 :Ce3+ with Ce3+ concentration increasing. A successful attempt was made to initiate the energy transfer mechanism from Ce3+ to Dy3+ in the host lattice and an overlap between the emission band of Ce3+ and the excitation band of Dy3+ indicated that the Ce3+  → Dy3+ energy transfer may indeed exist. It is clear that the photoluminescence intensity of Dy3+ as well as the quantum efficiency of the phosphor can be enhanced markedly by co-doping Ce3+ . Sr2 P2 O7 :Dy3+ ,Ce3+ has its (CIE) chromaticity coordinates in the bluish-white-light region, near the standard illuminant D65 . The CIE 1913 chromaticity coordinates of Sr2 P2 O7 :Dy3+ phosphors fall in the white-light region, and are adjacent to the ideal white-light coordinates. In addition, the colour temperature and colour tone of Sr2 P2 O7 :Dy3+ could be adjusted by changing the relative concentration of Dy3+ . In short, Sr2 P2 O7 :Dy3+ can be a promising single-phased white-light emitting phosphor for near-UV (NUV) w-LEDs. Copyright © 2017 John Wiley & Sons, Ltd.

  13. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  14. EST Table: FS825356 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS825356 E_FL_fmgV_20I11_R_0 10/09/28 74 %/215 aa gb|ABC61672.1| cxpwmw03 [Periplan...1 10/09/10 74 %/215 aa gnl|Amel|GB16882-PA 10/09/10 75 %/215 aa gi|91075966|ref|XP_969306.1| PREDICTED: similar to cxpwmw03 [Tribolium castaneum] FS870678 fmgV ...

  15. Combining Trust and Behavioral Analysis to Detect Security Threats in Open Environments

    Science.gov (United States)

    2010-11-01

    Combining Trust and Behavioral Analysis to Detect Security Threats in Open Environments Owen McCusker Sonalysts, Inc. 215 Parkway N. Waterford , CT...Brunza Sonalysts, Inc. 215 Parkway N. Waterford , CT 06333 USA scottso@sonalysts.com Dr. Carrie Gates CA Labs One CA Plaza Islandia, NY 11749 USA...5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Sonalysts Inc,215 Parkway N., Waterford ,CT,06333 8. PERFORMING

  16. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  17. Protein (Viridiplantae): 357448019 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :12299 3880:12299 14 kDa proline-rich protein DC2.15 Medicago truncatula MGLKGVGSIFILFLHLIFVSTLVSAKSAPRRPPPPPQVTCSSTPPPVVAPSTPPSTPP...ITVAPSTSPVAVDPTTLPPSTPPSTPPTSTPPNVVAPSTPPPSTPPFTTPPTVAPSTPPLVHAPSTPPPSTPPSTPP...TAIAPSTPQVVIDPTTLPPSTTHSTPPSVDAPSSPPSTPPTTVAPSTPPSLVDPTTPPPSTPPSTPPPVHDPSTPPSTPPIAVAPSTPPSVVNPTIPPPSTPPTTPPPNPRTPP...TNPRTPPTNPRTPPTTPPPNPRTPPTTPPTNPRTPPKNPMTPPTIPPPNPRTPPTTLPPNPRTPPTTPPANPRTPPTRPPTNPRTPPTTSPPNPRTPPTNPMTPP...TTPPANPRTPPTTPPTNPRTPPTTPPTNPRTPPTTPPPNPRTPPTNPMKPPTTPPPNPMTPPSTPPPNPRTPPTTPSPNPRTPP

  18. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1021) ... magaplasmid pSymA ... Length = 215 ... Query: 74 ... LDRREHLIGVAASFEAHVEKRLVVAIDELYPEHALG...ELFAEFAVHFPHVELELLFPMMED 133 ... LDRREHLIGVAASFEAHVEKRLVVAIDELYPEHALGELFAEFAVHFPHVELELLFPMMED Sbjct: ...1 ... LDRREHLIGVAASFEAHVEKRLVVAIDELYPEHALGELFAEFAVHFPHVELELLFPMMED 60 ... Query: 194 I

  19. β-decay studies of neutron-rich Tl, Pb, and Bi isotopes

    Science.gov (United States)

