
Sample records for actinium 212

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    International Nuclear Information System (INIS)

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. 48 CFR 212.212 - Computer software. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Computer software. 212.212... Acquisition of Commercial Items 212.212 Computer software. (1) Departments and agencies shall identify and... technology development), opportunities for the use of commercial computer software and other...

  4. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Spectroscopic and computational investigation of actinium coordination chemistry. (United States)

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J


    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  6. Discovery of the actinium, thorium, protactinium, and uranium isotopes


    Fry, C; Thoennessen, M


    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources. (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R


    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  8. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    International Nuclear Information System (INIS)

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    International Nuclear Information System (INIS)

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Comment: 212 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Oryzias javanicus Oryzias javanicus Oryzias_javanicus_L.png 212.png Kiyoshi Naruse ...(National Institute for Basic Biology) licensed under CC Attribution2.1 Japan ジャワメダカ (Oryzias javanicus) インド

  12. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    International Nuclear Information System (INIS)

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  13. A new method for the determination of low-level actinium-227 in geological samples

    International Nuclear Information System (INIS)

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  14. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  16. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    International Nuclear Information System (INIS)

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  17. 25 CFR 212.20 - Leasing procedures. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Leasing procedures. 212.20 Section 212.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF ALLOTTED LANDS FOR MINERAL DEVELOPMENT How To Acquire Leases § 212.20 Leasing procedures. (a) Application for leases shall...

  18. 22 CFR 212.21 - Public records. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public records. 212.21 Section 212.21 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Availability of Information for Public Inspection and Copying § 212.21 Public records. In accordance with this subpart, USAID makes the...

  19. 28 CFR 36.212 - Insurance. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Insurance. 36.212 Section 36.212 Judicial... COMMERCIAL FACILITIES General Requirements § 36.212 Insurance. (a) This part shall not be construed to... benefit plan that is not subject to State laws that regulate insurance. (b) Paragraphs (a) (1), (2),...

  20. 12 CFR 741.212 - Share insurance. (United States)


    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Share insurance. 741.212 Section 741.212 Banks... INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.212 Share insurance. (a)...

  1. 32 CFR 212.5 - Responsibilities. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 212.5 Section 212.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS...) INSTALLATIONS § 212.5 Responsibilities. (a) The Principal Deputy Under Secretary for Personnel and...

  2. 48 CFR 36.212 - Preconstruction orientation. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Preconstruction orientation. 36.212 Section 36.212 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Contracting for Construction 36.212 Preconstruction orientation. (a) The contracting officer will inform...

  3. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL (United States)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  4. Dicty_cDB: SSI212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI212 (Link to dictyBase) - - - Contig-U16354-1 SSI212E (Link... to Original site) - - - - - - SSI212E 608 Show SSI212 Library SS (Link to library) Clone ID SSI212 (Link Representative seq. ID SSI21...2E (Link to Original site) Representative DNA sequence >SSI212 (SSI212Q) /CSM/SS/SSI2-A/SSI212Q.Seq.d/ TTGTT... E Sequences producing significant alignments: (bits) Value SSI212 (SSI212Q) /CSM/SS/SSI2-A/SSI212Q.Seq.d/ 1

  5. 48 CFR 871.212 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 871.212... Rehabilitation and Employment Service 871.212 Contract clauses. Contracting officers must use the following clauses, as appropriate, in solicitations and contracts for vocational rehabilitation and...

  6. 32 CFR 212.4 - Policy. (United States)


    ....4 Policy. It is DoD policy, consistent with 32 CFR part 213, that procedures be established for the... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 212.4 Section 212.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PROCEDURES...

  7. 31 CFR 800.212 - Foreign entity. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign entity. 800.212 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.212 Foreign entity. (a) The term foreign entity means any... corporation, or organization organized under the laws of a foreign state if either its principal place...

  8. 36 CFR 212.3 - Cooperative work. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperative work. 212.3... MANAGEMENT Administration of the Forest Transportation System § 212.3 Cooperative work. (a) Cooperative... for expenditure from the appropriation “Cooperative Work, Forest Service.” If a State, county or...

  9. 36 CFR 2.12 - Audio disturbances. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Audio disturbances. 2.12... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.12 Audio disturbances. (a) The following are prohibited..., motorized toy, or an audio device, such as a radio, television set, tape deck or musical instrument, in...

  10. 40 CFR 86.212-94 - [Reserved (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.212-94 Section 86.212-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  11. Dicty_cDB: SSG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG212 (Link to dictyBase) - - - Contig-U09907-1 SSG212E (Link to Original site) SS...G212F 593 SSG212Z 678 SSG212P 1271 SSG212E 1008 Show SSG212 Library SS (Link to library) Clone ID SS...ginal site URL Representative seq. ID SS...G212E (Link to Original site) Representative DNA sequence >SSG212 (SSG212Q) /CSM/SS/SSG2-A/SS...qnqpkdyycpmdlinh*yhyqklldhftfltlvfn*lrlq flkl*ihssfvmdlvkklqre*fqnqlkrcfsii*fnhlkkilsqtlfhlwvvplplnil lmlnq*iklmtvact*fkmnklfilihss

  12. 48 CFR 12.212 - Computer software. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Computer software. 12.212... software. (a) Commercial computer software or commercial computer software documentation shall be acquired... required to— (1) Furnish technical information related to commercial computer software or...

  13. 48 CFR 212.207 - Contract type. (United States)


    ... OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the Acquisition of Commercial Items 212.207 Contract type. b) In accordance with Section 805 of the National... contracts for the acquisition of commercial items is authorized only for the following: (i)...

  14. Development and Testing of a 212Pb/212Bi Peptide for Targeting Metastatic Melanoma

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, Darrell R.


    The purpose of this project is to develop a new radiolabeled peptide for imaging and treating metastatic melanoma. The immunoconjugate consists of a receptor-specific peptide that targets melanoma cells. The beta-emitter lead-212 (half-life = 10.4 hours) is linked by coordination chemistry to the peptide. After injection, the peptide targets melanoma receptors on the surfaces of melanoma cells. Lead-212 decays to the alpha-emitter bismuth-212 (half-life = 60 minutes). Alpha-particles that hit melanoma cell nuclei are likely to kill the melanoma cell. For cancer cell imaging, the lead-212 is replaced by lead-203 (half-life = 52 hours). Lead-203 emits 279 keV photons (80.1% abundance) that can be imaged and measured for biodistribution analysis, cancer imaging, and quantitative dosimetry.

  15. Synthesis and evaluation of tetraphosphonates labelled with 212Bi, 212Pb and 165Er

    International Nuclear Information System (INIS)

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. 212Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a α-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to 153Sm-EDTMP, which is now formally approved in several countries, most recently in the US. 212Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the α-emitter, although loss of some of the in vivo generated 212Bi may be a problem. A generator has been developed for the production of the α-emitting radionuclide 212Bi and its parent nuclide 212Pb. The generator is based on the emanation of 220Rn from (228Th)barium stearate. The decay product of 220Rn, 212Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety

  16. 49 CFR 195.212 - Bending of pipe. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Bending of pipe. 195.212 Section 195.212... PIPELINE Construction § 195.212 Bending of pipe. (a) Pipe must not have a wrinkle bend. (b) Each field bend must comply with the following: (1) A bend must not impair the serviceability of the pipe. (2)...

  17. 7 CFR 1400.212 - Growers of hybrid seed. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Growers of hybrid seed. 1400.212 Section 1400.212... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Eligibility § 1400.212 Growers of hybrid seed. The existence of a hybrid seed contract for a person or legal entity will not be taken into...

  18. 46 CFR 179.212 - Watertight bulkheads for subdivision. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Watertight bulkheads for subdivision. 179.212 Section 179.212 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) SUBDIVISION, DAMAGE STABILITY, AND WATERTIGHT INTEGRITY Subdivision and Damage Stability Requirements § 179.212...

  19. 5 CFR 179.212 - Procedures for salary offset. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Procedures for salary offset. 179.212 Section 179.212 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.212 Procedures for salary offset. (a) The Director or his or...

  20. 22 CFR 212.11 - Materials to be published. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Materials to be published. 212.11 Section 212... Federal Register § 212.11 Materials to be published. (a) USAID separately states and currently publishes... section. (b) USAID Public Notice No. 1 and the USAID Regulations published in chapter II of Title 22...

  1. 25 CFR 212.56 - Geological and geophysical permits. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Geological and geophysical permits. 212.56 Section 212.56... FOR MINERAL DEVELOPMENT Rents, Royalties, Cancellations, and Appeals § 212.56 Geological and geophysical permits. (a) Permits to conduct geological and geophysical operations on Indian lands which do...

  2. 10 CFR 212.78 - Tertiary incentive crude oil. (United States)


    ... 10 Energy 3 2010-01-01 2010-01-01 false Tertiary incentive crude oil. 212.78 Section 212.78 Energy DEPARTMENT OF ENERGY OIL MANDATORY PETROLEUM PRICE REGULATIONS Producers of Crude Oil § 212.78 Tertiary incentive crude oil. Annual prepaid expenses report. By January 31 of each year after 1980, the...

  3. 48 CFR 212.602 - Streamlined evaluation of offers. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Streamlined evaluation of offers. 212.602 Section 212.602 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... for Evaluation and Solicitation for Commercial Items 212.602 Streamlined evaluation of offers....

  4. 27 CFR 24.212 - High fermentation wine. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false High fermentation wine. 24.212 Section 24.212 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.212 High fermentation wine. High fermentation wine is wine...

  5. 45 CFR 212.7 - Repayment to the United States. (United States)


    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Repayment to the United States. 212.7 Section 212... UNITED STATES CITIZENS RETURNED FROM FOREIGN COUNTRIES § 212.7 Repayment to the United States. (a) An..., any or all of the cost of such assistance to the United States, except insofar as it is...

  6. 40 CFR 211.212 - Compliance audit testing. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance audit testing. 211.212 Section 211.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.212 Compliance audit testing....

  7. 12 CFR 212.4 - Interlocking relationships permitted by statute. (United States)


    .... 212.4 Section 212.4 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MANAGEMENT OFFICIAL INTERLOCKS § 212.4 Interlocking relationships permitted by statute. The... subsidiary thereof: (a) A depository organization that has been placed formally in liquidation, or which...

  8. The chemical fate of 212Bi-DOTA formed by β- decay of 212Pb(DOTA)2-

    International Nuclear Information System (INIS)

    The increasing use of inert metal complexes in radioimmunotherapy prompted us to explore the potential use of 212Pb chelates. Herein, we report a study of the chemical fate of the 212Bi-DOTA complex formed by β- decay of 212Pb(DOTA)2-(H4DOTA = 1,4,7,10-tetraazacyclododecanetetraacetic acid). To assure that both parent and daughter complexes were thermally stable, kinetic studies were performed with 203Pb(II) and 206Bi(III) which showed that both lead and bismuth complexes with DOTA undergo chemical exchange only very slowly in aqueous solution at pH 4-10. To investigate whether the complex ion which results from decay of 212Pb(DOTA)2- was intact and also stable, solutions initially containing only this ion were analyzed for amounts of DOTA-complexed and uncomplexed 212Bi after attaining transient equilibrium with 212Bi. The fraction of 212Bi radioactivity not complexed to DOTA, vide infra, was found to be 36±2%. This value represents the fraction of breakup of 212Bi(DOTA)- formed from β- decay of the parent complex. By considering the various extranuclear processes responsible for kinetic and electronic excitation of the 212Bi daughter, break-up of the 212Bi-DOTA complex is ascribed to the internal conversion of γ-rays emitted by the excited 212Bi nuclide. (orig.)

  9. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  10. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    International Nuclear Information System (INIS)

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  11. 212-Angstrom neonlike zinc laser of LULI (United States)

    Jamelot, Gerard; Jaegle, Pierre; Rus, Bedrich; Carillon, Antoine; Klisnick, Annie; Nantel, Marc; Sebban, Stephane; Albert, F.; Zeitoun, Philippe; Plankl, E.; Sirgand, A.; Lewis, Ciaran L. S.; MacPhee, Andrew G.; Tallents, Gregory J.; Krishnan, J.; Holden, M.


    The main feature of x-ray laser research at LULI is the development of a saturated laser at 212 angstrom with a relatively small pump laser of 0.4 kJ in 600 ps. The laser works with the 3p- 3s J equals O yields 1 transition of neon-like zinc, by using the double-pass of amplified radiation in the active medium. Plasma parameters (temperature, density, homogeneity), and x-ray laser emission properties (intensity, pointing angle, divergence, and coherence) have been studied. Lasing action needs the main laser pulse to be preceded by a ten-prepulse train (contrast ratio less than 103) due to the remnant oscillator. The effect of a single prepulse was investigated as a function of contrast ratio and delay between the prepulse and the main pulse.

  12. 14 CFR 221.212 - Special tariff permission. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Special tariff permission. 221.212 Section... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.212 Special tariff permission. (a) When a filer submits an electronic tariff or an amendment to an electronic tariff for which...

  13. 22 CFR 1203.735-212 - Wearing of uniforms. (United States)


    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Wearing of uniforms. 1203.735-212 Section 1203.735-212 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE... employees are not considered uniforms within the meaning of this section except that, for ICA, MOA VII...

  14. 42 CFR 1002.212 - State agency notifications. (United States)


    ... 42 Public Health 5 2010-10-01 2010-10-01 false State agency notifications. 1002.212 Section 1002.212 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG... agency notifications. When the State agency initiates an exclusion under § 1002.210, it must provide...

  15. 33 CFR 160.212 - When to submit an NOA. (United States)


    ...) Vessels carrying break bulk cargo operating under a USCS exemption granted under 19 CFR 4.7(b)(4)(ii) may... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false When to submit an NOA. 160.212... Conditions, and Certain Dangerous Cargos § 160.212 When to submit an NOA. (a) Submission of NOA. (1)...

  16. 48 CFR 212.7003 - Technical data and computer software. (United States)


    ... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a...

  17. 14 CFR 212.6 - Operation of gambling junket charters. (United States)


    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS CHARTER RULES FOR U.S. AND FOREIGN DIRECT AIR CARRIERS § 212.6..., hotel, or cruise line or its agents, from requiring prospective passengers to pay nominal...

  18. Dicty_cDB: AFO212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO212 (Link to dictyBase) - - - Contig-U10734-1 AFO212Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  19. Dicty_cDB: CHR212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR212 (Link to dictyBase) - - - Contig-U10972-1 | Contig-U131... library) Clone ID CHR212 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U109...72-1 | Contig-U13146-1 Original site URL FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT

  20. Synthesis and evaluation of tetraphosphonates labelled with {sup 212}Bi, {sup 212}Pb and {sup 165}Er

    Energy Technology Data Exchange (ETDEWEB)

    Hassfjell, S.P


    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. {sup 212}Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a {alpha}-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to {sup 153}Sm-EDTMP, which is now formally approved in several countries, most recently in the US. {sup 212}Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the {alpha}-emitter, although loss of some of the in vivo generated {sup 212}Bi may be a problem. A generator has been developed for the production of the {alpha}-emitting radionuclide {sup 212}Bi and its parent nuclide {sup 212}Pb. The generator is based on the emanation of {sup 220}Rn from ({sup 228}Th)barium stearate. The decay product of {sup 220}Rn, {sup 212}Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety.

  1. Atmospheric concentrations of 212Pb and an observation of 212Pb originating from the 2000 eruptive activity of Miyake-jima volcano, at Kawasaki, Japan

    International Nuclear Information System (INIS)

    Atmospheric concentrations of 212Pb were observed with aerosol samples during the period from June, 1999 to December, 2000 at Kawasaki. The atmospheric concentrations of 212Pb ranged from 20 to 130 mBq/m3. Seasonal variations in 212Pb concentration showed the ''one-peak'' variation pattern: high concentrations appeared in winter season. The atmospheric concentration of 212Pb and SO2 after the eruption of Miyake-jima volcano on Aug. 29, 2000 were higher than average value in the season. After the eruption, the variation in the concentration of SO2 correlates with that of 212Pb. The atmospheric concentration of 212Pb showed an unusual and temporal increase in the period from late August to early September, 2000, being inferred to be attributed partly to the 212Pb fallout originating from the 2000 eruption of Miyake jima volcano, Japan. (author)

  2. 48 CFR 14.212 - Economic purchase quantities (supplies). (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Economic purchase... REGULATION CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.212 Economic purchase quantities (supplies). Contracting officers shall comply with the economic purchase...

  3. 26 CFR 1.212-1 - Nontrade or nonbusiness expenses. (United States)


    ... nonbusiness expenses. (a) An expense may be deducted under section 212 only if: (1) It has been paid or... ordinary and necessary expense for any of the purposes stated in subparagraph (1) of this paragraph. (b... at a profit or will otherwise be productive of income and even though the property is held merely...

  4. 34 CFR 668.212 - Loan servicing appeals. (United States)


    ... identifies a sample that is large enough to derive an estimate, acceptable at a 95 percent confidence level... EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cohort Default Rates § 668.212 Loan... Program lender or the Direct Loan Servicer, as defined in 34 CFR 685.102, failed to perform one or more...

  5. Dicty_cDB: VHB212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB212 (Link to dictyBase) - - - Contig-U16430-1 - (Link to Original site) ... mRNA f... 84 1e-15 DQ383787_1( DQ383787 |pid:none) Rhodomonas ... salina 82 kDa heat shoc... 83 3e-15 ( P08238 ) Rec ...

  6. 48 CFR 52.212-2 - Evaluation-Commercial Items. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation-Commercial....212-2 Evaluation—Commercial Items. As prescribed in 12.301(c), the Contracting Officer may insert a provision substantially as follows: Evaluation—Commercial Items (JAN 1999) (a) The Government will award...

  7. 9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease...

  8. Free radical detection by means of 212Pb mirrors

    International Nuclear Information System (INIS)

    Radicals have been detected at low temperatures (550-700 degree centigrade) in the thermal decomposition of dimethyl and methyl-ethyl-ketone by the Paneth method. the sensitivity of the method has been increased by the use of radioactive mirrors of PB212. They have proved to detect one radical among 2.106 molecules. (Author) 18 refs

  9. 31 CFR 0.212 - Influencing legislation or petitioning Congress. (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Influencing legislation or... DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.212 Influencing legislation or... Congress to favor or oppose any legislation. This prohibition does not apply to the official...

  10. Study of in vivo generators Pb-212/Bi--212 and U-230/Th-226 for alpha radioimmunotherapy

    International Nuclear Information System (INIS)

    Alpha-radioimmunotherapy is a promising cancer therapy that uses a-particles vectorized by monoclonal antibody to break down cancerous tumors. The notion of in vivo generator was introduced in 1989 by Leonard Mausner. The concept involves labeling of various molecular carriers (antibodies, peptides, etc) with intermediate half-life generator parents, which after accumulation in the desired tissue generate much shorter half-life daughter radionuclide. This thesis focuses on the study of two in vivo generators potentially interesting for alpha-radioimmunotherapy: Pb-212 / Bi-212 generator and U-230 / Th-226 generator. The first part of this work presents the Pb-212 / Bi-212 generator, two approaches allowing the vectorization. Chelation approach on a protein and an approach by encapsulation in liposomes have been proposed. This last approach appears to be the most interesting. In vitro stability studies have been performed on these labeling. The second part of this work presents the U-230 / Th-226 generator. Studies have first been made to achieve a theoretical model to describe the speciation of Th(IV) in human serum. The efficacy of DTPA as chelating agent for complexation of Th(IV) in human serum could thus be estimated. (author)

  11. Tl-208, Pb-212, Bi-212, Ra-226 and Ac-228 adsorption onto polyhydroxyethylmethacrylate-bentonite composite

    International Nuclear Information System (INIS)

    The adsorption of naturally occurring radionuclides (208Tl+, 212Pb2+, 226Ra2+, 212Bi3+ and 228Ac3+) onto Polyhydroxyethylmethacrylate-bentonite (PHEMA-B) composite was investigated. Experimentally obtained isotherms were evaluated with reference to Langmuir, Freundlich and Dubinin-Radushkevich (DR) models. The adsorption isotherms were L type of Giles classification proving that PHEMA-B had a high affinity adsorbent for the studied radionuclides. The Langmuir adsorption capacities (XL) were in the order of 226Ra (2.8 MBq kg-1)>212Bi (0.4 MBq kg-1)>212Pb (0.3 MBq kg-1)>228Ac and 208Tl (0.2 MBq kg-1). The adsorption process was physical via complex formation after proton exchanger for which the adsorption energies obtained from DR model was evidence. The enthalpy and entropy changes were positive and the negative free enthalpy change was proof for the spontaneity of adsorption. The reusability tests for PHEMA-B for five uses demonstrated that the adsorbent could be reused after complete recovery of the loaded radionuclide ions by 1 M HCl. The chemical structure of the composite did not change after the reuses and storage foregoing.

  12. 5 CFR 875.212 - Is there a minimum application age? (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Is there a minimum application age? 875.212 Section 875.212 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL LONG TERM CARE INSURANCE PROGRAM Eligibility § 875.212 Is there a...

  13. 8 CFR 212.5 - Parole of aliens into the United States. (United States)


    ... or her parole status terminated upon notice, as specified in 8 CFR 212.5(e)(2)(i), if he or she makes... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Parole of aliens into the United States. 212.5 Section 212.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION...

  14. 31 CFR 585.212 - Prohibited transactions related to scientific and technical cooperation, cultural exchanges, and... (United States)


    ... scientific and technical cooperation, cultural exchanges, and other official visits. 585.212 Section 585.212... § 585.212 Prohibited transactions related to scientific and technical cooperation, cultural exchanges....S. person related to scientific and technical cooperation and cultural exchanges involving...

  15. 36 CFR 212.7 - Access procurement by the United States. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Access procurement by the United States. 212.7 Section 212.7 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE TRAVEL MANAGEMENT Administration of the Forest Transportation System § 212.7 Access procurement...

  16. 40 CFR 180.212 - S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. 180.212 Section 180.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Tolerances § 180.212 S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. (a) General....

  17. 40 CFR 80.212 - What requirements apply to oxygenate blenders? (United States)


    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false What requirements apply to oxygenate blenders? 80.212 Section 80.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR....212 What requirements apply to oxygenate blenders? Effective January 1, 2004, oxygenate blenders...

  18. (212)Pb as tracer for PM deposition on urban vegetation. (United States)

    Voltaggio, Mario; Spadoni, Massimo; Carloni, Serena; Guglietta, Daniela


    (212)Pb concentration in outdoor air is closely correlated with fine suspended particulate matter in the atmosphere. Thanks to this association, this isotope can be used to trace the sinking processes of particulate matter due to the vegetation, also providing accurate estimations of the deposition velocity on foliar surfaces. This approach is particularly effective in areas with high thoron fluxes and, consequently, high (212)Pb fluxes from soil. The contribution of vegetation to the improvement of air quality (AQImp) in the municipality area (MA) of Rome (Latium, Italy), almost entirely located on Th-enriched volcanic soils, was estimated by studying (212)Pb deposition velocity on the grasses (0.9-2.5mm·s(-1)) and on the most common tree classes, namely conifers (1.5-15mm·s(-1)), evergreen (1-4mm·s(-1)) and deciduous (0.2-1.5mm·s(-1)). (212)Pb activity in outdoor air was determined by gamma spectrometry after air pumping with accumulation on cellulose filters and after collection on artificial electrostatically charged surfaces (ECS). The high (212)Pb activity values obtained from this analysis (0.90±0.6Bqm(-3) and 0.58±0.15Bqm(-3), respectively near and far from the soil) are consistent both with the average regional thoron flux from volcanic soils (2.9·10(4)Bqm(-2)·h(-1)) and with the thoron flux measured in the volcanic soils of the study area. Thoron and (212)Pb fluxes were also measured both in laboratory and in the field under different soil moisture conditions. The total AQImp for the period from September 2014 to September 2015, calculated after the classification of the MA of Rome into six classes of vegetation, provided a value of 0.20 corresponding to 2.3 Tons per day of removed PM10. The role of grasslands in the PM10 removal, the contribution of the vegetation to the improvement of AQImp and the possibility of improving the sinking efficiency of green areas by increasing conifer trees coverage were also highlighted. PMID:27323332

  19. Preparation of radionuclide 212Pb by emanation technique of 232Th

    International Nuclear Information System (INIS)

    The paper is focused on preparation of radionuclide 212Pb for its further application. 212Pb radioisotope has radiogenic origin of a series of 232Th. The given radionuclide 212Pb (10.6 h) was captured from Th-source on niobium emmanator shims by influence of electric field at a voltage of 310 V. 212Pb was then eluted from the shims to dilute solution of HNO3. 212Pb thus prepared in this way was then applied at radioindicator study of adsorption processes of clay rocks - bentonites.

  20. Tribological and mechanical comparison of sintered and hipped PM212: High temperature self-lubricating composites (United States)

    Dellacorte, Christopher; Sliney, Harold E.; Bogdanski, Michael S.


    Selected tribological, mechanical and thermophysical properties of two versions of PM212 (sintered and hot isostatically pressed, HIPped) are compared. PM212, a high temperature self-lubricating composite, contains 70 wt percent metal bonded chromium carbide, 15 wt percent CaF2/BaF2 eutectic and 15 wt percent silver. PM212 in the sintered form is about 80 percent dense and has previously been shown to have good tribological properties from room temperature to 850 C. Tribological results of a fully densified, HIPped version of PM212 are given. They are compared to sintered PM212. In addition, selected mechanical and thermophysical properties of both types of PM212 are discussed and related to the tribological similarities and differences between the two PM212 composites. In general, both composites display similar friction and wear properties. However, the fully dense PM212 HIPped composite exhibits slight lower friction and wear than sintered PM212. This may be attributed to its generally higher strength properties. The sintered version displays stable wear properties over a wide load range indicating its promise for use in a variety of applications. Based upon their properties, both the sintered and HIPped PM212 have potential as bearing and seal materials for advanced high temperature applications.

  1. Quality control of the tribological coating PS212 (United States)

    Sliney, Harold E.; Dellacorte, Christopher; Deadmore, Daniel L.


    PS212 is a self-lubricating, composite coating that is applied by the plasma spray process. It is a functional lubricating coating from 25 C (or lower) to 900 C. The coating is prepared from a blend of three different powders with very dissimilar properties. Therefore, the final chemical composition and lubricating effectiveness of the coatings are very sensitive to the process variables used in their preparation. Defined here are the relevant variables. The process and analytical procedures that will result in satisfactory tribological coatings are discussed.

  2. Alpha Decay Width of $^{212}$Po from a quartetting wave function approach

    CERN Document Server

    Xu, Chang; Röpke, G; Schuck, P; Funaki, Y; Horiuchi, H; Tohsaki, A; Yamada, T; Zhou, Bo


    A microscopic calculation of $\\alpha$-cluster preformation probability and $\\alpha$ decay width in the typical $\\alpha$ emitter $^{212}$Po is presented. Results are obtained by improving a recent approach to describe $\\alpha$ preformation in $^{212}$Po [Phys. Rev. C 90, 034304 (2014)] implementing four-nucleon correlations (quartetting). Using the actually measured density distribution of the $^{208}$ Pb core, the calculated alpha decay width of $^{212}$Po agrees fairly well with the measured one.

  3. 222Rn and 212Pb exposures at a Brazilian SPA

    International Nuclear Information System (INIS)

    Termas de Araxa spa is located in Araxa, State of Minas Gerais. In this region, several minerals rich in uranium and thorium are found. The mineral waters and mud from Termas de Araxa spa have been used for therapeutic and recreation purposes. In this study, the committed effective dose was evaluated for workers and patients at Araxa spa due to 222Rn and 212Pb inhalation. Radon measurements were carried out through the passive method with solid state nuclear track detectors (Makrofol E) over a period of 21 months, with results varying from 258 ± 20 to 1634 ± 111 Bq m-3. The 212Pb air concentration was assessed through the modified Kusnetz's method, the results varying from 0.3 ± 0.1 to 2.1 ± 0.2 Bq m-3. Doses received by the spa workers are below 20 mSv y-1, suggested by ICRP 60 as an annual effective dose limit for occupational exposure. The radiation doses for the patients are below the mean annual effective dose due to natural sources estimated to be 2.4 mSv.y-1. (authors)

  4. Tracking of activity of major daughter products (212Bi, 212Pb and 228Ac) in Thorium ore with time in a hermetically sealed container

    International Nuclear Information System (INIS)

    During this work activities of 212Bi, 212 Pb and 228Ac were tracked at different time intervals for 30 days in hermetically sealed closed container. IAEA-RGTh-1 reference materials having 2.89% Th with floated silica powder of similar grain size distribution ( 232Th in the composite sample (ore) is 3250 ± 270 Bq kg-1. Gamma measurement was carried on a high-purity p-type germanium (HPGe) detector having a relative efficiency of 50%. Data obtained during this work clearly shows that there is only minor variation in the concentration of 212Bi, 212Pb and 228Ac from the time of sealing to 30th day. Mean concentration of 232Th evaluated using gamma energy line of 228Ac (912 keV) and 212Bi (728 keV) shows a deviation of only 0.05%, and 5.66% respectively from the certified mean value of 232Th, whereas a large negative deviation of 29.9% was observed in the case of 212Pb (239 keV). (author)

  5. 7 CFR 330.212 - Movement of plant pests by baggage. (United States)


    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests by baggage. 330.212 Section... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.212 Movement of plant pests by...

  6. 23 CFR 972.212 - Federal lands safety management system (SMS). (United States)


    ... inspection and copying as prescribed at 49 CFR part 7. (c) The FWS shall utilize the SMS to ensure that... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 972.212....212 Federal lands safety management system (SMS). In addition to the requirements provided in §...

  7. 23 CFR 973.212 - Indian lands safety management system (SMS). (United States)


    ... inspection and copying as prescribed at 49 CFR part 7. (d) The BIA and ITGs shall utilize the SMSs to ensure... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands safety management system (SMS). 973.212... PROGRAM Bureau of Indian Affairs Management Systems § 973.212 Indian lands safety management system...

  8. 25 CFR 212.46 - Inspection of premises, books, and accounts. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books, and accounts. 212.46 Section 212.46 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF... premises, books, and accounts. The provisions of § 211.46 of this subchapter are applicable to leases...

  9. 30 CFR 212.200 - Maintenance of and access to records. (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Maintenance of and access to records. 212.200 Section 212.200 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... prices. (3) Costs of mining, processing, handling, and transportation....

  10. 21 CFR 212.10 - What personnel and resources must I have? (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What personnel and resources must I have? 212.10 Section 212.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... a sufficient number of personnel with the necessary education, background, training, and...

  11. 18 CFR 157.212 - Synthetic and liquefied natural gas facilities. (United States)


    ... natural gas facilities. 157.212 Section 157.212 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES... 7 OF THE NATURAL GAS ACT Interstate Pipeline Blanket Certificates and Authorization Under Section...

  12. 20 CFR 702.212 - Notice; when given; when given for certain occupational diseases. (United States)


    ...). (b) In the case of an occupational disease which does not immediately result in disability or death... employment, the disease and the death or disability. For purposes of these occupational diseases, therefore... occupational diseases. 702.212 Section 702.212 Employees' Benefits EMPLOYMENT STANDARDS...

  13. 49 CFR 180.212 - Repair of seamless DOT 3-series specification cylinders and seamless UN pressure receptacles. (United States)


    ... cylinders and seamless UN pressure receptacles. 180.212 Section 180.212 Transportation Other Regulations... Qualification, Maintenance and Use of Cylinders § 180.212 Repair of seamless DOT 3-series specification cylinders and seamless UN pressure receptacles. (a) General requirements for repair of DOT...

  14. Novel gene PUS3 c.A212G mutation in Ukrainian family with intellectual disability

    Directory of Open Access Journals (Sweden)

    Gulkovskyi R. V.


    Full Text Available Aim. To evaluate a possible role of a novel c.A212G substitution in the PUS3 gene at intellectual disability (ID. Methods. The observed group consisted of the ID Ukrainian family members (parents and two affected children and the control group – of 300 healthy individuals from general population of Ukraine. Sanger sequencing of the PUS3 gene exon 1 was performed for the family members. Polymorphic variants of c.A212G were analyzed using ARMS PCR. The homology models of wild type and p.Y71C mutant catalytic domains of human Pus3 were generated using the crystal structure of the human Pus1 catalytic domain (PDB ID: 4NZ6 as a template. Results. It was shown that the father of the affected siblings was the c.A212G substitution heterozygous carrier whereas the mother was a wild type allele homozygote, and the exom sequencing result was confirmed – the affected children are 212G homozygotes. We supposed de novo mutation in the maternal germ line. A low frequency of 212G allele (0.0017 was shown in the population of Ukraine. Homology modelling of the wild type and p.Y71C mutant catalytic domain of human Pus3 revealed that substitution p.Y71C is located in close proximity to its active site. Conclusions. The absence of hypoproteinemia in our patients, homozygous for the 212C allele allows us to assume that the mutation c.A212G PUS3 is rather neutral and cannot be the major cause of ID. However, considering a low frequency of the 212G allele in the population and close localization of p.Y71C substitution to the active site of hPus3 we cannot exclude that the c.A212G mutation in PUS3 may be a modifier for some pathologies including syndromic ID.

  15. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6Al-4V components of a Stirling engine space power system (United States)

    Sliney, Harold E.; Lukaszewicz, Victor; Dellacorte, Christopher


    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6Al-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is the possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'back-up', self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212-coated Ti6-4, and PS212-coated Ti6-4/PM212.

  16. α -decay width of 212Po from a quartetting wave function approach (United States)

    Xu, Chang; Ren, Zhongzhou; Röpke, G.; Schuck, P.; Funaki, Y.; Horiuchi, H.; Tohsaki, A.; Yamada, T.; Zhou, Bo


    A microscopic calculation of α -cluster preformation probability and α -decay width in the typical α emitter 212Po is presented. Results are obtained by improving a recent approach to describe α preformation in 212Po [Phys. Rev. C 90, 034304 (2014), 10.1103/PhysRevC.90.034304] implementing four-nucleon correlations (quartetting). Using the actually measured density distribution of the 208Pb core, the calculated α -decay width of 212Po agrees fairly well with the measured one.

  17. 5 CFR 575.212 - Internal monitoring requirements and revocation or suspension of authority. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Internal monitoring requirements and... MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, RELOCATION, AND RETENTION INCENTIVES; SUPERVISORY DIFFERENTIALS; AND EXTENDED ASSIGNMENT INCENTIVES Relocation Incentives § 575.212 Internal...

  18. Tacrolimus for myasthenia gravis: a clinical study of 212 patients. (United States)

    Ponseti, José M; Gamez, Josep; Azem, Jamal; López-Cano, Manuel; Vilallonga, Ramón; Armengol, Manuel


    Tacrolimus is a macrolide T cell immunomodulator that is used in myasthenia gravis (MG) patients to affect muscle contraction (ryanodine receptor by modulating intracellular calcium-release channels and increasing muscular strength), glucocorticoid receptors (increasing intracellular concentration of steroids and blocking the steroid export mechanism), and an increase in T cell apoptosis. In this study, we report the results of low-dose tacrolimus (0.1 mg/kg/day) treatment in 212 MG patients. There were 110 thymectomized, cyclosporine- and prednisone-dependent patients; 68 thymectomized patients who started tacrolimus early postoperatively (24 h after operation); and 34 patients over 60 years old with nonthymomatous generalized MG or in whom thymectomy was contraindicated. The mean follow-up time was 49.3 +/- 18.1 months. Muscular strength showed an increase of 23% after 1 month of treatment and 29% at the end of the study. The acetylcholine receptor antibodies decreased significantly from a mean of 33.5 nmol/L at base line to 7.8 nmol/L at the final visit. In the thymectomy group with combined prednisone and tacrolimus stratified by histology of the thymus, the mean probability to attain complete stable remission at 5 years was 80.8% in patients with hyperplasia, 48.1% in thymic involution, and 9.3% in patients with thymoma. In 4.9% of patients, tacrolimus was withdrawn because of major adverse effects. Our results suggest that a low dose of tacrolimus is effective for MG and could be included to the armamentarium for this autoimmune disease. The present results should be interpreted considering the limitations of a retrospective clinical study. Confirmation of these results in randomized studies is desirable. PMID:18096852

  19. Spectroscopy of high spin states in sup(211,212,213)Fr

    International Nuclear Information System (INIS)

    The level structures of 211Fr, 212Fr and 213Fr have been observed to high spins, approx. 28(h/2π) (and excitation energies approx. 8 MeV) using a variety of gamma-ray spectroscopic techniques. The structure of these nuclides is discussed in terms of couplings of single particle states through empirical shell model calculations. Good agreement with experiment is obtained. In 212Fr and 213Fr core-excited configurations are required to explain the properties of the highest states. A number of long lived states were observed in each nucleus some of which decay by by enhanced E3 transitions. The E3 transition strengths are discussed

  20. 22 CFR 212.41 - Exemptions from publication and disclosure requirements of subparts B, C, and D. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exemptions from publication and disclosure requirements of subparts B, C, and D. 212.41 Section 212.41 Foreign Relations AGENCY FOR INTERNATIONAL... privacy; (4) Could reasonably be expected to disclose the identity of a confidential source, including...

  1. 48 CFR 212.504 - Applicability of certain laws to subcontracts for the acquisition of commercial items. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to subcontracts for the acquisition of commercial items. 212.504 Section 212.504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL...

  2. 48 CFR 212.503 - Applicability of certain laws to executive agency contracts for the acquisition of commercial items. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to executive agency contracts for the acquisition of commercial items. 212.503 Section 212.503 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF...

  3. 48 CFR 212.570 - Applicability of certain laws to contracts and subcontracts for the acquisition of commercially... (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to contracts and subcontracts for the acquisition of commercially available off-the-shelf items. 212.570 Section 212.570 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION...

  4. 25 CFR 212.42 - Annual rentals and expenditures for development on leases other than oil and gas, and geothermal... (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Annual rentals and expenditures for development on leases other than oil and gas, and geothermal resources. 212.42 Section 212.42 Indians BUREAU OF INDIAN AFFAIRS... other than oil and gas, and geothermal resources. The provisions of § 211.42 of this subchapter...

  5. 20 CFR 30.212 - How does a claimant establish that the employee contracted cancer after beginning employment at a... (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How does a claimant establish that the employee contracted cancer after beginning employment at a DOE facility, an atomic weapons employer facility or a RECA section 5 facility? 30.212 Section 30.212 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS, DEPARTMENT OF LABOR...

  6. Tribological properties of PM212 - A high temperature, self-lubricating, powder metallurgy composite (United States)

    Dellacorte, Christopher; Sliney, Harold E.


    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  7. Tribological properties of PM212: A high-temperature, self-lubricating, powder metallurgy composite (United States)

    Dellacorte, Christopher; Sliney, Harold E.


    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  8. The sl(2|1)(2) Gaudin magnet with diagonal boundary terms

    International Nuclear Information System (INIS)

    This work is concerned with the quasi-classical limit of the boundary quantum inverse scattering method for the twisted sl(2|1)(2) vertex model with diagonal K-matrices. In this limit Gaudin's Hamiltonians with diagonal boundary terms are presented and diagonalized

  9. 10 CFR 72.212 - Conditions of general license issued under § 72.210. (United States)


    ... INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE General License for Storage of Spent Fuel at Power Reactor Sites § 72.212 Conditions of... general license is limited to storage of spent fuel in casks approved under the provisions of this...

  10. 23 CFR 970.212 - Federal lands safety management system (SMS). (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 970.212... Federal lands safety management system (SMS). In addition to the requirements provided in § 970.204, the SMS must meet the following requirements: (a) The NPS shall have an SMS for all transportation...

  11. 23 CFR 971.212 - Federal lands safety management system (SMS). (United States)


    ... available for inspection and copying as prescribed at 49 CFR part 7. (c) The tri-party partnership shall... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 971.212... lands safety management system (SMS). In addition to the requirements provided in § 971.204, the...

  12. 21 CFR 212.2 - What is current good manufacturing practice for PET drugs? (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What is current good manufacturing practice for... HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR POSITRON EMISSION TOMOGRAPHY DRUGS (Eff. 12-12-2011) General Provisions § 212.2 What is current good manufacturing practice...

  13. 27 CFR 25.212 - Beer returned to brewery from which removed. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.212 Beer returned to brewery from which removed. If beer on which the tax has been determined or paid is returned...

  14. 8 CFR 212.15 - Certificates for foreign health care workers. (United States)


    ... perform labor in the United States as an occupational or physical therapist must obtain the following... language proficiency testing. (3) Physical therapists. An alien physical therapist who has graduated from a... section, if 8 CFR 212.1 requires an alien who is described in paragraph (a) of this section and who...

  15. 19 CFR 212.07 - Rulemaking on maximum rates for attorney fees. (United States)


    ....07 Section 212.07 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT General Provisions... conduct any rulemaking proceedings for this purpose under the informal rulemaking procedures of...