    Morales, A. I.; Benzoni, G.; Gottardo, A.; Valiente-Dobón, J. J.; Blasi, N.; Bracco, A.; Camera, F.; Crespi, F. C. L.; Corsi, A.; Leoni, S.; Million, B.; Nicolini, R.; Wieland, O.; Gadea, A.; Lunardi, S.; Górska, M.; Regan, P. H.; Podolyák, Zs.; Pfützner, M.; Pietri, S.; Boutachkov, P.; Weick, H.; Grebosz, J.; Bruce, A. M.; Núñez, J. Alcántara; Algora, A.; Al-Dahan, N.; Ayyad, Y.; Alkhomashi, N.; Allegro, P. R. P.; Bazzacco, D.; Benlliure, J.; Bowry, M.; Bunce, M.; Casarejos, E.; Cortes, M. L.; Bacelar, A. M. Denis; Deo, A. Y.; de Angelis, G.; Domingo-Pardo, C.; Doncel, M.; Dombradi, Zs.; Engert, T.; Eppinger, K.; Farrelly, G. F.; Farinon, F.; Farnea, E.; Geissel, H.; Gerl, J.; Goel, N.; Gregor, E.; Habermann, T.; Hoischen, R.; Janik, R.; Klupp, S.; Kojouharov, I.; Kurz, N.; Mandal, S.; Menegazzo, R.; Mengoni, D.; Napoli, D. R.; Naqvi, F.; Nociforo, C.; Prochazka, A.; Prokopowicz, W.; Recchia, F.; Ribas, R. V.; Reed, M. W.; Rudolph, D.; Sahin, E.; Schaffner, H.; Sharma, A.; Sitar, B.; Siwal, D.; Steiger, K.; Strmen, P.; Swan, T. P. D.; Szarka, I.; Ur, C. A.; Walker, P. M.; Wollersheim, H.-J.

    2014-01-01

    The fragmentation of relativistic uranium projectiles has been exploited at the Gesellschaft für Schwerionenforschung laboratory to investigate the β decay of neutron-rich nuclei just beyond 208Pb. This paper reports on β-delayed γ decays of 211-213Tl, 215Pb, and 215-219Bi de-exciting states in the daughters 211-213Pb, 215Bi, and 215-219Po. The resulting partial level schemes, proposed with the help of systematics and shell-model calculations, are presented. The role of allowed Gamow-Teller and first-forbidden β transitions in this mass region is discussed.

  20. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LESG Sbjct: 1 ... LIASEFTYKKEEEIYGEDEPSEYVYQVVSGAVRSYKLLSDGRRQIGAFYLPGDVFGLESG 60 ... Query: 156 MERVANFLLEMDRRLA...VAGMMALPMCRRDIGDYLGLTLETVSRALSQLQSKGILGFSGAR 215 ... MERVANFLLEMDRRLAVAGMM...ALPMCRRDIGDYLGLTLETVSRALSQLQSKGILGFSGAR Sbjct: 121 MERVANFLLEMDRRLAVAGMMALPMCRRDIGDYLGLTLETVSRALSQLQSKGILGFSGAR 180 ...

  1. ORF Alignment: NC_002578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ion ... factor 6 (aIF-6) ... Length = 215 ... Query: 1 ... MIRKTSVLRSNFIGIYAKAWDDVAFITMMADEKTVADFQE...VLQVDVRRISIDNSSLIGTM 60 ... MIRKTSVLRSNFIGIYAKAWDDVAFITMMADEKTVADFQEVLQVDV...RRISIDNSSLIGTM Sbjct: 1 ... MIRKTSVLRSNFIGIYAKAWDDVAFITMMADEKTVADFQEVLQVDVRRISIDNSSLIGTM 60 ... Query: 121 EIEDTL

  2. β -decay studies of neutron-rich Tl, Pb, and Bi isotopes

    OpenAIRE

    Morales, A. I.; Benzoni, G.; Gottardo, A.; Valiente-Dobon, J. J.; Blasi, N.; Bracco, A.; Camera, F.; Crespi, F. C. L.; Corsi, A.; Leoni, S.; Million, B.; Nicolini, R.; Wieland, O.; Gadea, A.; Lunardi, S.