  16. Half-life of 214Po and 212Po measured with CTF at LNGS

    International Nuclear Information System (INIS)

    Polonium isotopes 214Po and 212Po are part of the 238U and 232Th decay chains, respectively. There exist only a few measurements of these two mean lifetimes with precision better than one or two percent. Since we have been studying decay spectra of 214Bi and 212Bi with the purpose of experimentally constraining anti-neutrino spectral shape important for geoneutrino studies, we have a large statistics of decays of 214Po and 212Po collected with the Counting Test Facility (CTF), which was operational in the underground I.N.F.N. Gran Sasso National Laboratory. The apparatus consisted of an external cylindrical water tank (diameter ∼ 11 m, high ∼ 10 m; ∼ 1000 tons of water) serving as passive shielding for 4.8 m3 of liquid organic scintillator contained in an inner spherical vessel with a diameter of ∼ 2 m. The inner vessel was realized with a nylon membrane (∼ 500 ?m thick), with excellent optical clarity, which allowed the effective transmission of the scintillation light to the 100 phototubes (PMTs) forming the optical read-out, anchored on a 7 m diameter support structure inside the water tank. The high purity and low background in CTF allows a favourable signal to background ratio for these measurements. More specifically the ratio of signal to background of the present measurements is more than three orders of magnitude larger than the best existing measurements. We have studied the decays of 214Po into 210Pb and of 212Po into 208Pb tagged by the coincidence with the previously decays from 214Bi and 212Bi by using 222Rn, 232Th and 220Rn sources sealed inside quartz vials and inserted in the CTF

  17. Microwave sintering of ZrO2-12 mol% CeO2

    International Nuclear Information System (INIS)

    Sintering of ZrO2-12 mol% CeO2 was accelerated by microwave processing at 2.45 GHz as compared with conventional firing. However, the size of the ''microwave effect'' was significantly smaller than that which was previously observed for microwave sintering of ZrO2-8 mol% Y2O3. The difference in the effect that the microwave field had on the two zirconia systems is interpreted in terms of their ionic conductivities

  18. Examination results of the Three Mile Island radiation detector HP-R-212

    International Nuclear Information System (INIS)

    Area radiation detector HP-R-212 was removed from the Three Mile Island containment building on November 13, 1981. The detector apparently started to fail during November 1979 and by the first part of December 1979 the detector readings had degraded from 1 R/hr to 20 mR/hr. This report discusses the cause of failure, detector radiation measurement characteristics, and our estimates of the total gamma radiation dose received by the detector electronics

  19. Metallothionein bioconjugates as delivery vehicles for bismuth-212 alpha particle therapy

    International Nuclear Information System (INIS)

    Metallothioneins (MTHs) are small cysteine-rich polypeptides that binds cationic metals at physiologic pH ranges through noncovalent -SH ligand interactions. Some leucine-rich renal MTHs have a particular avidity for bismuth. The authors have examined the ability of MTHs to selectively incorporate Bi-212, a short-lived high-energy alpha particle emitter currently under exploration as a potential therapeutic radiolabel for use in molecularly targeted cancer therapy. They find that under physiologic conditions, MTH will selectively incorporate Bi-212 after incubation with an equilibrium mixture of its upstream and downstream parents. The MTH moieties may be linked to tumor-binding macromolecules such as antibodies via thiolation reactions using SPDP, and the resultant Bismuth-avid molecules may be used either as primary delivery vehicles for the Bi-212 or as part of a 2-step release-and-catch isotope localization system in which the MTH-antibody conjugate is pre-localized at the tumor site and the radiometal is then administered and chelated in situ. They present the chemistry, dosimetry and potential clinical applications of this system

  20. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong-Kook [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Henry, Jon C. [Department of Surgery, Ohio State University, Columbus, OH 43210 (United States); Jiang, Jinmai [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Esau, Christine [Regulus Therapeutics, Carlsbad, CA (United States); Gusev, Yuriy [Lombardi Cancer Center, Georgetown University, Washington, DC (United States); Lerner, Megan R. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Postier, Russell G. [Department of Surgery, University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States); Brackett, Daniel J. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Schmittgen, Thomas D., E-mail: [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States)


    Research highlights: {yields} The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. {yields} miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. {yields} miR-132 and miR-212 expression is increased by a {beta}2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G{sub 2}/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the {beta}2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The {beta}2 adrenergic pathway may play an important role in this novel mechanism.

  1. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    International Nuclear Information System (INIS)

    Research highlights: → The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. → miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. → miR-132 and miR-212 expression is increased by a β2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G2/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the β2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The β2 adrenergic pathway may play an important role in this novel mechanism.

  2. SU-C-201-05: Imaging 212Pb-TCMC-Trastuzumab for Alpha Radioimmunotherapy for Ovarian Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Shen, S; Meredith, R; Azure, M; Yoder, D [University of Alabama, Birmingham, AL (United States); Torgue, J; Banaga, E [AREVA Med LLC, Bethesda, MD (United States)


    Purpose: To support the phase I trial for toxicity, biodistribution and pharmacokinetics of intra-peritoneal (IP) 212Pb-TCMC-trastuzumab in patients with HER-2 expressing malignancy. A whole body gamma camera imaging method was developed for estimating amount of 212Pb-TCMC-trastuzumab left in the peritoneal cavity. Methods: {sup 212}Pb decays to {sup 212}Bi via beta emission. {sup 212}Bi emits an alpha particle at an average of 6.1 MeV. The 238.6 keV gamma ray with a 43.6% yield can be exploited for imaging. Initial phantom was made of saline bags with 212Pb. Images were collected for 238.6 keV with a medium energy general purpose collimator. There are other high energy gamma emissions (e.g. 511keV, 8%; 583 keV, 31%) that penetrate the septae of the collimator and contribute scatter into 238.6 keV. An upper scatter window was used for scatter correction for these high energy gammas. Results: A small source containing 212Pb can be easily visualized. Scatter correction on images of a small 212Pb source resulted in a ∼50% reduction in the full width at tenth maximum (FWTM), while change in full width at half maximum (FWHM) was <10%. For photopeak images, substantial scatter around phantom source extended to > 5 cm outside; scatter correction improved image contrast by removing this scatter around the sources. Patient imaging, in the 1st cohort (n=3) showed little redistribution of 212Pb-TCMC-trastuzumab out of the peritoneal cavity. Compared to the early post-treatment images, the 18-hour post-injection images illustrated the shift to more uniform anterior/posterior abdominal distribution and the loss of intensity due to radioactive decay. Conclusion: Use of medium energy collimator, 15% width of 238.6 keV photopeak, and a 7.5% upper scatter window is adequate for quantification of 212Pb radioactivity inside peritoneal cavity for alpha radioimmunotherapy of ovarian cancer. Research Support: AREVA Med, NIH 1UL1RR025777-01.

  3. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6A1-4V components of a Stirling engine space power system (United States)

    Sliney, Harold E.; Dellacorte, Christopher; Lukaszewicz, Victor


    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6A1-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is a possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'backup,' self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212 coated Ti6-4, and Ps212 coated Ti6-4/PM212

  4. Recombinant protein of heptad-repeat HR212, a stable fusion inhibitor with potent anti-HIV action in vitro

    International Nuclear Information System (INIS)

    HR212, a recombinant protein expressed in Escherichia coli, has been previously reported to inhibit HIV-1 membrane fusion at low nanomolar level. Here we report that HR212 is effective in blocking laboratory strain HIV-1IIIB entry and replication with EC50 values of 3.92 ± 0.62 and 6.59 ± 1.74 nM, respectively, and inhibiting infection by clinic isolate HIV-1KM018 with EC50 values of 44.44 ± 10.20 nM, as well as suppressing HIV-1-induced cytopathic effect with an EC50 value of 3.04 ± 1.20 nM. It also inhibited HIV-2ROD and HIV-2CBL-20 entry and replication in the μM range. Notably, HR212 was highly effective against T20-resistant strains with EC50 values ranging from 5.09 to 7.75 nM. Unlike T20, HR212 showed stability sufficient to inhibit syncytia formation in a time-of-addition assay, and was insensitive to proteinase K digestion. These results suggest that HR212 has great potential to be further developed as novel HIV-1 fusion inhibitor for treatment of HIV/AIDS patients, particularly for those infected by T20-resistant variants

  5. An evaluation of the membership probability of 212 $\\lambda$ Boo stars: I. A Catalogue

    CERN Document Server

    Murphy, Simon J; Gray, Richard O; Cheng, Kwang-Ping; Neff, James E; Koen, Chris; Kuehn, Charles A; Newsome, Ian; Riggs, Quinlin


    The literature on the $\\lambda$ Boo stars has grown to become somewhat heterogenous, as different authors have applied different criteria across the UV, optical and infrared regions to determine the membership status of $\\lambda$ Boo candidates. We aim to clear up the confusion by consulting the literature on 212 objects that have been considered as $\\lambda$ Boo candidates, and subsequently evaluating the evidence in favour of their admission to the $\\lambda$ Boo class. We obtained new spectra of $\\sim$90 of these candidates and classified them on the MK system to aid in the membership evaluations. The re-evaluation of the 212 objects resulted in 64 members and 103 non-members of the $\\lambda$ Boo class, with a further 45 stars for which membership status is unclear. We suggest observations for each of the stars in the latter category that will allow them to be confidently included or rejected from the class. Our reclassification facilitates homogenous analysis on group members, and represents the largest co...

  6. Water and acetaldehyde in HH212: The first hot corino in Orion

    CERN Document Server

    Codella, C; Cabrit, S; Podio, L; Bachiller, R; Fontani, F; Gusdorf, A; Lefloch, B; Leurini, S; Tafalla, M


    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH$_3$CHO and deuterated water (HDO) high-excitation ($E_{\\rm u}$ up to 335 K) lines towards the Sun-like protostar HH212--MM1. Results: For the first time, we have obtained images of CH$_3$CHO and HDO emission in the inner $\\simeq$ 100 AU of HH212. The multifrequency line analysis allows us to contrain the density ($\\geq$ 10$^{7}$ cm$^{-3}$), temperature ($\\simeq$ 100 K), and CH$_3$CHO abundance ($\\simeq$ 0.2--2 $\\times$ 10$^{-9}$) of the emitting region. The HDO profile is asymmetric at low velocities ($\\leq$ 2 km s$^{-1}$ from $V_{\\rm sys}$). If the HDO line is optically thick, this points to an extremely small ($\\sim$ 20--40 AU) and dense ($\\ge$ 10$^{9}$ cm$^{-3}$) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymm...

  7. Water and acetaldehyde in HH212: The first hot corino in Orion (United States)

    Codella, C.; Ceccarelli, C.; Cabrit, S.; Gueth, F.; Podio, L.; Bachiller, R.; Fontani, F.; Gusdorf, A.; Lefloch, B.; Leurini, S.; Tafalla, M.


    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH3CHO and deuterated water (HDO) high-excitation (Eu up to 335 K) lines towards the Sun-like protostar HH212-MM1. Results: For the first time, we have obtained images of CH3CHO and HDO emission in the inner ≃100 AU of HH212. The multifrequency line analysis allows us to contrain the density (≥107 cm-3), temperature (≃100 K), and CH3CHO abundance (≃0.2-2 × 10-9) of the emitting region. The HDO profile is asymmetric at low velocities (≤2 km s-1 from Vsys). If the HDO line is optically thick, this points to an extremely small (~20-40 AU) and dense (≥109 cm-3) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymmetric profile indicates a contribution of outflowing gas from the compact central region, possibly associated with a dense disk wind.

  8. Deuterated formaldehyde in HH212: physics and chemistry of a typical protostar (United States)

    Sahu, Dipen; Chakrabarti, Sandip Kumar; Minh, Young Chol


    HH212 is a nearby (400 pc) source in Orion. Recent observation (Codella et al., 2014) with ALMA using 24 no. of 12 m antenna revealed the source with high angular resolution and sensitivity (HPBW=0.65arc × 0.47 arc, σ - 3 to 4 mJy/beam/0.43 km s^-1) than previous SMA observation (Lee et al., 2007). This allows observations of several molecular lines e.g., SO, SO^2, C^{17}O, CO, and SiO. Emissions from these species probe different regions of this young stellar object, e.g., the outflow, the molecular jet, the envelop and the disk. The source might be the Class 0 protostellar system with a Keplerian disc and collimated bipolar SiO jets. Physics and chemistry of this region are very interesting. No deuterated molecule has been reported in this source except the recent report of deuterated water, HDO (Codella et al., 2016). Here, we report the HDCO (deuterated formaldehyde) line observation from ALMA data to probe the inner region of HH212. We compare HDCO line with other molecular lines to explain the possible chemistry and physics of the source, and also discussed the deuterium enrichment of molecular species.

  9. Effective chelators for 90Y and 212Bi radioimmunotherapy of cancer

    International Nuclear Information System (INIS)

    Advances in synthesis and evaluation of monoclonal antibody (mAb)-ligand bioconjugates are required to further use of 90Y, 212Bi labeled mAb in cancer therapy. The authors have used ligand 1B4M-DTPA for preparation of 90Y-mAb-anti-TAC for an ongoing clinical trial of treatment of adult T-cell leukemia. Good results have been obtained in that of 10 evaluable patients, two are in complete remission 1 yr after initiation of therapy and six experienced partial remissions. Radiochemical dose was limited by marrow suppression, leading the authors to suspect that some 90Y was reaching bone. For this reason, they have prepared ultra-pure 88Y and thereafter 88Y-mAb conjugates with bifunctional DOTA and CHX-DTPA ligands which they have measured to be thermodynamically stronger for yttrium than the 1B4M ligand. The CHX ligand has also been useful for 212Bi-leukemia therapy in mice

  10. Multiepoch Radio Observations of the Exciting Sources of HH 212 and HH 119

    Directory of Open Access Journals (Sweden)

    R. Galván Madrid


    Full Text Available Presentamos observaciones de alta resolución angular (- 0.``3 hechas con el Very Large Array a 3.5 cm hacia las regiones de las fuentes excitadoras de dos sistemas Herbig-Haro: HH 212 en Orión y HH 119 en B335. Las observaciones fueron hechas durante tres épocas diferentes con el objetivo de medir posibles variaciones temporales rápidas (en la escala de una semana a un mes en las fuentes. En HH 212 detectamos, promediando las observaciones de las tres épocas, una fuente muy débil justo en la posición esperada para la fuente excitadora del sistema HH. La comparación con otras observaciones de radio de esta fuente indica variación temporal considerable en escala de años. En B335 detectamos en cada época al objeto previamente reportado por otros autores y nuestros resultados sugieren que esta fuente, un chorro térmico de radio, es variable en escalas de tiempo de un mes. Discutimos posibles explicaciones para esta rápida variabilidad.

  11. Expression and modulation of nerve growth factor in murine keratinocytes (PAM 212)

    International Nuclear Information System (INIS)

    Nerve growth factor (NGF) is a polypeptide that is required for normal development and maintenance of the sympathetic and sensory nervous systems. Skin has been shown to contain relatively high amounts of NGF, which is in keeping with the finding that the quantity of NGF in a tissue is proportional to the extent of sympathetic innervation of that organ. Since the keratinocyte, a major cellular constituent of the skin, is known to produce other growth factors and cytokines, our experiments were designed to determine whether keratinocytes are a source of NGF. Keratinocyte-conditioned media from the keratinocyte cell line PAM 212 contained NGF-like activity, approximately 2-3 ng/ml, as detected by the neurite outgrowth assay. Freshly isolated BALB/c keratinocytes contained approximately 0.1 ng/ml. Using a cDNA probe directed against NGF, we demonstrated the presence of a 1.3-kb NGF mRNA in both PAM 212 and BALB/c keratinocytes. Since ultraviolet radiation (UV) is a potentially important modulating factor for cytokines in skin, we examined the effect of UV on NGF mRNA expression. Although UV initially inhibited the expression of keratinocyte NGF mRNA (4 h), by 24 h an induction of NGF mRNA was seen. The NGF signal could also be induced by phorbol esters. Thus, keratinocytes synthesize and express NGF, and its expression is modulated by UVB and phorbol esters

  12. Cellular uptake of {sup 212}BiOCl by Ehrlich ascites cells: A dosimetric analysis

    Energy Technology Data Exchange (ETDEWEB)

    Roeske, J.C.; Whitlock, J.L.; Harper, P.V.; Rotmensch, J. [Univ. of Chicago, IL (United States); Stinchcomb, T.G. [DePaul Univ., Chicago, IL (United States). Dept. of Physics; Schwartz, J.L. [Univ. of Washington, Seattle, WA (United States). Dept. of Radiation Oncology; Hines, J.J. [Argonne National Lab., IL (United States). Chemistry Div.


    Bi-212 is an alpha-emitting radionuclide being investigated as a therapeutic agent in the intraperitoneal treatment of micrometastatic ovarian carcinoma. In evaluating a new therapeutic modality, cell-survival studies are often used as a means of quantifying the biological effects of radiation. In this analysis, Ehrlich ascites cells were irradiated under conditions similar to therapy in various concentrations of Bi-212. Immediately following irradiation, a cell survival assay was performed in which cells were plated and colonies were counted after 10--14 days. Both a macrodosimetric and a microdosimetric approach were used in analyzing these data. These models used as input the fraction of activity within the cell and in solution, the distribution of cell sizes, and the variation of LET along individual alpha-particle tracks. The results indicate that the energy deposited within the nucleus varies significantly among individual cells. There is a small fraction of cell nuclei which receive no hits, while the remaining cells receive energy depositions which can differ significantly from the mean value. These dosimetric parameters are correlated with measured cell survival and will be a useful predictor of outcome for therapeutic doses.

  13. Mechanical strength and thermophysical properties of PM212: A high temperature self-lubricating powder metallurgy composite (United States)

    Edwards, Phillip M.; Sliney, Harold E.; Dellacorte, Christopher; Whittenberger, J. Daniel; Martineau, Robert R.


    A powder metallurgy composite, PM212, composed of metal bonded chromium carbide and solid lubricants is shown to be self-lubricating to a maximum application temperature of 900 C. The high temperature compressive strength, tensile strength, thermal expansion and thermal conductivity data needed to design PM212 sliding contact bearings and seals are reported for sintered and isostatically pressed (HIPed) versions of PM212. Other properties presented are room temperature density, hardness, and elastic modulus. In general, both versions appear to have adequate strength to be considered as sliding contact bearing materials, but the HIPed version, which is fully dense, is much stronger than the sintered version which contains about 20 percent pore volume. The sintered material is less costly to make, but the HIPed version is better where high compressive strength is important.

  14. Activities of AREVA Med. Extraction and purification of the 212Pb isotope from Thorium for radio-immunotherapy

    International Nuclear Information System (INIS)

    After having recalled the definition of radio-immunotherapy (RIT) and the benefits of alpha RIT for the treatment of some cancers, this document explains the choice of the 212-Pb isotope instead of the 212-Bi isotope (the first one has a longer half-life than the second). The Pb isotope in fact progressively transforms itself into the Bi isotope. The production process is evoked with its important steps. A second part reports the first clinic tests performed in the Alabama Centre for the treatment of different cancer (breast, colon, ovarian, pancreas, stomach). Processes and doses are discussed

  15. Evaluation of PS 212 Coatings Under Boundary Lubrication Conditions with an Ester-based Oil to 300 C (United States)

    Sliney, Harold E.; Loomis, William R.; Dellacorte, Christopher


    High friction and wear of turbine engine components occur during high temperature excursions above the oxidation threshold of the liquid lubricant. This paper reports on research to study the use of a high temperature self lubricating coating, PS 212 for back-up lubrication in the event of failure of the liquid lubricant. Pin on disk tests were performed under dry and boundary-lubricated conditions at disk temperatures up to 300 C. The liquid lubricant was a formulated polyol ester qualified under MIL L-23699. At test temperatures above the oil's thermal degradation level, the use of PS 212 reduced wear, providing a back-up lubricant effect.

  16. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B; Skov, Vibe; Jensen, Hasse Brønnum; Thomassen, Mads; Kruse, Torben A; Andersen, Ditte Caroline; Sheikh, Søren P


    INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular ...... pathways that fine-tuned by miR-132/212, suggesting a role for this miRNA family as master signalling switches in cardiac fibroblasts. Our data underscore the potential for miRNA tools to manipulate a large array of molecules and thereby control biological function....

  17. (212)Pb-radioimmunotherapy induces G(2) cell-cycle arrest and delays DNA damage repair in tumor xenografts in a model for disseminated intraperitoneal disease. (United States)

    Yong, Kwon Joong; Milenic, Diane E; Baidoo, Kwamena E; Brechbiel, Martin W


    In preclinical studies, targeted radioimmunotherapy using (212)Pb-TCMC-trastuzumab as an in vivo generator of the high-energy α-particle emitting radionuclide (212)Bi is proving an efficacious modality for the treatment of disseminated peritoneal cancers. To elucidate mechanisms associated with this therapy, mice bearing human colon cancer LS-174T intraperitoneal xenografts were treated with (212)Pb-TCMC-trastuzumab and compared with the nonspecific control (212)Pb-TCMC-HuIgG, unlabeled trastuzumab, and HuIgG, as well as untreated controls. (212)Pb-TCMC-trastuzumab treatment induced significantly more apoptosis and DNA double-strand breaks (DSB) at 24 hours. Rad51 protein expression was downregulated, indicating delayed DNA double-strand damage repair compared with (212)Pb-TCMC-HuIgG, the nonspecific control. (212)Pb-TCMC-trastuzumab treatment also caused G(2)-M arrest, depression of the S phase fraction, and depressed DNA synthesis that persisted beyond 120 hours. In contrast, the effects produced by (212)Pb-TCMC-HuIgG seemed to rebound by 120 hours. In addition, (212)Pb-TCMC-trastuzumab treatment delayed open chromatin structure and expression of p21 until 72 hours, suggesting a correlation between induction of p21 protein and modification in chromatin structure of p21 in response to (212)Pb-TCMC-trastuzumab treatment. Taken together, increased DNA DSBs, impaired DNA damage repair, persistent G(2)-M arrest, and chromatin remodeling were associated with (212)Pb-TCMC-trastuzumab treatment and may explain its increased cell killing efficacy in the LS-174T intraperitoneal xenograft model for disseminated intraperitoneal disease. PMID:22238365

  18. El Decreto reglamentario de la Ley N° 18.212 (Usura: su ilegitimidad

    Directory of Open Access Journals (Sweden)

    Roque Molla


    Full Text Available En nuestra entrega para el Tomo XXXIX del Anuario de Derecho Civil Uruguay, ratificamos nuestra opinión vertida en La Pluma No. 29 Junio 2008, en el sentido de que el régimen de la ley 18.212 no es aplicable a la cláusula penal pactada en una compraventa para el caso de resolución del contrato por incumplimiento de la obligación de pagar el precio.La cuestión debe resolverse en función de la materia regulada por la ley.En ese orden de ideas, en el trabajo publicado en el ADCU referido, siguiendo a Emilio Betti, manifestamos: "La materia (ratio legis de la ley es la disciplina de la usura civil y penal abarcativa no solamente de los intereses usurarios sino también de los negocios usurarios en las operaciones de crédito"

  19. 76 FR 68301 - Airworthiness Directives; Bell Helicopter Textron, Inc. (Bell), Model 205A-1, 205B, 210, and 212... (United States)


    ... same type designs, this AD supersedes AD 2010-03-03 (75 FR 5681, February 4, 2010), retaining the same... airworthiness directive (AD) for Bell Model 205B and 212 helicopters with certain main rotor blade (blade... of the helicopter. Since issuing AD 2010-03-03 (75 FR 5681, February 4, 2010), we have...

  20. 25 CFR 212.5 - Authority and responsibility of the Office of Surface Mining Reclamation and Enforcement (OSM). (United States)


    ... regulations for surface coal mining and reclamation operations are found in 30 CFR part 750. Those regulations... § 212.5 Authority and responsibility of the Office of Surface Mining Reclamation and Enforcement (OSM). The OSM is the regulatory authority for surface coal mining and reclamation operations on Indian...

  1. Determination of 210Pb and 212Pb in water and their radiological impact to the public via drinking water

    International Nuclear Information System (INIS)

    A sensitive and accurate method for determining ultra low-level 210Pb and 212Pb in water samples through double measurements was developed. Pb was pre-concentrated as hydroxides, separated from alkaline earth elements as PbS precipitate, purified by an anion exchange resin chromatography column, precipitated as PbSO4 for source preparation and counted by a low background β-counter. The procedure was checked with IAEA reference materials, and the results agreed well with the recommended values. The minimum detectable activity was 0.062 mBq·L-1 for 210Pb and 0.053 mBq·L-1 for 212Pb with a 48 L water sample. Seventeen drinking water samples were analyzed,with a Pb recovery of 88.8±5.5%, and the typical activity concentrations were 0.191-15.1 mBq·L-1 for 210Pb and of 1.12-5.77 mBq·L-1 for 212Pb. The estimated committed effective doses to adult members of the public in Italy due to intake of 210Pb and 212Pb in drinking water were 0.096-7.59 μSv·a-1 and 0.005-0.025 μSv·a-1, respectively. (authors)

  2. 40 CFR 262.212 - Making the hazardous waste determination at an on-site interim status or permitted treatment... (United States)


    ....212 Making the hazardous waste determination at an on-site interim status or permitted treatment... hazardous waste permit or interim status as soon as it arrives in the on-site treatment, storage or disposal... permitted treatment, storage or disposal facility. (e) If the unwanted material is a hazardous waste,...

  3. 77 FR 41795 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act (United States)


    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and ] Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS),...

  4. 76 FR 14419 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act (United States)


    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Citizenship and Immigration Services (USCIS), in consultation with U.S. Immigration and Customs...

  5. 76 FR 14418 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act (United States)


    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... determination will be made by U.S. Citizenship and Immigration Services (USCIS), in consultation with...

  6. 76 FR 2130 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act (United States)


    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... Immigration Services (USCIS), in consultation with U.S. Immigration and Customs Enforcement (ICE), or by...

  7. 76 FR 2131 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act (United States)


    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS),...

  8. 47 CFR 36.212 - Basic local services revenue-Account 5000 (Class B telephone companies); Basic area revenue... (United States)


    ... Income Accounts Operating Revenues § 36.212 Basic local services revenue—Account 5000 (Class B telephone... 47 Telecommunication 2 2010-10-01 2010-10-01 false Basic local services revenue-Account 5000 (Class B telephone companies); Basic area revenue-Account 5001 (Class A telephone companies)....

  9. Bismuth-212-labeled anti-Tac monoclonal antibody: alpha-particle-emitting radionuclides as modalities for radioimmunotherapy

    International Nuclear Information System (INIS)

    Anti-Tac, a monoclonal antibody directed to the human interleukin 2 (IL-2) receptor, has been successfully conjugated to the alpha-particle-emitting radionuclide bismuth-212 by use of a bifunctional ligand, the isobutylcarboxycarbonic anhydride of diethylenetriaminepentaacetic acid. The physical properties of 212Bi are appropriate for radioimmunotherapy in that it has a short half-life, deposits its high energy over a short distance, and can be obtained in large quantities from a radium generator. Antibody specific activities of 1-40 microCi/microgram (1 Ci = 37 GBq) were achieved. Specificity of the 212Bi-labeled anti-Tac was demonstrated for the IL-2 receptor-positive adult T-cell leukemia line HUT-102B2 by protein synthesis inhibition and clonogenic assays. Activity levels of 0.5 microCi or the equivalent of 12 rad/ml of alpha radiation targeted by anti-Tac eliminated greater than 98% the proliferative capabilities of HUT-102B2 cells with more modest effects on IL-2 receptor-negative cell lines. Specific cytotoxicity was blocked by excess unlabeled anti-Tac but not by human IgG. In addition, an irrelevant control monoclonal antibody of the same isotype labeled with 212Bi was unable to target alpha radiation to cell lines. Therefore, 212Bi-labeled anti-Tac is a potentially effective and specific immunocytotoxic reagent for the elimination of IL-2 receptor-positive cells. These experiments thus provide the scientific basis for use of alpha-particle-emitting radionuclides in immunotherapy

  10. Rice OsRAD21-2 is Expressed in Actively Dividing Tissues and its Ectopic Expression in Yeast Results in Aberrant Cell Division and Growth

    Institute of Scientific and Technical Information of China (English)

    Chunyan Gong; Tang Li; Qi Li; Longfeng Yan; Tai Wang


    Rad21 and its meiotic counterpart Rec8,the key components of the cohesin complex,are essential for sister chromatid cohesion and chromosome segregation in mitosis and meiosis,respectively.In contrast to yeast and vertebrates,which have only two RAD21/REC8 genes,the rice genome encodes four Rad21/Rec8 proteins.Here,we report on the cloning and characterization of OsRAD21-2 from rice (Oryza sativa L.).Phylogenetic analysis of the full-length amino acids showed that OsRad21-2 was grouped into the plant-specific Rad21 subfamily.Semi-quantitative reverse transcription-polymerase chain reaction revealed OsRAD21-2 preferentially expressed in premeiotic flowers.Further RNA in situ hybridization analysis and promoter::β-glucuronidase staining indicated that OsRAD21-2 was mainly expressed in actively dividing tissues including premeiotic stamen,stem intercalary meristem,leaf meristem,and root pericycle.Ectopic expression of OsRAD21-2 in fission yeast resulted in cell growth delay and morphological abnormality.Flow cytometric analysis revealed that the OsRAD21-2-expressed cells were arrested in G2 phase.Our results suggest that OsRad21-2 functions in regulation of cell division and growth.

  11. The Effect of Dorsal Hippocampal α2-Adrenegic Receptors on WIN55,212-2 State-Dependent Memory of Passive Avoidance

    Directory of Open Access Journals (Sweden)

    Zarrindast M.R.


    Full Text Available Background and Objectives: Cannabinoids are a class of psychoactive compounds that produce a wide array of effects in a large number of species. In the present study, the effects of bilateral intra-CA1 injections of an α2-adrenergic receptor agents, on WIN55,212-2 state-dependent learning were examined in adult male Wistar rats. Methods: The animals were bilaterally implanted with chronic cannulae in the CA1 regions of the dorsal hippocampus, trained in a step-down type inhibitory avoidance task, and tested 24h after training to measure step-down latency.Results: Post-training intra-CA1 injection of WIN55,212-2 (0.25 and 0.5µg/rat induced impairment of memory retention. Amnesia produced by post-training WIN55,212-2 (0.5µg/rat was reversed by pre-test administration of the same dose of WIN55,212-2 that is due to a state-dependent effect. Pre-test intra-CA1 injection of clonidine (0.5 and 0.75µg/rat, intra-CA1 improved post-training WIN55,212-2 (0.5µg/rat, intra-CA1-induced retrieval impairment, while pre-test intra-CA1 injection of yohimbine (1µg/rat, intra-CA1 2min before the administration of WIN55,212-2 (0.5µg/rat, intra-CA1 inhibited WIN55,212-2 state-dependent memory. Conclusion: These results suggest that α2-adrenergic receptors of the dorsal hippocampal CA1 regions may play an important role in Win55,212-2-induced amnesia and WIN55,212-2 state-dependent memory.

  12. Production and in vivo imaging of (203)Pb as a surrogate isotope for in vivo (212)Pb internal absorbed dose studies. (United States)

    Máthé, Domokos; Szigeti, Krisztián; Hegedűs, Nikolett; Horváth, Ildikó; Veres, Dániel S; Kovács, Béla; Szűcs, Zoltán


    (212)Pb is a clinically relevant therapeutic alpha emitter isotope. A surrogate, (203)Pb, if prepared with sufficiently high specific activity could be used to estimate (212)Pb in vivo absorbed doses. An improved production procedure of (203)Pb with a simple, new separation method and high specific radioactivity for imaging is reported. We determined the in-vivo biodistribution of (203)Pb in mice by SPECT/CT. This highlights application possibilities of (203)Pb for further in vivo and clinical uses (radiolabeled (212)Pb-peptide co-injection, dosimetry calculation). PMID:27156049

  13. A 140 GHz pulsed EPR/212 MHz NMR spectrometer for DNP studies (United States)

    Smith, Albert A.; Corzilius, Björn; Bryant, Jeffrey A.; DeRocher, Ronald; Woskov, Paul P.; Temkin, Richard J.; Griffin, Robert G.


    We described a versatile spectrometer designed for the study of dynamic nuclear polarization (DNP) at low temperatures and high fields. The instrument functions both as an NMR spectrometer operating at 212 MHz (1H frequency) with DNP capabilities, and as a pulsed-EPR operating at 140 GHz. A coiled TE011 resonator acts as both an NMR coil and microwave resonator, and a double balanced (1H, 13C) radio frequency circuit greatly stabilizes the NMR performance. A new 140 GHz microwave bridge has also been developed, which utilizes a four-phase network and ELDOR channel at 8.75 GHz, that is then multiplied and mixed to obtain 140 GHz microwave pulses with an output power of 120 mW. Nutation frequencies obtained are as follows: 6 MHz on S = 1/2 electron spins, 100 kHz on 1H, and 50 kHz on 13C. We demonstrate basic EPR, ELDOR, ENDOR, and DNP experiments here. Our solid effect DNP results demonstrate an enhancement of 144 and sensitivity gain of 310 using OX063 trityl at 80 K and an enhancement of 157 and maximum sensitivity gain of 234 using Gd-DOTA at 20 K, which is significantly better performance than previously reported at high fields (⩾3 T).

  14. Production and optimization of curdlan produced by Pseudomonas sp. QL212. (United States)

    Yang, Min; Zhu, Ying; Li, Yumei; Bao, Jie; Fan, Xiangyu; Qu, Yanhong; Wang, Yiwei; Hu, Zhiheng; Li, Qiang


    Curdlan is a polysaccharide that consists of β-1,3-linked glucose residues. A polysaccharide-producing bacterium isolated from soil samples was identified as Pseudomonas sp. QL212. The polysaccharide was purified to homogeneity via sequential ethanol precipitation, deproteinization, CM ion-exchange, and gel chromatography sequentially. Analysis of the purified polysaccharide revealed that it consisted of many glucosyl residues, and its molecular weight was only 6.18×10(5)Da. This low molecular weight endowed it with excellent solubility. Infrared and nuclear magnetic resonance spectral analysis confirmed that the polysaccharide was curdlan. Single-factor and Response surface methodology experiments were used to optimize the culture medium and conditions. The optimal culture conditions consisted of seed culture age of 12h, and an incubation temperature of 30°C, with 10% inoculum and a total fluid volume of 75mL in a 250-mL Erlenmeyer flask. The maximum curdlan yield of about 5.92gL(-1) was achieved with an optimal medium consisting of 30.11gL(-1) of sucrose, 5.94gL(-1) of yeast extract, and an initial pH of 8.03. To our best knowledge, this is the highest reported yield of curdlan produced by Pseudomonas sp., and the curdlan production medium components were much simpler than those in previous reports. PMID:27086290

  15. Fractal structure in the scalar λ(φ2-1)2 theory

    International Nuclear Information System (INIS)

    Head-on collisions of kink and antikink solitons are investigated numerically in the classical one-dimensional λ(φ2-1)2 model. It is shown that whether a kink-antikink interaction settles to a bound state or a two-soliton solution depends ''fractally'' on the impact velocity. We discuss the results using the framework of perturbation theory which helps to clarify the nature of the fractal structure in terms of resonances with the internal shape mode oscillations. We also review the technique of collective coordinates used to reduce the infinite-dimensional system to one with just two degrees of freedom. Although we do not expect exact agreement by using such a simplification, we show that the reduced system bears a striking qualitative resemblance to the full infinite-dimensional system, reproducing the fractal structure. The maximum Lyapunov exponents are computed for the bound-state oscillations and found to be ∼0.3 for both the full and reduced systems, demonstrating the chaotic nature of the bound state

  16. Jet Motion, Internal Working Surfaces, and Nested Shells in the Protostellar System HH 212

    CERN Document Server

    Lee, Chin-Fei; Zhang, Qizhou; Shang, Hsien; Ho, Paul T P; Mizuno, Yosuke


    HH 212 is a nearby (400 pc) highly collimated protostellar jet powered by a Class 0 source in Orion. We have mapped the inner 80" (~ 0.16 pc) of the jet in SiO (J=8-7) and CO (J=3-2) simultaneously at ~ 0.5 resolution with the Atacama Millimeter/Submillimeter Array at unprecedented sensitivity. The jet consists of a chain of knots, bow shocks, and sinuous structures in between. As compared to that seen in our previous observations with the Submillimeter Array, it appears to be more continuous, especially in the northern part. Some of the knots are now seen associated with small bow shocks, with their bow wings curving back to the jet axis, as seen in pulsed jet simulations. Two of them are reasonably resolved, showing kinematics consistent with sideways ejection, possibly tracing the internal working surfaces formed by a temporal variation in the jet velocity. In addition, nested shells are seen in CO around the jet axis connecting to the knots and bow shocks, driven by them. The proper motion of the jet is e...

  17. Study on the performance of Nafion 212 membrane in polymeric electrolyte fuel cells operating with air; Estudo do desempenho da membrana de Nafion 212 em celulas a combustivel de eletrolito polimerico operando com ar

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Adriano C.; Ticianelli, Edson Antonio [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail:


    The operational characteristics of the Nafion 212 membrane (N212) were investigated and compared to the Nafion 112 membrane (N112), both 50 thick, in polymer electrolyte fuel cell (PEFC). The polarization measurements were performed changing the cell and gases humidification temperature and the gases pressure. The kinetic parameters obtained from the polarization curve proved that the cell with membrane N212 showed better performance than membrane N112, when they operating with air at cathode. The electrochemical impedance studies were carried out to make clear the polarization phenomena due to the resistive and diffusive effects that limit the cell performance. At high frequency region is found an arc, which dimension in depends on the current density, whereas at the mid frequency region we can find two loops with different characteristics and both dependent of current density. This behavior becomes evident that there are polarization components linked to resistive processes at high frequency, as well as charge transference and diffusional at mid and low frequency, respectively. (author)

  18. Quantum yield of Cl∗ (21/2) production in the gas phase photolysis of CCl4 in the ultraviolet

    Indian Academy of Sciences (India)

    Manish Tak; Manabendra Chandra; Dulal Senapati; Puspendu K Das


    In this paper, we have probed the dynamics of chlorine atom production from the gas phase photodissociation of carbon tetrachloride at 222 and 235 nm. The quantum yield, * of Cl∗ (21/2) production has been determined by probing the nascent concentrations of both excited (21/2) and ground state (23/2) chlorine atoms by suitable resonance-enhanced multiphoton ionization (REMPI) detection schemes. Although at the photolysis wavelengths the absorption of carbon tetrachloride is weak, significant amounts of Cl∗ are produced. Surprisingly, the quantum yield of Cl∗ production does not follow the absorption spectrum closely, which gives rise to the possibility of an indirect dissociation mechanism present in CCl4 along with direct dissociation at these ultraviolet wavelengths.

  19. Drug Survival and reasons for discontinuation of intramuscular methotrexate: a study of 212 consecutive patients switching from oral methotrexate

    DEFF Research Database (Denmark)

    Linde, Louise; Hetland, Merete Lund; Østergaard, Mikkel


    Drug survival and reasons for discontinuation of intramuscular methotrexate: a study of 212 consecutive patients switching from oral methotrexate.Linde L, Hetland ML, Ostergaard M. Department of Rheumatology, Copenhagen University Hospital, Hvidovre Hospital, Hvidovre, Denmark. OBJECTIVES: To assess the drug survival and reasons for discontinuation of intramuscular methotrexate (imMTX) in rheumatological patients who had switched to imMTX from oral methotrexate (oMTX). METHODS: Data from 212 consecutive patients who switched from oMTX to imMTX therapy at our outpatient clinic...... had stopped oMTX because of adverse events, 22% also withdrew from imMTX because of adverse events. CONCLUSION: Half of the patients benefited from switching from oral to intramuscular methotrexate for at least 6 months, but only a minority adhered to the treatment for years. Lack of efficacy was the...

  20. Nuclear g-factor measurements of the (9/2)- and (21/2)- isomeric states in 173Ta

    International Nuclear Information System (INIS)

    The nuclear g-factors of the one-quasiparticle isomeric state (9/2)- at 165.8 keV and the three-quasiparticle isomeric state (21/2)- at 1713.2 keV in 173Ta nuclei have been measured using the time differential perturbed angular distribution technique. The nuclear reaction 165Ho(12C, 4nγ)173Ta was used to populate these isomeric states, and the recoiling 173Ta nuclei were implanted into a thick tantalum backing in the presence of a 7.04(4) kG external magnetic field. The measured value g((9/2)-) = +0.591(18) shows that the (9/2)- isomeric state is not a pure single-particle state but may have a collective contribution due to the octupole excitation of the core. Based on the measured value g((21/2)-) = + 0.620(15) and multi-quasiparticle calculations, the (21/2)- isomeric state is assigned a mixed configuration: π3((9/2)-[514], (7/2)+[404] (5/2)+[402]) (39%) and π1((7/2)+[404])(multiply-in-circle sign) ν2((7/2)-[514], (7/2)+[633]) (61%)

  1. Oxygen Sensing via the Ethylene Response Transcription Factor RAP2.12 Affects Plant Metabolism and Performance under Both Normoxia and Hypoxia. (United States)

    Paul, Melanie Verena; Iyer, Srignanakshi; Amerhauser, Carmen; Lehmann, Martin; van Dongen, Joost T; Geigenberger, Peter


    Subgroup-VII-ethylene-response-factor (ERF-VII) transcription factors are involved in the regulation of hypoxic gene expression and regulated by proteasome-mediated proteolysis via the oxygen-dependent branch of the N-end-rule pathway. While research into ERF-VII mainly focused on their role to regulate anoxic gene expression, little is known on the impact of this oxygen-sensing system in regulating plant metabolism and growth. By comparing Arabidopsis (Arabidopsis thaliana) plants overexpressing N-end-rule-sensitive and insensitive forms of the ERF-VII-factor RAP2.12, we provide evidence that oxygen-dependent RAP2.12 stability regulates central metabolic processes to sustain growth, development, and anoxic resistance of plants. (1) Under normoxia, overexpression of N-end-rule-insensitive Δ13RAP2.12 led to increased activities of fermentative enzymes and increased accumulation of fermentation products, which were accompanied by decreased adenylate energy states and starch levels, and impaired plant growth and development, indicating a role of oxygen-regulated RAP2.12 degradation to prevent aerobic fermentation. (2) In Δ13RAP2.12-overexpressing plants, decreased carbohydrate reserves also led to a decrease in anoxic resistance, which was prevented by external Suc supply. (3) Overexpression of Δ13RAP2.12 led to decreased respiration rates, changes in the levels of tricarboxylic acid cycle intermediates, and accumulation of a large number of amino acids, including Ala and γ-amino butyric acid, indicating a role of oxygen-regulated RAP2.12 abundance in controlling the flux-modus of the tricarboxylic acid cycle. (4) The increase in amino acids was accompanied by increased levels of immune-regulatory metabolites. These results show that oxygen-sensing, mediating RAP2.12 degradation is indispensable to optimize metabolic performance, plant growth, and development under both normoxic and hypoxic conditions. PMID:27372243

  2. Experimental study of neonlike zinc J=0-1 soft X-ray lasing at 21.2 nm (United States)

    Rus, B.; Carillon, A.; Dhez, P.; Gauthé, B.; Goedtkindt, P.; Jaeglé, P.; Jamelot, G.; Klisnick, A.; Nantel, M.; Sureau, A.; Zeitoun, P.


    Since our first observation of intense J=0-1 lasing in neonlike zinc in early 1993, we have investigated various issues of this X-ray laser. The results of these experiments, performed at Laboratoire pour l'Utilisation des Lasers Intenses (LULI), are briefly reviewed. Gain coefficients of ˜5 cm-1 at 21.2 nm are now routinely obtained with ≊350 J delivered onto a Zn slab in ˜650 ps pulses—the net irradiance is ˜1.4×1013 W cm-2. The 21.2 nm emission appears in a ≊100 ps burst and precedes the lasing on the J=2-1 transitions at 26.2 and 26.7 nm which have a duration ≊350 ps. We have directly measured the gain regions of the J=0-1 line at 21.2 nm and the J=2-1 line at 26.7 nm and confirmed the initial claim that they are located at different distances from the target. We have also measured the refraction angles and divergences of the XRL beams of these two transitions. The beam at 21.2 nm was observed to be remarkably narrow with a divergence of ˜2.6 mrad, peaking ˜7 mrad off-axis. This contrasts to the beam at 26.7 nm which has a divergence of ≊10 mrad and peaks at ˜15 mrad. The most recent finding is that the J=0-1 lasing exists only when the main pump pulse is preceded by a pulse train of mJ level, which is a remnant from the laser oscillator. An important achievement in developing the XRL at 21.2 nm was the demonstration of half-cavity operation: with a gain-length product of ˜16.5, the emission exhibits saturation behavior. The absolute energy measurements indicate ˜400 μJ in the near-saturated beam.