    2014-01-01

    The fragmentation of relativistic uranium projectiles has been exploited at the Gesellschaft für Schwerionenforschung laboratory to investigate the β decay of neutron-rich nuclei just beyond 208Pb. This paper reports on β-delayed γ decays of 211–213Tl, 215Pb, and 215–219Bi de-exciting states in the daughters 211–213Pb, 215Bi, and 215–219Po. The resulting partial level schemes, proposed with the help of systematics and shell-model calculations, are presented. The role of allowed Gamow-Teller a...

  3. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  4. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  5. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.

    2016-03-09

    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  6. Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

    Directory of Open Access Journals (Sweden)

    Jaspreet Singh Jaggi

    2007-03-01

    Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

  7. Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

    2011-03-15

    Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

  8. Review of radionuclide source terms used for performance-assessment analyses; Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Barnard, R.W.

    1993-06-01

    Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ``uranium`` and 4n+3 ``actinium`` decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides.

  9. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  10. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  11. Measurements of gamma radiation levels and spectra in the San Francisco Bay Area

    Science.gov (United States)

    Lo, B. T.; Brozek, K. P.; Angell, C. T.; Norman, E. B.

    2011-10-01

    Much of the radiation received by an average person is emitted by naturally-occurring radioactive isotopes from the thorium, actinium, and uranium decay series, or potassium. In this study, we have measured gamma radiation levels at various locations in the San Francisco Bay Area and the UC Berkeley campus from spectra taken using an ORTEC NOMAD portable data acquisition system and a large-volume coaxial HPGe detector. We have identified a large number of gamma rays originating from natural sources. The most noticeable isotopes are 214Bi, 40K, and 208Tl. We have observed variations in counting rates by factors of two to five between different locations due to differences in local conditions - such as building, concrete, grass, and soil compositions. In addition, in a number of outdoor locations, we have observed 604-, 662-, and 795-keV gamma rays from 134,137Cs, which we attribute to fallout from the recent Fukushima reactor accident. The implications of these results will be discussed. This work was supported in part by a grant from the U. S. Dept. of Homeland Security.

  12. Rapid Column Extraction Method for Actinides and Sr-89/90 in Water Samples

    Energy Technology Data Exchange (ETDEWEB)

    MAXWELL III, SHERROD L.

    2005-06-15

    The SRS Environmental Laboratory analyzes water samples for environmental monitoring, including river water and ground water samples. A new, faster actinide and strontium 89/90 separation method has been developed and implemented to improve productivity, reduce labor costs and add capacity to this laboratory. This method uses stacked TEVA Resin{reg_sign}, TRU Resin{reg_sign} and Sr-Resin{reg_sign} cartridges from Eichrom Technologies (Darien, IL, USA) that allows the rapid separation of plutonium (Pu), neptunium (Np), uranium (U), americium (Am), curium (Cm) and thorium (Th) using a single multi-stage column combined with alpha spectrometry. By using vacuum box cartridge technology with rapid flow rates, sample preparation time is minimized. The method can be used for routine analysis or as a rapid method for emergency preparedness. Thorium and curium are often analyzed separately due to the interference of the daughter of Th-229 tracer, actinium (Ac)-225, on curium isotopes when measured by alpha spectrometry. This new method also adds a separation step using DGA Resin{reg_sign}, (Diglycolamide Resin, Eichrom Technologies) to remove Ac-225 and allow the separation and analysis of thorium isotopes and curium isotopes at the same time.

  13. Development of ion beam sputtering techniques for actinide target preparation

    Science.gov (United States)

    Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

    1985-06-01

    Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

  14. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  15. 76 FR 58424 - Transmission Relay Loadability Reliability Standard

    Science.gov (United States)

    2011-09-21

    ... is determined on the basis of the transformer's design and the maintenance of that capability by the... section 215 of the Federal Power Act, the Commission proposes to approve Reliability Standard PRC-023-2... INFORMATION: Notice of Proposed Rulemaking September 15, 2011. 1. Pursuant to section 215 of the Federal Power...

  16. 40 CFR 282.83 - North Carolina State-Administered Program.