  3. The new version 2.12 of BKG Ntrip Client (BNC) (United States)

    Stürze, Andrea; Mervart, Leos; Weber, Georg; Rülke, Axel; Wiesensarter, Erwin; Neumaier, Peter


    A new version of the BKG Ntrip Client (BNC) has been released. Originally developed in cooperation of the Federal Agency for Cartography and Geodesy (BKG) and the Czech Technical University (CTU) with a focus on multi-stream real-time access to GPS observations, the software has once again been substantially extended. Promoting Open Standards as recommended by the Radio Technical Commission for Maritime Services (RTCM) remains the prime subject. Beside its Graphical User Interface (GUI), the real-time software for Windows, Linux, Mac, and Linux platforms now comes with complete Command Line Interface (CLI) and considerable post processing functionality. RINEX Version 3 file editing & Quality Check (QC) with full support of Galileo, BeiDou, and SBAS - besides GPS and GLONASS - is part of the new features. Comparison of satellite orbit/clock files in SP3 format is another fresh ability of BNC. Simultaneous multi-station Precise Point Positioning (PPP) for real-time displacement-monitoring of entire reference station networks is one more recent addition to BNC. Implemented RTCM messages for PPP (under development) comprise satellite orbit and clock corrections, code and phase observation biases, and the Vertical Total Electron Content (VTEC) of the ionosphere. The well established, mature codebase is mostly written in C++ language. Its publication under GNU GPL is thought to be well-suited for test, validation and demonstration of new approaches in precise real-time satellite navigation when IP streaming is involved. The poster highlights BNC features which are new in version 2.12 and beneficial to IAG institutions and services such as IGS/RT-IGS and to the interested public in general.

  4. A new nonsyndromic X-linked sensorineural hearing impairment linked to Xp21.2

    Energy Technology Data Exchange (ETDEWEB)

    Lalwani, A.K.; Brister, J.R.; Fex, J.; Grundfast, K.M.; Pikus, A.T.; Ploplis, B.; San Agustin, T.; Skarka, H.; Wilcox, E.R. [National Institutes of Health, Bethesda, MD (United States)


    X-linked deafness is a rare cause of hereditary hearing impairment. We have identified a family with X-linked dominant sensorineural hearing impairment, characterized by incomplete penetrance and variable expressivity in carrier females, that is linked to the Xp21.2, which contains the Duchenne muscular dystrophy (DMD) locus. The auditory impairment in affected males was congenital, bilateral, profound, sensorineural, affecting all frequencies, and without evidence of radiographic abnormality of the temporal bone. Adult carrier females manifested bilateral, mild-to-moderate high-frequency sensorineural hearing impairment of delayed onset during adulthood. Eighteen commercially available polymorphic markers from the X chromosome, generating a 10-15-cM map, were initially used for identification of a candidate region. DXS997, located within the DMD gene, generated a two-point LOD score of 2.91 at {theta} = 0, with every carrier mother heterozygous at this locus. Recombination events at DXS992 (located within the DMD locus, 3{prime} to exon 50 of the dystrophin gene) and at DXS1068 (5{prime} to the brain promoter of the dystrophin gene) were observed. No recombination events were noted with the following markers within the DMD locus: 5{prime}DYS II, intron 44, DXS997, and intron 50. There was no clinical evidence of Duchenne or Becker muscular dystrophy in any family member. It is likely that this family represents a new locus on the X chromosome, which when mutated results in nonsyndromic sensorineural hearing loss and is distinct from the heterogeneous group of X-linked hearing losses that have been previously described. 57 refs., 6 figs., 1 tab.

  5. FTIR Studies of Internal Water Molecules of Bacteriorhodopsin: Structural Analysis of Halide-bound D85S and D212N Mutants in the Schiff Base Region (United States)

    Shibata, Mikihiro; Kandori, Hideki


    Bacteriorhodopsin (BR), a membrane protein found in Halobacterium salinarum, functions as a light-driven proton pump. The Schiff base region has a quadropolar structure with positive charges located at the protonated Schiff base and Arg82, and counterbalancing negative charges located at Asp85 and Asp212 (Figure 1A). It is known that BR lacks a proton-pumping activity if Asp85 or Asp212 is neutralized by mutation. On the other hand, binding of C1- brings different effects for pumping functions in mutants at D85 and D212 position. While C1--bound D85T and D85S pump C1-, photovoltage measurements suggested that C1--bound D212N pumps protons at low pH. In this study, we measured low-temperature FTIR spectra of D85S and D212N containing various halides to compare the halide binding site of both proteins. In the case of D85S, the N-D stretching vibrations of the Schiff base were halide-dependent. This result suggests that the halide is a hydrogen-bond acceptor of the Schiff base, being consistent with the X-ray crystal structure. On the other hand, no halide dependence was observed for vibrational bands of the retinal skeleton and the Schiff base in the D212N mutant. This result suggests that the halide does not form a hydrogen bond with the Schiff base directly, unlike the mutation at D85 position. Halide-dependent water bands in the Schiff base region also differ between D85S and D212N. From these results, halide binding site of both proteins and role of two negative charges in BR will be discussed.

  6. Temperature dependence of gamma ray induced luminescence of ethanolamine based liquid scintillator between 212 and 273 K

    International Nuclear Information System (INIS)

    The luminescence response of ethanolamine based liquid scintillator (Ethanolamine + 1g/l Butyle PBD + 0.1g/l BBOT) has been investigated as a function of temperature in the range 212-273 K. It has been observed that under gamma excitation the scintillation efficiency increases by a factor of 1.37 with decrease in temperature. The data obtained conforms to Arrhenius relation in which activation energy of rate process (.20 ev) is typical for thermal activated diffusion controlled process. (author)

  7. Density-functional study of structural and electronic properties of AlnN(n=2-12) clusters

    International Nuclear Information System (INIS)

    The lowest energy structures and electronic properties of AlnN(n=2-12) clusters were studied using density-functional theory. The equilibrium geometries of AlnN clusters with up to n=12 were determined from a number of possible structural isomers at each size. The Al7N cluster was found be particularly stable with higher binding energy and larger electronic gap. For all the AlnN clusters studied, we found charge transfers from the Al to N site and co-existence of ionic and covalent bonding characteristics

  8. Ground- state structure and stabilities of Mon (n=2-12) clusters%Mon(n=2-12)团簇的基态结构及其稳定性

    Institute of Scientific and Technical Information of China (English)

    张红美; 孔德国; 王玉梅


    从第一性原理出发,对Mon(n=2-12)团簇的最低能量结构和电子性质进行了研究.计算结果表明,Mon的最低能量结构可以看成是在Mon-1的基础上戴帽一个Mo原予生长而成.综合团簇的平均结合能和能隙可知,n=3,6,8,10时团簇的基态稳定性较高.%The geometric configuration and electronic structure of Mo. (n = 2- 12) clusters have been studied by using density functional theory. The results indicated that the lowest energy structure of Mon cluster may be seen as the Mon-1 elustercapping one Mo atom. The calculated results on the averaged binding energy and the HOMO - LUMO gap of the Mon (n=2-12) clusters indicate that the relative stabilities of Mo3 ,Mo6 ,Mo8 and Mo10are stronger than clusters of other sizes.

  9. Determination of 55Mn(n,γ) reaction cross-section at the neutron energies of 1.12 and 2.12 MeV

    International Nuclear Information System (INIS)

    In the present work, we determine the 55Mn(n,γ)56Mn reaction cross-section at the neutron energies of 1.12 and 2.12 MeV by using the off-line γ-ray spectrometric technique. The (n,γ) reaction cross-section 55Mn as a function of neutron energy was also calculated using nuclear reaction modular code TALYS-1.6 and compared with the present experimental data at 1.12 and 2.12 MeV as well as the literature data at other neutron energies

  10. Evaluation of the MICAST #2-12 AI-7wt%Si Sample Directionally Solidified Aboard the International Space Station (United States)

    Tewari, Surendra N.; Ghods, Masoud; Angart, Samuel G.; Lauer, Mark; Grugel, Richard N.; Poirier, David R.


    The US team of the European led "MIcrostructure Formation in CASTing of Technical Alloys under Diffusive and Magnetically Controlled Convective Conditions" (MICAST) program recently received a third Aluminum - 7wt% silicon alloy that was processed in the microgravity environment aboard the International Space Station. The sample, designated MICAST#2-12, was directionally solidified in the Solidification with Quench Furnace (SQF) at a constant rate of 40micometers/s through an imposed temperature gradient of 31K/cm. Procedures taken to evaluate the state of the sample prior to sectioning for metallographic analysis are reviewed and rational for measuring the microstructural constituents, in particular the primary dendrite arm spacing (Lambda (sub1)), is given. The data are presented, put in context with the earlier samples, and evaluated in view of a relevant theoretical model.

  11. Measurement of the Electric Quadrupole Moment of the 9/2- and 21/2- Isomers in 173Ta

    International Nuclear Information System (INIS)

    The electric quadrupole moments of the 9/2- and 21/2- isomeric states of 173Ta at 165.8 keV and 1713.2 keV, respectively, were measured as Q(9/2-)=2.92(15) b and Q(21/2-)=6.23(18) b for the first time using the TDPAD technique. A 66 MeV pulsed 12C ion beam from the 15UD pelletron accelerator facility of the Nuclear Science Centre at New Delhi was used in the reaction 165Ho(12C, 4nγ)173Ta. The experimental values of equilibrium deformations β2(9/2-)=0.251(7) and β2(21/2-)=0.391(7) were extracted

  12. 21 CFR 212.71 - What actions must I take if a batch of PET drug product does not conform to specifications? (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What actions must I take if a batch of PET drug... Acceptance § 212.71 What actions must I take if a batch of PET drug product does not conform to specifications? (a) Rejection of nonconforming product. You must reject a batch of a PET drug product that...

  13. 8 CFR 1003.44 - Special motion to seek section 212(c) relief for aliens who pleaded guilty or nolo contendere to... (United States)


    ... basis of a crime that is an aggravated felony, except as provided in 8 CFR 1212.3(f)(4). (d) Effect of... or removal, and who are eligible to apply for relief under former section 212(c) of the Act and 8 CFR... adjudicated under the standards of this section and 8 CFR 1212.3. This section is not applicable with...

  14. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    DEFF Research Database (Denmark)

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan;


    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,...

  15. 42 CFR 436.212 - Individuals who would be eligible for cash assistance if the State plan for OAA, AFDC, AB, APTD... (United States)


    ... may provide Medicaid to individuals who would meet the Federal definition of disability, 45 CFR 233.80... assistance if the State plan for OAA, AFDC, AB, APTD, or AABD were as broad as allowed under the Act. 436.212... cash assistance if the State plan for OAA, AFDC, AB, APTD, or AABD were as broad as allowed under...

  16. Observation of atmospheric 210Pb and 212Pb originating from the 2004 eruptive activity of Asama volcano, Japan, and relevant 222Rn releasing from the erupting magma

    International Nuclear Information System (INIS)

    This paper describes a study of observation of atmospheric 210Pb and 212Pb possibly from the volcano (36 deg N, 138 deg E) activity in the title and of measurement of 222Rn releasing efficiency with the ash-fall deposit collected around the period. The aerosol sample was collected from Sep. 1, an eruption day, on a building terrace (10 m high) of Meiji University at Kawasaki, located at 140 km SE of the volcano, every 24 hr on the glass fiber filter using a high volume air sampler. The filter was cut out to 4 disks, which were packed into acrylic canisters with a window of a thin Mylar film for non-destructive γ-ray measurement. 210Pb and 212Pb radioactivities were determined by the 46.5- and 238.6-keV γ-rays with an LEPS (low energy photon spectrometer) and an HPGe spectrometer, respectively. The ash-fall sample from the eruption Sep. 14, was collected at Kanrakumachi, Gunma Pref., 40 km SE of the volcano, and measurement for the growth curve of 222Rn from the fall started 1 week after the eruption. A well-type HPGe spectrometer was used for determination of the 351.9-keV γ-ray of 222Rn from 214Pb in equilibrium, which was normalized by the 911.1-keV 228Ac γ-ray. 210Pb and 212Pb emitted into the atmosphere were suggested to have been transported 140 km within the time of a few times of the 212Pb half life (10.6 hr) on the northerly wind. 210Pb and 212Pb, and 222Rn were suggested to be a possibly useful tool of monitoring magmatic activities. (S.I.)

  17. Estimation of the Arctic aerosols from local and long-range transport using relationships between 210Pb and 212Pb atmospheric activity concentrations

    International Nuclear Information System (INIS)

    In this study, the aerosol activity concentrations of 210Pb at 28 Canadian radiological monitoring stations from 2009 to 2013 were analyzed. The results show that the ratio of 210Pb winter average concentration to summer average concentration increases with increasing latitude. This could be used to evaluate the transport of pollutants to the Arctic region such as the Arctic haze from Eurasia through long-range atmospheric transport during winter. Based on 12 years of monitoring results from the Yellowknife station that includes both 210Pb and 212Pb concentrations, the study confirms that the seasonal distribution of 210Pb to 212Pb activity concentration ratios has a significant peak in winter and a relatively low value in summer, which can be used as an indicator of the air mass flow to the Arctic. The period dominated by long-range aerosol transport and Arctic haze was estimated by fitting a Gaussian distribution function to the peak values of this ratio in winter. A peak width parameter of full width at half maximum (FWHM) allows a year by year estimate of the period of influence by long-range transport of aerosols, and this varied between 67 and 88 days in this study. The fitted Gaussian peak also shows that the season of the continental influenced air mass in Yellowknife usually starts in mid-to-late November and ends in mid-to-late April. Thus, the 210Pb to 212Pb ratio distributions may enable the determination of periods dominated by long-range aerosol transport and the scale of the Arctic haze at different latitudes. - Highlights: • Twelve years 210Pb/212Pb monitoring results from low to high altitude are presented. • The 210Pbwinter/210Pbsummer ratio increases clearly with latitude of monitoring site. • The pollutant transport to the Arctic is estimated by distribution 210Pb/212Pb ratio. • The time scale of long-range transport aerosol bearing 210Pb to Arctic is reported

  18. Involvement of PPAR receptors in the anticonvulsant effects of a cannabinoid agonist, WIN 55,212-2. (United States)

    Payandemehr, Borna; Ebrahimi, Ali; Gholizadeh, Ramtin; Rahimian, Reza; Varastehmoradi, Bardia; Gooshe, Maziar; Aghaei, Hossein Nayeb; Mousavizadeh, Kazem; Dehpour, Ahmad Reza


    Cannabinoid and PPAR receptors show well established interactions in a set of physiological effects. Regarding the seizure-modulating properties of both classes of receptors, the present study aimed to evaluate the roles of the PPAR-gamma, PPAR-alpha and CB1 receptors on the anticonvulsant effects of WIN 55,212-2 (WIN, a non selective cannabinoid agonist). The clonic seizure thresholds after intravenous administration of pentylenetetrazole (PTZ) were assessed in mice weighing 23-30 g. WIN increased the seizure threshold dose dependently. Pretreatment with pioglitazone, as a PPARγ agonist, potentiated the anticonvulsant effects of WIN, while PPARγ antagonist inhibited these anticonvulsant effects partially. On the other hand PPARα antagonist reduced the anticonvulsant effects of WIN significantly. Finally the combination of CB1 antagonist and PPARα antagonist could completely block the anticonvulsant properties of WIN. Taken together, these results show for the first time that a functional interaction exists between cannabinoid and PPAR receptors in the modulation of seizure susceptibility. PMID:25448777

  19. Discovery of Very High Energy gamma-rays from 1ES1011+496 at z=0.212

    CERN Document Server

    Albert, J; Anderhub, H; Antoranz, P; Armada, A; Baixeras, C; Barrio, J A; Bartko, H; Bastieri, D; Becker, J K; Bednarek, W; Berger, K; Bigongiari, C; Biland, A; Böck, R K; Bordas, P; Bosch-Ramon, V; Bretz, T; Britvitch, I; Camara, M; Carmona, E; Chilingarian, A; Coarasa, J A; Commichau, S; Contreras, J L; Cortina, J; Costado, M T; Curtef, V; Danielyan, V; Dazzi, F; De Angelis, A; Delgado, C; De los Reyes, R; De Lotto, B; Domingo-Santamaria, E; Dorner, D; Doro, M; Errando, M; Fagiolini, M; Ferenc, D; Fernández, E; Firpo, R; Flix, J; Fonseca, M V; Font, L; Fuchs, M; Galante, N; Garcia-Lopez, R J; Garczarczyk, M; Gaug, M; Giller, M; Göbel, F; Hakobyan, D; Hayashida, M; Hengstebeck, T; Herrero, A; Höhne, D; Hose, J; Hsu, C C; Jacon, P; Jogler, T; Kosyra, R; Kranich, D; Kritzer, R; Laille, A; Lindfors, E; Lombardi, S; Longo, F; López, J; López, M; Lorenz, E; Majumdar, P; Maneva, G; Mannheim, K; Mansutti, O; Mariotti, M; Mart, M; Mazin, D; Merck, C; Meucci, M; Meyer, M; Miranda, J M; Mirzoyan, R; Mizobuchi, S; Moralejo, A; Nieto, D; Nilsson, K; Ninkovic, J; Ona-Wilhelmi, E; Otte, N; Oya, I; Paneque, D; Panniello, M; Paoletti, R; Paredes, J M; Pasanen, M; Pascoli, D; Pauss, F; Pegna, R; Perlman, E; Persic, M; Peruzzo, L; Piccioli, A; Prandini, E; Puchades, N; Raymers, A; Rhode, W; Rib, M; Rico, J; Rissi, M; Robert, A; Rugamer, S; Saggion, A; Saitô, T; Sánchez, A; Sartori, P; Scalzotto, V; Scapin, V; Schmitt, R; Schweizer, T; Shayduk, M; Shinozaki, K; Shore, S N; Sidro, N; Sillanpa, A; Sobczynska, D; Stamerra, A; Stark, L S; Takalo, L; Tavecchio, F; Temnikov, P; Tescaro, D; Teshima, M; Torres, D F; Turini, N; Vankov, H; Vitale, V; Wagner, R M; Wibig, T; Wittek, W; Zandanel, F; Zanin, R; Zapatero, J


    We report on the discovery of Very High Energy (VHE) gamma-ray emission from the BL Lacertae object 1ES1011+496. The observation was triggered by an optical outburst in March 2007 and the source was observed with the MAGIC telescope from March to May 2007. Observing for 18.7 hours we find an excess of 6.2 sigma with an integrated flux above 200GeV of (1.58$\\pm0.32)\\cdot 10^{-11}$ photons cm$^{-2}$ s$^{-1}$. The VHE gamma-ray flux is >40% higher than in March-April 2006 (reported elsewhere), indicating that the VHE emission state may be related to the optical emission state. We have also determined the redshift of 1ES1011+496 based on an optical spectrum that reveals the absorption lines of the host galaxy. The redshift of z=0.212 makes 1ES1011+496 the most distant source observed to emit VHE gamma-rays up to date.

  20. Measurement of {sup 214} Pb, {sup 212} Pb {sup 210} Pb and {sup 7} Be activities in sizes fractionated aerosols in the lower atmosphere at Sacavem (Lisbon)

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Mario J.; Brogueira, Alfredo L.; Bettencourt, Antonio O. [Instituto Tecnologico e Nuclear, Sacavem (Portugal). Dept. de Protecao Radiologica e Seguranca Nuclear; Rosa, Rui N. [Universidade de Evora (Portugal). Dept. de Fisica


    Aerodynamic size distribution measurements of {sup 214} Pb, {sup 212} Pb {sup 210} Pb and {sup 7} Be were carried out using a five-stage high-volume cascade impactor with effective cut-off diameters of 0.49, 0.95, 1.5, 3.0, and 7.2 {mu}m. The activity of the samples was measured by {gamma}-ray spectrometry using both coaxial and ultra-low background well-type HPGe detectors. The activity size distribution measurements indicate that all radionuclides were associated with submicron aerosol in the accumulation mode, being {sup 210} Pb and {sup 7} Be attached to slightly larger particles, when compared to short-lived radon and thoron daughters. The mass size distributions show a significant contribution from aerosol particles larger than 7.2 {mu}m to the total mass concentration, which indicates the occurrence of resuspension processes. However, since that in most of the samples no {sup 210} Pb and short-lived {sup 214} Pb and {sup 212} Pb were found in association with larger particles, it seems that those nuclides were mostly originated by the decay of atmospheric radon (or thoron in the case of {sup 212} Pb) instead of soil resuspension. On average it was observed that about 80% of the {sup 214} Pb and {sup 212} Pb activity was associated with aerosol particles with aerodynamic diameters smaller than 0.49 {mu}m and about 90% with particles smaller than 0.95 {mu}m. (author)

  1. The cannabinoid agonist WIN55,212-2 increases intracellular calcium via CB1 receptor coupling to Gq/11 G proteins


    Lauckner, Jane E.; Hille, Bertil; Mackie, Ken


    Central nervous system responses to cannabis are primarily mediated by CB1 receptors, which couple preferentially to Gi/o G proteins. Here, we used calcium photometry to monitor the effect of CB1 activation on intracellular calcium concentration. Perfusion with 5 μM CB1 aminoalkylindole agonist, WIN55,212-2 (WIN), increased intracellular calcium by several hundred nanomolar in human embryonic kidney 293 cells stably expressing CB1 and in cultured hippocampal neurons. The increase was blocked ...