    Science.gov (United States)

    2010-07-01

    ... and hazardous substance abatement § 143-215.94Joint and several liability § 143-215.94FLimited amnesty...) “Attorney General's Statement for Final Approval”, signed by the State Attorney General on January 5, 1998... program under subtitle I of RCRA, 42 U.S.C. 6991 et seq. (ii) Letter from the Attorney General of North...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 215 of 215 ... Vol 26, No 4 (2014), Toxic metal levels in Nigerian electronic waste workers indicate occupational metal toxicity associated with crude electronic waste management practices, Abstract PDF. Godwin O. Igharo, John I. Anetor, Oladele O. Osibanjo, Humphrey B. Osadolor, Kingsley C. Dike. Vol 17, No 2 ...

  18. 10 CFR 434.518 - Service water heating.

    Science.gov (United States)

    2010-01-01

    ... Consumption as were used in calculating the Energy Cost Budget. Table 518.1.1—Service Hot water Quantities Building type Btu/person-hour 1 Assembly 215 Office 175 Retail 135 Warehouse 225 School 215 Hotel/Motel...

  19. Gclust Server: 154150 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 154150 Gox_GOX2616 Cluster Sequences - 215 DotI 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0...elated sequences - Sequence length 215 Representative annotation DotI Number of Sequences 1 Homologs 1 Clust

  20. Ultraviolet absorption spectra and kinetics of CH3S and CH2SH radicals

    DEFF Research Database (Denmark)

    Anastasi, C.; Broomfield, M.; Nielsen, O.J.

    1991-01-01

    The ultraviolet absorption spectra of CH3S and CH2SH radicals have been measured between 215 and 380 nm using the pulse-radiolysis/kinetic-absorption method. One absorption band between 250 and 300 nm and one around 215 nm have been tentatively assigned to the CH2SH and CH3S radicals, respectively...

  1. Gclust Server: 53645 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Pst_PSPTO_B0071 Cluster Sequences - 215 surface exclusion protein, putative 2 1.00e-80 0.0 0.0 0.0 0.0 3...length 215 Representative annotation surface exclusion protein, putative Number of Sequences 2 Homologs

  2. Drug: D06125 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06125 Drug Tiamenidine (USAN/INN); Symcor base TTS (TN) C8H10ClN3S 215.0284 215.7031 D06125.gif Antihyperte...nsive CAS: 31428-61-2 PubChem: 47207783 LigandBox: D06125 NIKKAJI: J20.515J ATOM 13

  3. 78 FR 28785 - Defense Federal Acquisition Regulation Supplement: Only One Offer-Further Implementation (DFARS...

    Science.gov (United States)

    2013-05-16

    ..., overlap, or conflict with any other Federal rules. There are no known significant alternatives to the rule... or pricing data required for negotiation is covered in FAR 15.4 and associated clauses in FAR 52.215...--CONTRACTING BY NEGOTIATION 0 3. Amend section 215.371-3 by-- 0 a. In paragraph (a), removing ``at one level...

  4. 77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

    Science.gov (United States)

    2012-12-31

    ... CONFLICTS OF INTEREST 0 3. Section 203.1003 is revised to read as follows: 203.1003 Requirements. (b...--CONTRACTING BY NEGOTIATION 215.403-1 0 7. Section 215.403-1 paragraph (c)(4)(B) is amended by removing ``DPAP...

  5. 78 FR 13544 - Defense Federal Acquisition Regulation Supplement: Acquisition of Tents and Other Temporary...

    Science.gov (United States)

    2013-02-28

    ... rule does not duplicate, overlap, or conflict with any other Federal rules. DoD did not identify any...--CONTRACTING BY NEGOTIATION 0 2. Subpart 215.1 is added to read as follows: Subpart 215.1--Source Selection...

  6. 75 FR 57776 - Clean Water Act Section 303(d): Notice for the Public Review of the Draft Total Maximum Daily...

    Science.gov (United States)

    2010-09-22

    ... person at EPA Region III, 1650 Arch Street, Philadelphia, PA 19103 with proper arrangements made in... Street, Philadelphia, PA 19103; telephone number: (215) 814-5766; fax number: (215) 814-2318; e-mail: R3... Grafton Theatre, James Madison University, 281 Warren Service Drive, Harrisonburg, VA. Tuesday, October 5...