  2. Preclinical evaluation of NETA-based bifunctional ligand for radioimmunotherapy applications using 212Bi and 213Bi: Radiolabeling, serum stability, and biodistribution and tumor uptake studies

    International Nuclear Information System (INIS)

    Introduction: Despite the great potential of targeted α-radioimmunotherapy (RIT) as demonstrated by pre-clinical and clinical trials, limited progress has been made on the improvement of chelation chemistry for 212Bi and 213Bi. A new bifunctional ligand 3p-C-NETA was evaluated for targeted α RIT using 212Bi and 213Bi. Methods: Radiolabeling of 3p-C-NETA with 205/6Bi, a surrogate of 212Bi and 213Bi, was evaluated at pH 5.5 and room temperature. In vitro stability of the 205/6Bi-3p-C-NETA-trastuzumab conjugate was evaluated using human serum (pH 7, 37 °C). Immunoreactivity and specific activity of the 205/6Bi-3p-C-NETA-trastuzumab conjugate were measured. An in vivo biodistribution study was performed to evaluate the in vivo stability and tumor targeting properties of the 205/6Bi-3p-C-NETA-trastuzumab conjugate in athymic mice bearing subcutaneous LS174T tumor xenografts. Result: The 3p-C-NETA-trastuzumab conjugate was extremely rapid in complexing with 205/6Bi, and the corresponding 205/6Bi-3p-C-NETA-trastuzumab was stable in human serum. 205/6Bi-3p-C-NETA-trastuzumab was prepared with a high specific activity and retained immunoreactivity. 205/6Bi-3p-C-NETA-trastuzumab conjugate displayed excellent in vivo stability and targeting as evidenced by low normal organ and high tumor uptake. Conclusion: The results of the in vitro and in vivo studies indicate that 3p-C-NETA is a promising chelator for RIT applications using 212Bi and 213Bi. Further detailed in vivo evaluations of 3p-C-NETA for targeted α RIT are warranted

  3. FDG PET/CT imaging in primary osseous and soft tissue sarcomas: a retrospective review of 212 cases

    Energy Technology Data Exchange (ETDEWEB)

    Charest, Mathieu [Lakeshore General Hospital, Service of Nuclear Medicine, Pointe-Claire (Canada); Hickeson, Marc; Lisbona, Robert; Novales-Diaz, Javier A.; Derbekyan, Vilma [McGill University Health Center, Department of Nuclear Medicine, Montreal (Canada); Turcotte, Robert E. [McGill University Health Center, Department of Orthopedic Surgery, Montreal (Canada)


    The aims of this study are to evaluate the sensitivity of FDG PET/CT for detection of soft tissue and osseous sarcomas on the basis of FDG avidity. We retrospectively evaluated 212 consecutive patients with known soft tissue or osseous sarcoma who had undergone a FDG PET/CT study for the initial staging or assessment of recurrence of disease. The maximum standardized uptake value (SUV{sub max}) of each primary and/or most intense metastatic lesion was measured and compared with the histological data provided in the final pathological reports. An SUV{sub max} of 2.5 or greater was considered positive for our analysis. Sufficient histopathological data were available for 160 soft tissue sarcomas and 52 osseous sarcomas. FDG PET/CT detected 93.9% of all sarcomas with a sensitivity of 93.7% for soft tissue sarcomas and 94.6% for osseous sarcomas. The sensitivities of the most common sarcoma histologies were 100% for leiomyosarcomas, 94.7% for osteosarcomas, 100% for Ewing's sarcomas, 88.9% for liposarcomas, 80.0% for synovial sarcomas, 100% for gastrointestinal stromal tumors, 87.5% for malignant peripheral nerve sheath tumors, 100% for fibroblastic and myoblastic sarcomas, and 100% for malignant fibrohistiocytic tumors. The receiver-operating characteristic curve revealed an area under the curve of 94% for the discrimination of low-grade and high-grade sarcomas imaged for initial staging by FDG PET/CT. The combined metabolic and morphological information of FDG PET/CT imaging allows high sensitivity for the detection of various sarcomas and accurate discrimination between newly diagnosed low-grade and high-grade sarcomas. (orig.)

  4. FDG PET/CT imaging in primary osseous and soft tissue sarcomas: a retrospective review of 212 cases

    International Nuclear Information System (INIS)

    The aims of this study are to evaluate the sensitivity of FDG PET/CT for detection of soft tissue and osseous sarcomas on the basis of FDG avidity. We retrospectively evaluated 212 consecutive patients with known soft tissue or osseous sarcoma who had undergone a FDG PET/CT study for the initial staging or assessment of recurrence of disease. The maximum standardized uptake value (SUVmax) of each primary and/or most intense metastatic lesion was measured and compared with the histological data provided in the final pathological reports. An SUVmax of 2.5 or greater was considered positive for our analysis. Sufficient histopathological data were available for 160 soft tissue sarcomas and 52 osseous sarcomas. FDG PET/CT detected 93.9% of all sarcomas with a sensitivity of 93.7% for soft tissue sarcomas and 94.6% for osseous sarcomas. The sensitivities of the most common sarcoma histologies were 100% for leiomyosarcomas, 94.7% for osteosarcomas, 100% for Ewing's sarcomas, 88.9% for liposarcomas, 80.0% for synovial sarcomas, 100% for gastrointestinal stromal tumors, 87.5% for malignant peripheral nerve sheath tumors, 100% for fibroblastic and myoblastic sarcomas, and 100% for malignant fibrohistiocytic tumors. The receiver-operating characteristic curve revealed an area under the curve of 94% for the discrimination of low-grade and high-grade sarcomas imaged for initial staging by FDG PET/CT. The combined metabolic and morphological information of FDG PET/CT imaging allows high sensitivity for the detection of various sarcomas and accurate discrimination between newly diagnosed low-grade and high-grade sarcomas. (orig.)

  5. Selective lack of tolerance to delayed gastric emptying after daily administration of WIN 55,212-2 in the rat. (United States)

    Abalo, R; Cabezos, P A; López-Miranda, V; Vera, G; González, C; Castillo, M; Fernández-Pujol, R; Martín, M I


    The use of cannabinoids to treat gastrointestinal (GI) motor disorders has considerable potential. However, it is not clear if tolerance to their actions develops peripherally, as it does centrally. The aim of this study was to examine the chronic effects of the cannabinoid agonist WIN 55,212-2 (WIN) on GI motility, as well as those in the central nervous and cardiovascular systems. WIN was administered for 14 days, at either non-psychoactive or psychoactive doses. Cardiovascular parameters were measured in anaesthetized rats, whereas central effects and alterations in GI motor function were assessed in conscious animals using the cannabinoid tetrad and non-invasive radiographic methods, respectively. Tests were performed after first (acute effects) and last (chronic effects) administration of WIN, and 1 week after discontinuing treatment (residual effects). Food intake and body weight were also recorded throughout treatment. Blood pressure and heart rate remained unchanged after acute or chronic administration of WIN. Central activity and GI motility were acutely depressed at psychoactive doses, whereas non-psychoactive doses only slightly reduced intestinal transit. Most effects were reduced after the last administration. However, delayed gastric emptying was not and could, at least partially, account for a concomitant reduction in food intake and body weight gain. The remaining effects of WIN administration in GI motility were blocked by the CB1 antagonist AM 251, which slightly accelerated motility when administered alone. No residual effects were found 1 week after discontinuing cannabinoid treatment. The different systems show differential sensitivity to cannabinoids and tolerance developed at different rates, with delayed gastric emptying being particularly resistant to attenuation upon chronic treatment. PMID:19413685

  6. 21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)


    930403 Family therapy of social psycologic in-tervention and rehabilitation of schizophrenia.KANG Ming(亢明),et al.Dept Psychiatr,3rdPeople’s Hosp,Huaiyin,Jiangsu Prov,223001.Chin J Nerv & Ment Dis 1992;18(5):258—260.Family therapy of social psychologic interven-tion(SPI) was used for the rehabilitation of dis-charged patients with schizophrenia.It was indi-cated that family therapy of SPI had significanteffect on the recovery of social function,im-provement of relation between the patients andmembers of the family,and preventing relapse ofschizophrenia etc.The social function of the

  7. The effect of miR-212 inhibitor on the pain behavior of bone cancer mice%鞘内注射miR-212反义锁核酸对骨癌小鼠痛行为的影响

    Institute of Scientific and Technical Information of China (English)

    侯百灵; 刘玥; 夏天娇; 张羽; 孙蓓; 冷鑫; 周瑜; 倪坤; 顾小萍


    目的 研究骨癌痛发展和维持过程中小鼠脊髓水平miR-212表达的变化规律及连续鞘内注射miR-212反义锁核酸LNA-anti-miR-212对骨癌痛小鼠痛行为的影响.方法 本实验分为两个部分:(一)骨癌痛小鼠脊髓水平miR-212表达的变化规律:C3H/HeJ雄性小鼠36只,随机分为假手术组(sham组,n=18)和肿瘤组(T组,n=18).sham组小鼠在右侧股骨远端骨髓腔注射不含肿瘤细胞的α-MEM,T组小鼠在右侧股骨远端骨髓腔注射纤维肉瘤细胞NCTC 2472,建立骨癌痛模型.在术前1d,术后4d、7d、10 d、14 d、21 d,sham组和T组各随机取三只小鼠处死,取脊髓腰膨大标本,用Real-time PCR的方法检测脊髓水平miR-212的表达情况.(二)连续鞘内注射LNA-anti-miR-212对骨癌痛小鼠痛行为的影响:C3H/HeJ雄性小鼠24只,随机分为四组:L组(鞘内注射LNA-anti-miR-212,n=6)、L’组(鞘内注射LNA'-negative control,n=6)、C组(鞘内注射溶媒无核酸酶水,n=6)和S组(假手术处理,n=6).L组、L’组和C组小鼠在右侧股骨远端注射纤维肉瘤细胞NCTC 2472,S组小鼠在右侧股骨远端骨髓腔注射不含肿瘤细胞的α-MEM.所有小鼠于术前1d、术后4d、7d、10 d、14 d测小鼠痛行为指标,包括自发抬足次数和机械缩足阈值(PWMT),术后14 d,L组、L’组、C组小鼠分别鞘内注射LNA-anti-miR-212 12 pmol/5μl、LNA '-negative control 12 pmol/5μl和无核酸酶水5μl,连续鞘内注射7d,1次/d,每天测小鼠痛行为指标,至术后第21天.结果 miR-212的表达变化表现为:与基础值相比,sham组和T组小鼠在术后第4天,脊髓水平miR-212明显升高(P<0.05);与基础值和sham组相比,T组小鼠脊髓水平miR-212在术后7d、10 d、14 d、21 d均明显升高(P<0.05).连续鞘内注射LNA-anti-miR-212改善骨癌痛小鼠痛行为:术后19 d至21 d,与L’组和C组相比,L组小鼠PWMT[19 d(1.07 ±0.16)g,20 d(1.13±0.21)g,21 d(1.27±0.21)g)]明显升高(P<0.05),

  8. Damage thresholds of various materials irradiated by 100-ps pulses of 21.2-nm laser radiation (United States)

    Hájková, V.; Chalupský, J.; Wabnitz, H.; Feldhaus, J.; Störmer, M.; Hecquet, Ch.; Mocek, T.; Kozlová, M.; Polan, J.; Homer, P.; Rus, B.; Juha, L.


    Irradiation experiments were conducted at Prague Asterix Laser System (PALS) with the Ne-like zinc soft x-ray laser (SXRL) at 21.2 nm (58.5 eV) delivering up to 4 mJ (~4 x 1014 photons), 100-ps pulses in a narrowly collimated beam. The SXRL beam was focused using a 1 inch diameter off-axis parabolic mirror (f = 253 mm at 14 degrees) with a Mo:Si multilayer coating (R = 30% at 21 nm) placed 2825 mm from the SXRL. The diameter of the SXRL beam incident on the mirror was about 11 mm. Ablation experiments with a gradually attenuated beam were performed to determine the single-shot damage threshold of various materials. In this case, the sample was positioned at the tightest focus of the SXRL whose pulse energy was attenuated by aluminum filters of various thickness to adjust the fluence. Both the focal spot area and single-shot damage threshold were determined from the plot of damaged surface areas as a function of a pulse energy logarithm to dete. For PMMA, the focal spot area and the ablation threshold inferred from the data are Sfoc = (1172+/-230) μm2 and Fth = (1.25+/-0.4) J/cm2, respectively. Inorganic materials have thresholds significantly higher than organic polymers, e.g., amorphous and monocrystalline silicon gave values 2.5 J/cm2 and 4.2 J/cm2, respectively. For prospective SASE FEL optical elements, the SiC coating is of great interest. Its damage threshold is of 20 J/cm2, i.e., slightly lower than that of monocrystalline silicon. The thresholds determined with the 100-ps pulses from plasma-based, quasi-steady state SXRL are significantly higher than the thresholds obtained for 20-fs pulses provided by the SXR freeelectron laser in Hamburg. There is a difference in PMMA thresholds of two orders of magnitude for these two sources.

  9. Multi-millijoule, deeply saturated x-ray laser at 21.2 nm for applications in plasma physics

    International Nuclear Information System (INIS)

    We report on the development of a multi-millijoule, ultra high-brightness Ne-like soft x-ray laser (XRL) at the wavelength of 21.2 nm, recently undertaken at the PALS Centre. The device has been implemented as a routine radiation source delivering about 4 mJ of energy in pulses with a duration of ∼100 ps, in a narrowly collimated beam exhibiting high spatial quality and possessing high spatial coherence. The peak power of about 40 MW, generated by this device, is the largest value attained by an XRL to date. The same holds true for the peak spectral brightness, amounting to 1027 photons s-1 mm-2 mrad-2 0.1%BW-1. The active medium consists of a 3 cm long plasma column, sequentially generated from a slab target by an energy of ∼500 J delivered by the iodine 1.315 μm driving laser. The population inversion is produced by focusing tightly down to the line ∼500 J of energy into a much wider preplasma column, which makes it possible to create a lasing medium with a reduced lateral density gradient and thereby to minimize the lateral refraction of the x-ray beam. The multi-millijoule output is generated in double-pass amplification regime, achieved by a carefully designed half cavity using a flat multilayer Mo : Si mirror positioned a few millimetres near the plasma end. We describe the measured characteristics of the output beam generated by double-pass amplification, and illustrate its spatial beam coherence obtained using a Fresnel wavefront splitting interferometer. Given the available energy, peak power and brightness in a single pulse, the demonstrated XRL constitutes a tool for novel applications in both solid state and plasma physics. Examples of such applications are the generation of high-energy density, low-temperature plasmas relevant to laboratory astrophysics, x-ray interferometry of plasmas and solids with spatial resolution ranging from a micron to a few nanometres according to the specific experimental arrangement, or study of soft x

  10. Multi-millijoule, deeply saturated x-ray laser at 21.2 nm for applications in plasma physics

    Energy Technology Data Exchange (ETDEWEB)

    Rus, B [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Mocek, T [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Praeg, A R [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Kozlova, M [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Hudecek, M [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Jamelot, G [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Carillon, A [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Ros, D [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Lagron, J-C [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Joyeux, D [Institut d' Optique Theorique et Appliquee, Laboratoire Charles Fabry, Batiment 503, Universite Paris-Sud, 91403 Orsay (France); Phalippou, D [Institut d' Optique Theorique et Appliquee, Laboratoire Charles Fabry, Batiment 503, Universite Paris-Sud, 91403 Orsay (France)


    We report on the development of a multi-millijoule, ultra high-brightness Ne-like soft x-ray laser (XRL) at the wavelength of 21.2 nm, recently undertaken at the PALS Centre. The device has been implemented as a routine radiation source delivering about 4 mJ of energy in pulses with a duration of {approx}100 ps, in a narrowly collimated beam exhibiting high spatial quality and possessing high spatial coherence. The peak power of about 40 MW, generated by this device, is the largest value attained by an XRL to date. The same holds true for the peak spectral brightness, amounting to 10{sup 27} photons s{sup -1} mm{sup -2} mrad{sup -2} 0.1%BW{sup -1}. The active medium consists of a 3 cm long plasma column, sequentially generated from a slab target by an energy of {approx}500 J delivered by the iodine 1.315 {mu}m driving laser. The population inversion is produced by focusing tightly down to the line {approx}500 J of energy into a much wider preplasma column, which makes it possible to create a lasing medium with a reduced lateral density gradient and thereby to minimize the lateral refraction of the x-ray beam. The multi-millijoule output is generated in double-pass amplification regime, achieved by a carefully designed half cavity using a flat multilayer Mo : Si mirror positioned a few millimetres near the plasma end. We describe the measured characteristics of the output beam generated by double-pass amplification, and illustrate its spatial beam coherence obtained using a Fresnel wavefront splitting interferometer. Given the available energy, peak power and brightness in a single pulse, the demonstrated XRL constitutes a tool for novel applications in both solid state and plasma physics. Examples of such applications are the generation of high-energy density, low-temperature plasmas relevant to laboratory astrophysics, x-ray interferometry of plasmas and solids with spatial resolution ranging from a micron to a few nanometres according to the specific experimental

  11. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression (United States)

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan; Michailidou, Kyriaki; Nord, Silje; Kar, Siddhartha; Humphreys, Keith; Thompson, Deborah; Ghoussaini, Maya; Bolla, Manjeet K.; Dennis, Joe; Wang, Qin; Canisius, Sander; Scott, Christopher G.; Apicella, Carmel; Hopper, John L.; Southey, Melissa C.; Stone, Jennifer; Broeks, Annegien; Schmidt, Marjanka K.; Scott, Rodney J.; Lophatananon, Artitaya; Muir, Kenneth; Beckmann, Matthias W.; Ekici, Arif B.; Fasching, Peter A.; Heusinger, Katharina; dos-Santos-Silva, Isabel; Peto, Julian; Tomlinson, Ian; Sawyer, Elinor J.; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E.; Flyger, Henrik; Benitez, Javier; González-Neira, Anna; Anton-Culver, Hoda; Neuhausen, Susan L.; Arndt, Volker; Brenner, Hermann; Engel, Christoph; Meindl, Alfons; Schmutzler, Rita K.; Arnold, Norbert; Brauch, Hiltrud; Hamann, Ute; Chang-Claude, Jenny; Khan, Sofia; Nevanlinna, Heli; Ito, Hidemi; Matsuo, Keitaro; Bogdanova, Natalia V.; Dörk, Thilo; Lindblom, Annika; Margolin, Sara; Kosma, Veli-Matti; Mannermaa, Arto; Tseng, Chiu-chen; Wu, Anna H.; Floris, Giuseppe; Lambrechts, Diether; Rudolph, Anja; Peterlongo, Paolo; Radice, Paolo; Couch, Fergus J.; Vachon, Celine; Giles, Graham G.; McLean, Catriona; Milne, Roger L.; Dugué, Pierre-Antoine; Haiman, Christopher A.; Maskarinec, Gertraud; Woolcott, Christy; Henderson, Brian E.; Goldberg, Mark S.; Simard, Jacques; Teo, Soo H.; Mariapun, Shivaani; Helland, Åslaug; Haakensen, Vilde; Zheng, Wei; Beeghly-Fadiel, Alicia; Tamimi, Rulla; Jukkola-Vuorinen, Arja; Winqvist, Robert; Andrulis, Irene L.; Knight, Julia A.; Devilee, Peter; Tollenaar, Robert A.E.M.; Figueroa, Jonine; García-Closas, Montserrat; Czene, Kamila; Hooning, Maartje J.; Tilanus-Linthorst, Madeleine; Li, Jingmei; Gao, Yu-Tang; Shu, Xiao-Ou; Cox, Angela; Cross, Simon S.; Luben, Robert; Khaw, Kay-Tee; Choi, Ji-Yeob; Kang, Daehee; Hartman, Mikael; Lim, Wei Yen; Kabisch, Maria; Torres, Diana; Jakubowska, Anna; Lubinski, Jan; McKay, James; Sangrajrang, Suleeporn; Toland, Amanda E.; Yannoukakos, Drakoulis; Shen, Chen-Yang; Yu, Jyh-Cherng; Ziogas, Argyrios; Schoemaker, Minouk J.; Swerdlow, Anthony; Borresen-Dale, Anne-Lise; Kristensen, Vessela; French, Juliet D.; Edwards, Stacey L.; Dunning, Alison M.; Easton, Douglas F.; Hall, Per; Chenevix-Trench, Georgia


    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,893 Asian case and control subjects from the Breast Cancer Association Consortium. We identified four independent sets of correlated, highly trait-associated variants (iCHAVs), three of which were located within ZNF365. The most strongly risk-associated SNP, rs10995201 in iCHAV1, showed clear evidence of association with both estrogen receptor (ER)-positive (OR = 0.85 [0.82–0.88]) and ER-negative (OR = 0.87 [0.82–0.91]) disease, and was also the SNP most strongly associated with percent mammographic density. iCHAV2 (lead SNP, chr10: 64,258,684:D) and iCHAV3 (lead SNP, rs7922449) were also associated with ER-positive (OR = 0.93 [0.91–0.95] and OR = 1.06 [1.03–1.09]) and ER-negative (OR = 0.95 [0.91–0.98] and OR = 1.08 [1.04–1.13]) disease. There was weaker evidence for iCHAV4, located 5′ of ADO, associated only with ER-positive breast cancer (OR = 0.93 [0.90–0.96]). We found 12, 17, 18, and 2 candidate causal SNPs for breast cancer in iCHAVs 1–4, respectively. Chromosome conformation capture analysis showed that iCHAV2 interacts with the ZNF365 and NRBF2 (more than 600 kb away) promoters in normal and cancerous breast epithelial cells. Luciferase assays did not identify SNPs that affect transactivation of ZNF365, but identified a protective haplotype in iCHAV2, associated with silencing of the NRBF2 promoter, implicating this gene in the etiology of breast cancer. PMID:26073781

  12. Radioimmunoscintigraphy of colorectal carcinoma using technetium-99m-labeled, totally human monoclonal antibody 88BV59H21-2. (United States)

    Gulec, S A; Serafini, A N; Moffat, F L; Vargas-Cuba, R D; Sfakianakis, G N; Franceschi, D; Crichton, V Z; Subramanian, R; Klein, J L; De Jager, R L


    Radioimmunoscintigraphy (RIS) using human monoclonal antibodies offers the important clinical advantage of repeated imaging over murine monoclonal antibodies by eliminating the cross-species antibody response. This article reports a Phase I-II clinical trial with Tc-99m-labeled, totally human monoclonal antibody 88BV59H21-2 in patients with colorectal carcinoma. The study population consisted of 34 patients with colorectal cancer (20 men and 14 women; age range, 44-81 years). Patients were administered 5-10 mg antibody labeled with 21-41 mCi Tc-99m by the i.v. route and imaged at 3-10 and 16-24 h after infusion using planar and single-photon emission computed tomographic (CT) techniques. Pathological confirmation was obtained in 25 patients who underwent surgery. Human antihuman antibody (HAHA) titers were checked prior to and 1 and 3 months after the infusion. RIS with Tc-99m-labeled 88BV59H21-2 revealed a better detection rate in the abdomen-pelvis region compared with axial CT. The combined use of both modalities increased the sensitivity in both the liver and abdomen-pelvis regions. Ten patients developed mild adverse reactions (chills and fever). No HAHA response was detected in this series. Tc-99m-labeled human monoclonal antibody 88BV59H21-2 RIS shows promise as a useful diagnostic modality in patients with colorectal cancer. RIS alone or in combination with CT is more sensitive than CT in detecting tumor within the abdomen and pelvis. Repeated RIS studies may be possible, due to the lack of a HAHA response. PMID:7493345

  13. Étude des dommages induits dans l'ADN par irradiation laser X-UV à 21.2 nm (United States)

    Cassou, K.; Ros, D.; Kazamias, S.; Klisnick, A.; Jamelot, G.; Guilbaud, O.; Rus, B.; Kozlová, M.; Polan, J.; Präg, A. R.; Stupka, M.; Eot-Houllier, G.; Sage, E.; Begusová, M.; Stísová, V.; Du Penhoat, M.-A. H.; Touati, A.; Chétioui, A.