  7. Remediation Trends in an Undergraduate Anatomy Course and Assessment of an Anatomy Supplemental Study Skills Course

    Science.gov (United States)

    Schutte, Audra Faye

    2013-01-01

    Anatomy A215: Basic Human Anatomy (Anat A215) is an undergraduate human anatomy course at Indiana University Bloomington (IUB) that serves as a requirement for many degree programs at IUB. The difficulty of the course, coupled with pressure to achieve grades for admittance into specific programs, has resulted in high remediation rates. In an…

  8. EST Table: CK516660 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK516660 rswjb0_004566.y1 11/12/09 n.h 10/09/29 71 %/215 aa ref|XP_968436.2| PREDICTED: similar to best... %/176 aa gnl|Amel|GB16861-PA 10/09/10 71 %/215 aa gi|189235903|ref|XP_968436.2| PREDICTED: similar to bes

  9. Dicty_cDB: CHQ876 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iltered library (LibID: 215) Hordeum vulgare genomic, ge... map 5515173-5817331 strain AX4, complete sequence. 66 2e-06 1 CZ886621 |CZ886621.1 215_2_12315608_3_37715_062 Barley methylation unf

  10. 76 FR 79529 - Community Reinvestment Act Regulations

    Science.gov (United States)

    2011-12-22

    .... FOR FURTHER INFORMATION CONTACT: OCC: Margaret Hesse, Special Counsel, Community and Consumer Law... subsequently amended its CRA regulation to reflect this transfer of supervision authority.\\3\\ \\1\\ Public Law... follows: Authority: 12 U.S.C. 21, 22, 26, 27, 30, 36, 93a, 161, 215, 215a, 481, 1814, 1816, 1828(c), 1835a...

  11. 77 FR 75521 - Community Reinvestment Act Regulations

    Science.gov (United States)

    2012-12-21

    ..., 2013. FOR FURTHER INFORMATION CONTACT: OCC: Margaret Hesse, Special Counsel, Community and Consumer Law... supervision authority.\\3\\ \\1\\ Public Law 111-203, 124 Stat. 1376 (2010). \\2\\ See OCC interim final rule, 76 FR..., 26, 27, 30, 36, 93a, 161, 215, 215a, 481, 1814, 1816, 1828(c), 1835a, 2901 through 2908, and 3101...

  12. NCBI nr-aa BLAST: CBRC-MEUG-01-1725 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1725 ref|YP_002831676.1| major facilitator superfamily MFS_1 [Sulfolobus island...icus L.S.2.15] gb|ACP35031.1| major facilitator superfamily MFS_1 [Sulfolobus islandicus L.S.2.15] YP_002831676.1 0.78 28% ...

  13. 32 CFR 21.330 - How are the DoDGARs published and maintained?

    Science.gov (United States)

    2010-07-01

    ..., and sections, to parallel the CFR publication. Cross references within the DoD document are stated as CFR citations (e.g., a reference to section 21.215 in part 21 would be to 32 CFR 21.215), which also...

  14. Effect of Sleep on the Central Nervous System.

    Science.gov (United States)

    1981-03-30

    Kleitman, N. (1967) Sleep and Wakefulness. P. 215. The University of Chicago Press , Chicago. 2. Tarozzi, G. Sull’influenze dell’insonnio sperimentale...developpee au cours d’une veille prolongee. C. R. Soc. Biol. 72:274-75, 1912. 203, 215, 352. 11. Peters, A. The fixation of central nervous tissue and the

  15. 32 CFR 552.86 - References.

    Science.gov (United States)

    2010-07-01

    ... (Natural Resources—Land, Forest, and Wildlife Management). (d) FL Reg 215-1 (Hunting, Fishing, and Trapping). (e) FL Reg 350-30 (I Corps and Fort Lewis Range Regulations). (f) DA Form 1594 (Daily Staff Journal...