    We report the preliminary result of the application of the collisional Ne-like soft x-ray laser as radiation source to induce DNA damage. The goal of this experiment was a test bed study of the damage yields induced by soft x-ray radiation in dried plasmid DNA sample. The saturated Ne-like soft x-ray laser available at the PALS facility, delivering several millijoules in a single 100 ps pulse at 21.2 nm was used to irradiate two different plasmids: pSP189 and pBS. The study is centered on the dose effect leading to single and double strand break in DNA.

  14. Cell Killing Mechanisms and Impact on Gene Expression by Gemcitabine and 212Pb-Trastuzumab Treatment in a Disseminated i.p. Tumor Model (United States)

    Yong, Kwon Joong; Milenic, Diane E.; Baidoo, Kwamena E.; Brechbiel, Martin W.


    In pre-clinical studies, combination therapy with gemcitabine and targeted radioimmunotherapy (RIT) using 212Pb-trastuzumab showed tremendous therapeutic potential in the LS-174T tumor xenograft model of disseminated intraperitoneal disease. To better understand the underlying molecular basis for the observed cell killing efficacy, gene expression profiling was performed after a 24 h exposure to 212Pb-trastuzumab upon gemcitabine (Gem) pre-treatment in this model. DNA damage response genes in tumors were quantified using a real time quantitative PCR array (qRT-PCR array) covering 84 genes. The combination of Gem with α-radiation resulted in the differential expression of apoptotic genes (BRCA1, CIDEA, GADD45α, GADD45γ, IP6K3, PCBP4, RAD21, and p73), cell cycle regulatory genes (BRCA1, CHK1, CHK2, FANCG, GADD45α, GTSE1, PCBP4, MAP2K6, NBN, PCBP4, and SESN1), and damaged DNA binding and repair genes (BRCA1, BTG2, DMC1, ERCC1, EXO1, FANCG, FEN1, MSH2, MSH3, NBN, NTHL1, OGG1, PRKDC, RAD18, RAD21, RAD51B, SEMA4G, p73, UNG, XPC, and XRCC2). Of these genes, the expression of CHK1, GTSE1, EXO1, FANCG, RAD18, UNG and XRCC2 were specific to Gem/212Pb-trastuzumab administration. In addition, the present study demonstrates that increased stressful growth arrest conditions induced by Gem/212Pb-trastuzumab could suppress cell proliferation possibly by up-regulating genes involved in apoptosis such as p73, by down-regulating genes involved in cell cycle check point such as CHK1, and in damaged DNA repair such as RAD51 paralogs. These events may be mediated by genes such as BRCA1/MSH2, a member of BARC (BRCA-associated genome surveillance complex). The data suggest that up-regulation of genes involved in apoptosis, perturbation of checkpoint genes, and a failure to correctly perform HR-mediated DSB repair and mismatch-mediated SSB repair may correlate with the previously observed inability to maintain the G2/M arrest, leading to cell death. PMID:27467592

  15. Measuring Progress on the Control of Porcine Reproductive and Respiratory Syndrome (PRRS at a Regional Level: The Minnesota N212 Regional Control Project (Rcp as a Working Example.

    Directory of Open Access Journals (Sweden)

    Pablo Valdes-Donoso

    Full Text Available Due to the highly transmissible nature of porcine reproductive and respiratory syndrome (PRRS, implementation of regional programs to control the disease may be critical. Because PRRS is not reported in the US, numerous voluntary regional control projects (RCPs have been established. However, the effect of RCPs on PRRS control has not been assessed yet. This study aims to quantify the extent to which RCPs contribute to PRRS control by proposing a methodological framework to evaluate the progress of RCPs. Information collected between July 2012 and June 2015 from the Minnesota Voluntary Regional PRRS Elimination Project (RCP-N212 was used. Demography of premises (e.g. composition of farms with sows = SS and without sows = NSS was assessed by a repeated analysis of variance. By using general linear mixed-effects models, active participation of farms enrolled in the RCP-N212, defined as the decision to share (or not to share PRRS status, was evaluated and used as a predictor, along with other variables, to assess the PRRS trend over time. Additionally, spatial and temporal patterns of farmers' participation and the disease dynamics were investigated. The number of farms enrolled in RCP-N212 and its geographical coverage increased, but the proportion of SS and NSS did not vary significantly over time. A significant increasing (p<0.001 trend in farmers' decision to share PRRS status was observed, but with NSS producers less willing to report and a large variability between counties. The incidence of PRRS significantly (p<0.001 decreased, showing a negative correlation between degree of participation and occurrence of PRRS (p<0.001 and a positive correlation with farm density at the county level (p = 0.02. Despite a noted decrease in PRRS, significant spatio-temporal patterns of incidence of the disease over 3-weeks and 3-kms during the entire study period were identified. This study established a systematic approach to quantify the effect of RCPs on

  16. 3种微创手术治疗复杂性输尿管上段结石212例比较%A comparison of three surgical procedures of complicated upper ureteral calculi for 212 cases

    Institute of Scientific and Technical Information of China (English)

    李旭明; 程洪林; 郭闯; 程宗勇; 李锋; 张力; 李元仲


    Objective To compare the efficacy of three procedures, ureteroscopic litripsy(URL), minimally invasive percutaneous nephrolithotomy(MPCNL) ,and retroperitoneal laparoscopic ureterolithomy(RLU), for the treatment of complicated upper ureteral calculi. Methods Two hundred and thirteen cases of complicated upper ureteral calculi were treated in this hospital from February 2002 to February 2010,including fifty-two cases of URL, one hundred and seven cases of MPCNL, and fifty-four cases of RLU. Results The stone free rate seven days after operation:URL was 36.5%(19/52),MPCNL was 75.7%(81/107),RLU was 90.6% (48/53); the stone free rate one months after operation: URL was 71. 1% (38/52), MPCNL was 95. 3% (102/107), RLU was 96.2%(51/53); the stone-free rate three months after operation:URL was 82.7%(43/52),MPCNL was 98. 1%(105/107),RLU was 98.1%(52/53). There was significantly difference between URL and MPCNL(P<0.05) ,URL and RLU (P<0.05). There was also significantly difference between MPCNL and RLU in the near future(P<0. 05) ,but had no difference in long term. Conclusion High stone free rate can be obtained with RLU and MPCNL for impacted upper ureteral calculi. The stone-free rate is less satisfactory with URL.%目的 比较输尿管镜碎石(URL)、微创经皮肾镜取石(MPCNL)、后腹腔镜下输尿管切开取石(RLU)治疗复杂性输尿管上段结石的疗效.方法 回顾分析2002年2月至2010年2月复杂性输尿管上段结石212例,其中URL治疗52例,MPCNL治疗107例,RLU治疗54例.比较分析3种手术的治疗效果.结果 术后7 d结石清除率:URL组36.5%(19/52),MPCNL组75.7%(81/107),RLU组90.6%(48/53).术后1个月结石清除率:URL组73.1%(38/52),MPCNL组95.3%(102/107),RLU组96.2%(51/53).术后3个月结石清除率:URL组82.7%(43/52),MPCNL组98.1%(105/107),RLU组98.1%(52/53).URL组分别与MPCNL组、RLU组比较差异有统计学意义(P<0.05),MPCNL、RLU组之间比较近期差异有统计学意义(P<0.05),

  17. Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia (United States)

    Papaemmanuil, Elli; Hosking, Fay J; Vijayakrishnan, Jayaram; Price, Amy; Olver, Bianca; Sheridan, Eammon; Kinsey, Sally E; Lightfoot, Tracy; Roman, Eve; Irving, Julie A E; Allan, James M.; Tomlinson, Ian P; Taylor, Malcolm; Greaves, Mel; Houlston, Richard S


    To identify risk variants for childhood acute lymphoblastic leukemia (ALL) we conducted a genome-wide association study of 2 case-control series, analyzing the genotypes of 291,423 tagging SNP genotypes in a total of 907 ALL cases and 2,398 controls. We identified risk loci for ALL at 7p12.2 (IKZF1, rs4132601; OR = 1.69, P = 1.20 x 10-19), 10q21.2 (ARIDB5, rs7089424; OR = 1.65, P = 6.69 x 10-19) and 14q11.2 (CEBPE, rs2239633; OR = 1.34, P = 2.88 x 10-7). The 10q21.2 (ARIDB5) risk association appears to be selective for the subset of B-cell precursor ALL with hyperdiploidy. These data show that common low-penetrance susceptibility alleles contribute to the risk of developing childhood ALL and provide novel insight into disease causation of this hematological cancer; notably all 3 risk variants map to genes involved in transcriptional regulation and differentiation of B-cell progenitors. PMID:19684604

  18. 13CO2/12CO2 ratio analysis in exhaled air by lead-salt tunable diode lasers for noninvasive diagnostics in gastroenterology (United States)

    Stepanov, Eugene V.; Zyrianov, Pavel V.; Miliaev, Valerii A.; Selivanov, Yurii G.; Chizhevskii, Eugene G.; Os'kina, Svetlana; Ivashkin, Vladimir T.; Nikitina, Elena I.


    An analyzer of 13CO2/12CO2 ratio in exhaled air based on lead-salt tunable diode lasers is presented. High accuracy of the carbon isotope ratio detection in exhaled carbon dioxide was achieved with help of very simple optical schematics. It was based on the use of MBE laser diodes operating in pulse mode and on recording the resonance CO2 absorption at 4.2 micrometers . Special fast acquisition electronics and software were applied for spectral data collection and processing. Developed laser system was tested in a clinical train aimed to assessment eradication efficiency in therapy of gastritis associated with Helicobacter pylori infection. Data on the 13C-urea breath test used for P.pylori detection and obtained with tunable diode lasers in the course of the trail was compared with the results of Mass-Spectroscopy analysis and histology observations. The analyzer can be used also for 13CO2/12CO2 ratio detection in exhalation to perform gastroenterology breath test based on using other compounds labeled with stable isotopes.

  19. Inherited Tandem Duplication of the X Chromosome: Dup(X(q13.2-q21.2 in a Family.

    Directory of Open Access Journals (Sweden)

    Jia-Woei Hou


    Full Text Available A 2-year-old boy who was failing to thrive and who had multiple anomalies was found tohave a maternally derived tandem duplication of the long arm of the X chromosome:dup(X(q13.2-q21.2. The karyotyping interpretation was further confirmed by fluorescencein situ hybridization studies in which a double gene dosage of the X-inactivation-specifictranscript (gene locus on Xq13.2 and a whole chromosome X painting on the abnormal Xwere noted. He suffered from hypotonia, gastroesophageal reflux, laryngomalacia, recurrentinfections, immunodeficiency (IgG4 deficiency, dysgenesis of the corpus callosum, proximalrenal tubular acidosis, and nephrolithiasis. His mother and elder sister also had the samerearrangement, the dup(X, on one of their X chromosomes. However, the mother was ingood health, but the sister suffered from nephrolithiasis. The clinical variability in this familywith the Xq duplication is reported and discussed.

  20. Differential effects of repeated low dose treatment with the cannabinoid agonist WIN 55,212-2 in experimental models of bone cancer pain and neuropathic pain

    DEFF Research Database (Denmark)

    Hald, Andreas; Ding, Ming; Egerod, Kristoffer Lihme;


    Pain due to bone malignancies is one of the most difficult types of cancer pain to fully control and may further decrease the patients' quality of life. Animal models of chronic pain conditions resulting from peripheral inflammatory reactions or nerve injuries are responsive to treatment with....... Furthermore, this treatment strategy was not found to induce measurable CNS related side effects or tolerance. Cancer cell viability assays and bone volume fraction assessed by micro computed tomography (microCT) demonstrated that these effects were not due to changes in cancer progression. The difference in...... cannabinoid agonists. However, the use of cannabinoid agonists in humans may be hampered by CNS related side effects and development of tolerance. In the present study, we investigated the effect of repeated low dose administration of the synthetic cannabinoid agonist WIN 55,212-2 on bone cancer pain and...

  1. A Deep X-ray look at a very massive star: HETGS spectroscopy of the blue hypergiant Cyg OB2-12 (HIP 101364) (United States)

    Huenemoerder, David; Oskinova, Lidia; Ignace, Richard; Hamann, Wolf-Rainer; Schulz, Norbert S.; neilson, hilding; Shenar, Tomer


    We have obtained a Chandra/HETGS spectrum of one of the most massive and luminous stars in the Galaxy: the blue hypergiant Cyg OB2-12 (HIP 101364, spectral type B3 Ia+). This is the first measurement at high resolution of X-ray spectral lines in a blue hypergiant and allows comparison of X-ray properties between massive stars at different but related evolutionary stages: O-type supergiants, luminous blue variables, Wolf-Rayet stars, and blue hypergiants stars. The new data provide a look at how the most massive stars shed mass during their pre-supernova evolution. We find that In Cyg OB2-12 the resolved Si and Mg lines are broadened by about 1000 km/s (FWHM). The lines, however, do not show appreciable centroid shifts (<100 km/s), which would be much larger for canonical moderately thick winds (~500 km/s). The He-like Mg XI lines show evidence of photo-excitation, implying a wind origin close to the UV-bright photosphere. The spectrum also indicates relatively high temperature plasma, up to 22 MK (1.9 keV), showing significant continuum and emission lines below 5A (above 2.5 keV). Hence, at first glance, the spectrum resembles neither an O-star thick wind, nor a magnetically confined (narrow-line) plasma. We will present more detailed wind models using both X-ray and UV spectra to constrain fundamental physical parameters of this star.

  2. Treatment of Advanced Non Small Cell Lung Cancer in Routine Care: A Retrospective Analysis of 212 Consecutive Patients Treated in a Community Based Oncology Group Practice

    Directory of Open Access Journals (Sweden)

    Hubert Koeppler


    Full Text Available Treatment outcome data generated in prospective trials are intrinsically biased due to necessary selection criteria. Therefore the results obtained may not reflect the actual impact of current treatment options for an unselected general population. We analysed the treatment modalities and the outcome in 212 consecutive patients with non small cell lung cancer stages IIIB and IV who were seen in a community based oncology group practice between 6/1995 and 6/2006. 93 presented with stage IIIB and 119 with stage IV. Chemotherapy was given to 194/212 patients (92%, 114 patients (54% received palliative radiation at one point during treatment. Treatment consisted of chemotherapy only in 86 patients (40% and radiation only in 6 patients. 12 patients received best supportive care only. Patients with stage IIIB have survival rates at 12, 24 and 36 months of 64%, 27% and 21% respectively and for patients with stage IV the survival rates at 12, 24 and 36 months are 40%, 19% and 11% respectively. The median survival for stages IIIB and IV is 16 and 11 months respectively. In a multivariate analysis incorporating the factors stage (IIIB vs. IV, age (70 vs. 70 years and performance status (WHO 0/1 vs. 2/3 only stage and performance status were independent factors for survival. These retrospective data concerning analysis of survival , response rates and toxicity in a community setting confirm published results of phase II-III studies and indicate that results generated in prospective trials can be transferred into routine care.

  3. A specific Ce oxidation process during sorption of rare earth elements on biogenic Mn oxide produced by Acremonium sp. strain KR21-2 (United States)

    Tanaka, Kazuya; Tani, Yukinori; Takahashi, Yoshio; Tanimizu, Masaharu; Suzuki, Yoshinori; Kozai, Naofumi; Ohnuki, Toshihiko


    Sorption of rare earth elements (REEs) and Ce oxidation on natural and synthetic Mn oxides have been investigated by many researchers. Although Mn(II)-oxidizing microorganisms are thought to play an important role in the formation of Mn oxides in most natural environments, Ce oxidation by biogenic Mn oxide and the relevance of microorganisms to the Ce oxidation process have not been well understood. Therefore, in this study, we conducted sorption experiments of REEs on biogenic Mn oxide produced by Acremonium sp. strain KR21-2. The distribution coefficients, Kd(REE), between biogenic Mn oxide (plus hyphae) and 10 mmol/L NaCl solution showed a large positive Ce anomaly and convex tetrad effect variations at pH 3.8, which was consistent with previous works using synthetic Mn oxide. The positive Ce anomaly was caused by oxidation of Ce(III) to Ce(IV) by the biogenic Mn oxide, which was confirmed by analysis of the Ce L III-edge XANES spectra. With increasing pH, the positive Ce anomaly and convex tetrad effects became less pronounced. Furthermore, negative Ce anomalies were observed at a pH of more than 6.5, suggesting that Ce(IV) was stabilized in the solution (HPLC-ICP-MS showed that some fractions of REEs in the filtrates (<0.2 μm) after sorption experiments were bound to organic molecules (40 and <670 kDa fractions), which were possibly released from hyphae. A line of our data indicates that the negative Ce anomalies under circumneutral pH conditions arose from Ce(III) oxidation on the biogenic Mn oxide and subsequent complexation of Ce(IV) with organic ligands. The suppression of tetrad effects is also explained by the complexation of REEs with organic ligands. The results of this study demonstrate that the coexistence of the biogenic Mn oxide and hyphae of strain KR21-2 produces a specific redox chemistry which cannot be explained by inorganic species.

  4. The jet and the disk of the HH 212 low-mass protostar imaged by ALMA: SO and SO2 emission (United States)

    Podio, L.; Codella, C.; Gueth, F.; Cabrit, S.; Bachiller, R.; Gusdorf, A.; Lee, C.-F.; Lefloch, B.; Leurini, S.; Nisini, B.; Tafalla, M.