  16. Impact of Kansas Ethanol Production on Kansas Transportation

    Science.gov (United States)

    2009-10-01

    The rapid expansion of the biofuel industry has driven the Kansas agricultural transportation market into a new era. Nationally, fuel alcohol production increased 452 percent in the 2000-2008 period. The number of ethanol production plants rose 215 p...

  17. 76 FR 3884 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2011-01-21

    ...: David Drucker, 301-415-6223. EIS No. 20110013, Final EIS, NPS, VA, Cedar Creek and Belle Grove National... Period Ends: 02/22/ 2011, Contact: Peter Iris-Williams, 215-597-6479. EIS No. 20110014, Draft EIS, USFS...

  18. South African Journal of Higher Education - Vol 25, No 2 (2011)

    African Journals Online (AJOL)

    Speaking truth to power: Understanding education research and the educational turn in South Africa's new century · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. RJ Balfour, R Moletsane, J Karlsson, 195–215 ...

  19. Heterozygous Deletion in Exons 4-5 of SHOX Gene in a Patient Diagnosed as Idiopathic Short Stature

    Directory of Open Access Journals (Sweden)

    David Anna

    2017-09-01

    Full Text Available Introduction: Isolated Short Stature Homeobox (SHOX gene haploinsufficiency can be found in 2-15% of individuals diagnosed with idiopathic short stature determining different skeletal phenotypes.

  20. La investigación social aplicada en redes sociales. Una innovación metodológica para el análisis de los «Me gusta» en Facebook/Social research applied to social networks. A methodological innovation for the analysis of Facebook Likes

    National Research Council Canada - National Science Library

    P Parra; A J Gordo; S A D'Antonio

    2014-01-01

    .... This study is based on quantitative and qualitative tools: a short online survey questionnaire made accessible through Facebook, which allows the obtaining of quantitative primary data, and the qualitative analysis of the Facebook Likes (215,232...

  1. MUAUV - MicroAUV. Preliminary System Design Document. Version 2

    National Research Council Canada - National Science Library

    Cranney, John

    2001-01-01

    ... (range per pound mass of vehicle) over currently fielded systems. Specifically, the authors target a 2-15 lb MicroAUV that can demonstrate a 20 nautical mile per pound mass specific range capability...

  2. An Evaluation of the Poverty Reduction Impact of the Non ...

    African Journals Online (AJOL)

    contributory old age pension scheme. This paper investigated the impact of the old age pension on poverty reduction among 215 beneficiaries and their families in Manonyane, Maama Constituency. Results of the analysis revealed that both ...

  3. USA terrorismivastane seadus ja jälitustegevuse erivolitused / Piibe Jõgi

    Index Scriptorium Estoniae

    Jõgi, Piibe, 1969-

    2007-01-01

    24. okt. 2001 Ameerika Ühendriikides vastu võetud terrorismivastase seaduse (nn USA Patriot Act) paragrahvist 215, mis käsitleb andmete salajast kogumist ja paragrahvist 213 salajaste läbiotsimisite kohta

  4. 75 FR 25238 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2010-05-07

    ..., Brunswick, ME, Comment Period Ends: 06/28/2010, Contact: Thomas H. Stephan, 215-897-4916. EIS No. 20100163.... EIS No. 20100164, Draft EIS, BLM, 00, Southern California Edison's Eldorado-Ivanpah Transmission Line...

  5. 76 FR 6430 - Takes of Marine Mammals Incidental to Specified Activities; Marine Geophysical Survey in the...

    Science.gov (United States)

    2011-02-04

    ... stationed on the observation platform, the PSVO's eye level will be approximately 21.5 m (71 ft) above sea... pods and seven to 12 km by more sensitive resting pods of cow-calf pairs. Avoidance distances with...

  6. South African Journal for Research in Sport, Physical Education and ...

    African Journals Online (AJOL)

    Leisure negotiation strategies scale: a study of validity and reliability for university students · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T Yerlisu-Lapa, 201-215 ...

  7. The training needs of Turkish emergency department personnel regarding intimate partner violence

    National Research Council Canada - National Science Library

    Aksan, H Asli Davas; Aksu, Feride

    2007-01-01

    .... A cross-sectional study was conducted in a large university hospital via questionnaire. The study population consisted of all the nurses and physicians who worked in the ED during a two month period (n = 215...

  8. Strengthening the Army-Industry Dialogue on Defense Cooperation and Trade

    Science.gov (United States)

    1990-11-01

    Office Organization ........ 2-15 LMI Recommendations .............................. 2-16 Chapter 3. Industry Recommendations on Defense Exports and...arrangements for advance notification and involvement of their industries prior to source selection. Program Management Office Organization With respect to the

  9. Lunnyu soils in the Lake Victoria basin of Uganda: Link to ...

    African Journals Online (AJOL)

    EJIRO

    1Department of Forest Biology and Ecosystems Management, Faculty of Forestry and Nature Conservation, ... average annual temperature is 21.5°C (Komutunga and Musiitwa, ...... storage prediction in temperate hydromorphic soils using a.

  10. Nearshore marine fish assemblages in southern California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish benthic trawls were completed by the Southern California Coastal Water Research Project (SCCWRP). Data from 425 fisheries independent trawls ranging from 2-215...

  11. Teachers’ individual action theories about competence-based education: the value of the cognitive apprenticeship model

    NARCIS (Netherlands)

    Seezink, Audrey; Poell, Rob; Kirschner, Paul A.

    2009-01-01

    Seezink, A., Poell, R. F., & Kirschner, P. A. (2009). Teachers' individual action theories about competence-based education: The value of the cognitive apprenticeship model. Journal of Vocational Education & Training, 61, 203-215.

  12. Hearing and Speech at Seven

    Science.gov (United States)

    Sheridan, Mary D.; Peckham, Catherine S.

    1973-01-01

    Evaluated for social and educational aspects at 7 years of age were 133 children with moderate hearing loss, 46 children with severe unilateral hearing loss, and 215 children with normal hearing but with unintelligible speech. (DB)

  13. Profile of nonsurgical root canal treatment under the National Health Insurance in Taiwan in 2006

    Directory of Open Access Journals (Sweden)

    Wing-Hong Lai

    2009-12-01

    Conclusion: The overall NSRCT rate per 1000 patients was 215.1 teeth, the incidence of NSRCT increased with the age of the patients, and the frequency of canine treatment increased with the age of patients.

  14. Identification of zygotic and nucellar seedlings in citrus interspecific ...

    African Journals Online (AJOL)

    ajl yemi

    2011-12-19

    . Genet. Mol. Biol. 21: 123-127. Bornet B, Branchard M (2001). Nonanchored inter simple sequence repeat (ISSR) markers: reproducible and specific tools for genome fingerprinting. Plant Mol. Biol. Rep. 19:209-215. Cameron ...

  15. 77 FR 2680 - Defense Federal Acquisition Regulation Supplement; Definition of Cost or Pricing Data

    Science.gov (United States)

    2012-01-19

    .... The rule does not duplicate, overlap, or conflict with any other Federal rules. No known significant...--CONTRACTING BY NEGOTIATION 3. Section 215.403 is amended by revising the section heading to read as follows...

  16. 48 CFR 237.7204 - Format and clauses for educational service agreements.

    Science.gov (United States)

    2010-10-01

    ...-2, Audit and Records—Negotiation. 6. FAR 52.215-8, Order of Precedence—Uniform Contract Format. 7. Conflicts Between Agreement and Catalog. Insert the following clause: Conflicts Between Agreement and...

  17. 48 CFR 815.304-70 - Evaluation factor commitments.

    Science.gov (United States)

    2010-10-01

    ... in selecting offers for award; (3) Use the proposed inclusion of SDVOSBs or VOSBs as subcontractors... an SDVOSB or VOSB subcontractor in accordance with 852.215-70, Service-Disabled Veteran-Owned and...

  18. Monitoring the levels of toxic air pollutants in the ambient air of ...

    African Journals Online (AJOL)

    user

    Key words: Air pollution, polycyclic aromatic hydrocarbons, suspended particulate matter, carbon monoxide, .... 215 Switzerland), in a water bath at temperature of 55°C and pressure of 180 Torr. ...... Texas, USA, Atmos. Environ., 35: ...

  19. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  20. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...