    Context. The investigation of the disk formation and jet launching mechanism in protostars is crucial to understanding the earliest stages of star and planet formation. Aims: We aim to constrain the physical and dynamical properties of the molecular jet and disk of the HH 212 protostellar system at unprecedented angular scales, exploiting the capabilities of the Atacama Large Millimeter Array (ALMA). Methods: The ALMA observations of HH 212 in emission lines from sulfur-bearing molecules, SO 98-87, SO 1011-1010, SO282,6-71,7, are compared with simultaneous CO 3-2, SiO 8-7 data. The molecules column density and abundance are estimated using simple radiative transfer models. Results: SO 98-87 and SO282,6-71,7 show broad velocity profiles. At systemic velocity, they probe the circumstellar gas and the cavity walls. Going from low to high blue- and red-shifted velocities the emission traces the wide-angle outflow and the fast (~100-200 km s-1), collimated (~90 AU) molecular jet revealing the inner knots with timescales ≤50 yr. The jet transports a mass-loss rate ≥ 0.2-2 × 10-6 M⊙ yr-1, implying high ejection efficiency (≥ 0.03-0.3). The SO and SO2 abundances in the jet are ~ 10-7-10-6. SO 1011-1010 emission is compact and shows small-scale velocity gradients, indicating that it originates partly from the rotating disk previously seen in HCO+ and C17O, and partly from the base of the jet. The disk mass is ≥ 0.002-0.013 M⊙ and the SO abundance in the disk is ~ 10-8-10-7. Conclusions: SO and SO2 are effective tracers of the molecular jet in the inner few hundreds AU from the protostar. Their abundances indicate that 1-40% of sulfur is in SO and SO2 due to shocks in the jet/outflow and/or to ambipolar diffusion at the wind base. The SO abundance in the disk is 3-4 orders of magnitude larger than in evolved protoplanetary disks. This may be due to an SO enhancement in the accretion shock at the envelope-disk interface or in spiral shocks if the disk is partly

  5. The enhancement of 21.2%-power conversion efficiency in polymer photovoltaic cells by using mixed Au nanoparticles with a wide absorption spectrum of 400 nm-1000 nm

    Institute of Scientific and Technical Information of China (English)

    郝敬昱; 徐颖; 张玉佩; 陈淑芬; 李兴鳌; 汪联辉; 黄维


    Au nanoparticles (NPs) mixed with a majority of bone-like, rod, and cube shapes and a minority of irregu-lar spheres, which can generate a wide absorption spectrum of 400 nm–1000 nm and three localized surface plas-mon resonance peaks, respectively, at 525, 575, and 775 nm, are introduced into the hole extraction layer poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) to improve optical-to-electrical conversion performances in polymer photovoltaic cells. With the doping concentration of Au NPs optimized, the cell performance is significantly improved: the short-circuit current density and power conversion efficiency of the poly(3-hexylthiophene): [6,6]-phenyl-C60-butyric acid methyl ester cell are increased by 20.54%and 21.2%, reaching 11.15 mA·cm−2 and 4.23%. The variations of optical, electrical, and morphology with the incorporation of Au NPs in the cells are analyzed in detail, and our results demonstrate that the cell performance improvement can be attributed to a synergistic reaction, including:1) both the local-ized surface plasmon resonance-and scattering-induced absorption enhancement of the active layer, 2) Au doping-induced hole transport/extraction ability enhancement, and 3) large interface roughness-induced efficient exciton dissociation and hole collection.

  6. Comprehensive study on the structure of the BSA from extended-to aged form in wide (2-12) pH range. (United States)

    Varga, N; Hornok, V; Sebők, D; Dékány, I


    In this work we studied the structure of the bovine serum albumin (BSA) and the protein-ligand interactions since researchers prefer to use them as carriers in drug delivery systems. Systematic study (between pH 2-12, in double distilled water and physiological salt solution) was carried out to determine the changes in the secondary and the tertiary structures of the BSA, the apparent molecular weight (Mw), the size (dLS) and the electrokinetic potential (ζ). At pH 7, the BSA has higher stability in the absence (ζ=-69mV, dLS=2.2nm, A2=1.4×10(-3)mlmol/g(2)) than in the presence of salt solution (ζ=-2.4mV, dLS=5.3nm, A2=-3.2×10(-4)mlmol/g(2)). The Mw strongly depends on the pH and the ionic strength (at pH 3 in the absence of salt, the Mw is 54.6kDa while in the presence of salt is 114kDa) which determines the geometry of the protein. The protein-ligand interactions were characterized by fluorescence (FL) and isothermal microcalorimetry (ITC) methods; these independent techniques provided similar thermodynamic parameters such as the binding constant (K) and the Gibbs free energy (ΔG). PMID:26995614

  7. Family paracentric inversion of the short arm of chromosome X (Xp21.2p11.23 and connection with autism spectrum disorders

    Directory of Open Access Journals (Sweden)

    Pejović-Milovančević Milica


    Full Text Available Introduction. Autism spectrum disorders (ASDs are a group of complex pervasive developmental disorders characterized by impairments in communication, social interaction and behavior. In most cases autism is caused by a combination of genetic factors and environmental risk factors. In 10% to 20% of cases it has been shown that the cause of ASD is genetic. Case Outline. We are describing a 2-year-old boy who was referred to genetic counseling because of speech delay and certain autism-like behavior. By cytogenetic analysis the karyotype 46, inv(X,Y was obtained. The boy was a carrier of a paracentric inversion of the short arm of the chromosome X. After cytogenetic analysis of parental blood, it was detected that mother was a carrier of identical aberration, but had no clinical signs. The method of fluorescent in situ hybridization (FISH yielded the precise breakpoint in the region (p21.2p11.23. Mother and son were carriers of identical X chromosome. Conclusion. Breakpoints are located in the regions that have already been linked to autism, which indicates that the positional effect of the gene could have been a possible cause of the patient’s genotype. In addition to positional effects, in order to better understand the etiology of autism other genetic and environmental factors should be always taken into consideration. [Projekat Ministarstva nauke Republike Srbije, br. ON175013

  8. Oxidation behaviour of ferritic stainless steel grade Crofer 22 APU at 700 °C in flowing Ar-75%CO2-12%H2O (United States)

    Shariff, Nurul Atikah; Othman, Norinsan Kamil; Jalar, Azman


    The oxidation of Ferritic Stainless Steel (FSS) grade Crofer 22 APU has been investigated. FSS alloys were exposed to isothermal conditions in a horizontal tube furnace at a 700 °C in flowing Ar-75%CO2-12%H2O at a pressure of approximately 1 atm. The results showed that the growth of non protective Fe2O3 and spinel was observed after 50 h exposure in the presence of 12% H2O. The weight was increased significantly with time of exposure. The formation of different oxides is presented on the interface of the specimen such as MnCr2O4, Fe3O4 and Fe2O3 were revealed by X-ray diffraction and supported by EDAX analysis. FSS did not form a protective Cr2O3 layer due to water vapour accelerates the kinetics oxidation. Data of microstructure observation is presented and discussed in this paper in term of water vapour effects.

  9. The jet and the disk of the HH 212 low-mass protostar imaged by ALMA: SO and SO2 emission

    CERN Document Server

    Podio, L; Gueth, F; Cabrit, S; Bachiller, R; Gusdorf, A; Lee, C -F; Lefloch, B; Leurini, S; Nisini, B; Tafalla, M


    To investigate the disk formation and jet launch in protostars is crucial to comprehend the earliest stages of star and planet formation. We aim to constrain the properties of the molecular jet and the disk of the HH 212 protostellar system at unprecedented angular scales through ALMA observations of sulfur-bearing molecules, SO 9(8)-8(7), SO 10(11)-10(10), SO2 8(2,6)-7(1,7). SO 9(8)-8(7) and SO2 8(2,6)-7(1,7) show broad velocity profiles. At systemic velocity they probe the circumstellar gas and the cavity walls. Going from low to high blue-/red-shifted velocities the emission traces the wide-angle outflow and the fast (~100-200 km/s) and collimated (~90 AU) molecular jet revealing the inner knots with timescales 0.2-2e-6 Msun/yr, implying high ejection efficiency (>0.03-0.3). The SO and SO2 abundances in the jet are ~1e-7-1e-6. SO 10(11)-10(10) emission is compact and shows small-scale velocity gradients indicating that it originates partly from the rotating disk previously seen in HCO+ and C17O, and partly...

  10. Decontamination and decommissioning of 61 plutonium gloveboxes in D-Wing, Building 212 Argonne National Laboratory-East: Final project report

    International Nuclear Information System (INIS)

    Argonne National Laboratory-East (ANL-E) is a government-owned, contractor operated, multipurpose research facility located 25 miles southwest of downtown Chicago on 689 hectares (1,700 acres) in DuPage County, Illinois, as shown in Figure 1.1. Building 212 is located in the central area of ANL-E, as shown in Figure 1.2. The purpose of this project was to eliminate the risk of radioactive material release from the contaminated glovebox systems and to make the laboratories available for unrestricted use. The following work objectives were established: (1) Identify and remove radioactive materials for return to ANL-E Special Materials control. (2) Remove and package the radioactively contaminated materials and equipment from the gloveboxes. (3) Decontaminate the gloveboxes to nontransuranic (non-TRU) levels. (4) Size-reduce and package the gloveboxes and support systems. (5) Document and dispose of the radioactive and mixed waste. (6) Decontaminate, survey, and release the nine laboratories and corridor areas for unrestricted use

  11. Charge-state dependence of M-shell x-ray production in 67Ho by 2--12-MeV carbon ions

    International Nuclear Information System (INIS)

    Charge-state dependence of M-shell x-ray production cross sections of 67Ho bombarded by 2--12-MeV carbon ions, with and without K-shell vacancies, were measured using a windowless Si(Li) x-ray detector with a full-width-at-half-maximum resolution of 135 eV at 5.9 keV. Carbon ions of different charge states were produced using a postacceleration, nitrogen gas stripping cell. The carbon ions were then magnetically analyzed to select the desired charge state and energy before entering the target chamber. The total M-shell and Mζ, Mα,β, and Mγ x-ray cross sections were measured. The electron-capture (EC) contributions as well as the direct-ionization (DI) contributions can be determined by making a comprehensive study of the projectile-charge-state dependence of the target x-ray production cross sections for targets in which the single-collision realm is maintained. In this paper, both EC and DI contributions and the total M-shell x-ray production cross sections are compared to both the first Born theory and to the perturbed-stationary-state theory with energy-loss, Coulomb-deflection, and relativistic corrections

  12. Ruling out unresolved binaries in five transitional disks VLT/NACO: deep 2.12 and 1.75 {\\mu}m narrow-band imaging

    CERN Document Server

    Vicente, Silvia; Hartung, Markus; Bouy, Herve; Huelamo, Nuria; Artigau, Etienne; Augereau, Jean-Charles; van Dishoeck, Ewine; Olofsson, Johan; Oliveira, Isa; Prusti, Timo


    Aims. We aim at detecting the presence of companions inside the inner hole/gap region of a sample of five well known transitional disks using spatially-resolved imaging in the near-IR with the VLT/NACO/S13 camera, which probes projected distances from the primary of typically 0.1 to 7 arcsec. The sample includes the stars DoAr 21, HD 135344B (SAO 206462), HR 4796A, T Cha, and TW Hya, spanning ages of less than 1 to 10 Myr, spectral types of A0 to K7, and hole/gap outer radii of 4 to 100 AU. Methods. In order to enhance the contrast and to avoid saturation at the core of the point-spread function (PSF), we use narrow-band filters at 1.75 and 2.12 {\\mu}m. The "locally optimized combination of images" (LOCI) algorithm is applied for an optimal speckle noise removal and PSF subtraction, providing an increase of 0.5-1.5 mag in contrast over the classic method. Results. With the proviso that we could have missed companions owing to unfavorable projections, the VLT/NACO observations rule out the presence of unresolv...

  13. Systemic radioimmunotherapy using a monoclonal antibody, anti-Tac directed toward the alpha subunit of the IL-2 receptor armed with the {alpha}-emitting radionuclides {sup 212}Bi or {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Wesley, Jon N.; McGee, Edwin C.; Garmestani, Kayhan; Brechbiel, Martin W.; Yordanov, Alexander T.; Wu Chuanchu; Gansow, Otto A.; Eckelman, William C.; Bacher, John D.; Flynn, Michael; Goldman, Carolyn K.; MacLin, Melvin; Schwartz, Uwe P.; Jackson-White, Terri; Phillip, Celeste M.; Decker, Jean; Waldmann, Thomas A. E-mail:


    To exploit the fact that IL-2 receptors are expressed by T-cells responding to foreign antigens but not by resting T-cells, humanized anti-Tac (HAT) armed with alpha-emitting radionuclides {sup 212}Bi and {sup 211}At was evaluated in a cynomolgus cardiac allograft model. Control graft survival was 8.2{+-} 0.5 days compared with 14.0{+-}1.3 days (p<0.01) survival for monkeys treated with {sup 212}Bi labeled HAT and 26.7{+-}2.4 days survival (p<0.001 versus controls) with {sup 211}At labeled HAT. Thus, {sup 211}At labeled HAT may have application in organ transplantation and in treatment of IL-2 receptor expressing T-cell leukemia.

  14. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002), Waste Site Reclassification Form 2008-003

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron


    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  15. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002). Attachment Waste Site Reclassification Form 2008-003

    International Nuclear Information System (INIS)

    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  16. Involvement of TRPV1 channels in the activity of the cannabinoid WIN 55,212-2 in an acute rat model of temporal lobe epilepsy. (United States)

    Carletti, Fabio; Gambino, Giuditta; Rizzo, Valerio; Ferraro, Giuseppe; Sardo, Pierangelo


    The exogenous cannabinoid agonist WIN 55,212-2, (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone (WIN), has revealed to play a role on modulating the hyperexcitability phenomena in the hippocampus. Cannabinoid-mediated mechanisms of neuroprotection have recently been found to imply the modulation of transient receptor potential vanilloid 1 (TRPV1), a cationic channel subfamily that regulate synaptic excitation. In our study, we assessed the influence of pharmacological manipulation of TRPV1 function, alone and on WIN antiepileptic activity, in the Maximal Dentate Activation (MDA) acute model of temporal lobe epilepsy. Our results showed that the TRPV1 agonist, capsaicin, increased epileptic outcomes; whilst antagonizing TRPV1 with capsazepine exerts a protective role on paroxysmal discharge. When capsaicin is co-administered with WIN effective dose of 10mg/kg is able to reduce its antiepileptic strength, especially on the triggering of MDA response. Accordingly, capsazepine at the protective dose of 2mg/kg managed to potentiate WIN antiepileptic effects, when co-treated. Moreover, WIN subeffective dose of 5mg/kg was turned into effective when capsazepine comes into play. This evidence suggests that systemic administration of TRPV1-active drugs influences electrically induced epilepsy, with a noticeable protective activity for capsazepine. Furthermore, results from the pharmacological interaction with WIN support an interplay between cannabinoid and TRPV1 signaling that could represent a promising approach for a future pharmacological strategy to challenge hyperexcitability-based diseases. PMID:26970948

  17. Enhanced self-administration of the CB1 receptor agonist WIN55,212-2 in olfactory bulbectomized rats: evaluation of possible serotonergic and dopaminergic underlying mechanisms

    Directory of Open Access Journals (Sweden)

    Petra eAmchova


    Full Text Available Depression has been associated with drug consumption, including heavy or problematic cannabis use. According to an animal model of depression and substance use disorder comorbidity, we combined the olfactory bulbectomy model of depression with intravenous drug self-administration procedure to verify whether depressive-like rats displayed higher voluntary intake of the CB1 receptor agonist WIN55,212-2 (WIN, 12.5 µg/kg/infusion. To this aim, olfactory-bulbectomized (OBX and sham-operated (SHAM Lister Hooded rats were allowed to self-administer WIN by lever-pressing under a continuous (FR-1 schedule of reinforcement in 2h daily sessions. Data showed that both OBX and SHAM rats developed stable WIN intake; yet, responses in OBX were constantly higher than in SHAM rats soon after the first week of training. In addition, OBX rats took significantly longer to extinguish the drug-seeking behaviour after vehicle substitution. Acute pre-treatment with serotonin 5HT1B receptor agonist, CGS-12066B (2.5-10 mg/kg, did not significantly modify WIN intake in OBX and SHAM Lister Hooded rats. Furthermore, acute pre-treatment with CGS-12066B (10 and 15 mg/kg did not alter responses in parallel groups of OBX and SHAM Sprague Dawley rats self-administering methamphetamine under higher (FR-2 reinforcement schedule with nose-poking as operandum. Finally, dopamine levels in the nucleus accumbens of OBX rats did not increase in response to a WIN challenge, as in SHAM rats, indicating a dopaminergic dysfunction in bulbectomized rats. Altogether, our findings suggest that a depressive state may alter cannabinoid CB1 receptor agonist-induced brain reward function and that a dopaminergic rather than a 5-HT1B mechanism is likely to underlie enhanced WIN self-administration in OBX rats.

  18. ALMA results of the pseudodisk, rotating disk, and jet in the continuum and HCO{sup +} in the protostellar system HH 212

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chin-Fei; Hirano, Naomi; Shang, Hsien; Ho, Paul T. P.; Krasnopolsky, Ruben [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 106, Taiwan (China); Zhang, Qizhou, E-mail: [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)


    HH 212 is a nearby (400 pc) Class 0 protostellar system showing several components that can be compared with theoretical models of core collapse. We have mapped it in the 350 GHz continuum and HCO{sup +} J = 4-3 emission with ALMA at up to ∼0.''4 resolution. A flattened envelope and a compact disk are seen in the continuum around the central source, as seen before. The HCO{sup +} kinematics shows that the flattened envelope is infalling with small rotation (i.e., spiraling) into the central source, and thus can be identified as a pseudodisk in the models of magnetized core collapse. Also, the HCO{sup +} kinematics shows that the disk is rotating and can be rotationally supported. In addition, to account for the missing HCO{sup +} emission at low-redshifted velocity, an extended infalling envelope is required, with its material flowing roughly parallel to the jet axis toward the pseudodisk. This is expected if it is magnetized with an hourglass B-field morphology. We have modeled the continuum and HCO{sup +} emission of the flattened envelope and disk simultaneously. We find that a jump in density is required across the interface between the pseudodisk and the disk. A jet is seen in HCO{sup +} extending out to ∼500 AU away from the central source, with the peaks upstream of those seen before in SiO. The broad velocity range and high HCO{sup +} abundance indicate that the HCO{sup +} emission traces internal shocks in the jet.

  19. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA) Study. (United States)

    Hoffman, Martin D; Krishnan, Eswar


    Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1%) and exercise-induced asthma (13.0%), but there was a low prevalence of serious medical issues including cancers (4.5%), coronary artery disease (0.7%), seizure disorders (0.7%), diabetes (0.7%), and human immunodeficiency virus (HIV) infection (0.2%). In the year preceding enrollment, most (64.6%) reported an exercise-related injury that resulted in lost training days (median of 14 days), but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each). The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5%) involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (pasthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving the foot, and it is the younger and less experienced ultramarathoners who appear most at risk for injury. PMID:24416176

  20. Paracentric inversion of chromosome 7 (46,XX,inv(7)(q21.2q22)) in a newborn with hypoplastic left heart syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Kuforjii, T.A.; Pillers, D.M.; Silberbach, M. [Oregon Health Sciences Univ., Portland, OR (United States)] [and others


    Hypoplastic left heart syndrome (HLHS) is a severe congenital heart disease that is uniformly fatal without surgical intervention. Fetal echocardiography allows prenatal diagnosis, but this condition may not become apparent until after the mid-second trimester. We report a term baby with severe HLHS who had an 18 week fetal ultrasound that reportedly demonstrated a normal heart. There was no family history of congenital heart disease. She was phenotypically female with no dysmorphic features. Physical examination was otherwise normal. She expired at 48 hours of age. The autopsy was noncontributory. The karyotype was 46,XX, but there was an apparently balanced paracentric inversion of the long arm of chromosome 7 (46,XX,inv(7)(q21.2q22)). The mother`s chromosome study was normal without any inversion, and the father was not available for study. Hypoplastic left heart syndrome has been associated with extracardiac anomalies and chromosomal abnormalities including 45,XO,11q-, and trisomy 18. It has also been reported in 5 members spanning 3 generations of a family with a spectrum of left heart defects suggesting an autosomal dominant pattern with high penetrance. First-degree relatives of infants with HLHS have a thirteen percent incidence of related cardiovascular malformations, a frequency higher than predicted by a multifactorial model of inheritance, suggesting that at least a portion of HLHS have a genetic basis. Karyotype analysis, including high resolution banding, may help define the etiology of this condition. Chromosome 7 has not been implicated in HLHS. This case emphasizes the need for genetic analysis, including a pedigree, of affected families. It also underscores the importance of screening by karyotype analysis to determine whether defects of the long arm of chromosome 7 are important in the pathogenesis of hypoplastic left heart syndrome.

  1. The enhancement of 21.2%-power conversion efficiency in polymer photovoltaic cells by using mixed Au nanoparticles with a wide absorption spectrum of 400 nm-1000 nm (United States)

    Hao, Jing-Yu; Xu, Ying; Zhang, Yu-Pei; Chen, Shu-Fen; Li, Xing-Ao; Wang, Lian-Hui; Huang, Wei


    Au nanoparticles (NPs) mixed with a majority of bone-like, rod, and cube shapes and a minority of irregular spheres, which can generate a wide absorption spectrum of 400 nm-1000 nm and three localized surface plasmon resonance peaks, respectively, at 525, 575, and 775 nm, are introduced into the hole extraction layer poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) to improve optical-to-electrical conversion performances in polymer photovoltaic cells. With the doping concentration of Au NPs optimized, the cell performance is significantly improved: the short-circuit current density and power conversion efficiency of the poly(3-hexylthiophene): [6,6]-phenyl-C60-butyric acid methyl ester cell are increased by 20.54% and 21.2%, reaching 11.15 mA·cm-2 and 4.23%. The variations of optical, electrical, and morphology with the incorporation of Au NPs in the cells are analyzed in detail, and our results demonstrate that the cell performance improvement can be attributed to a synergistic reaction, including: 1) both the localized surface plasmon resonance- and scattering-induced absorption enhancement of the active layer, 2) Au doping-induced hole transport/extraction ability enhancement, and 3) large interface roughness-induced efficient exciton dissociation and hole collection. Project supported by the National Basic Research Program of China (Grant Nos. 2015CB932202 and 2012CB933301), the National Natural Science Foundation of China (Grant Nos. 61274065, 51173081, 61136003, BZ2010043, 51372119, and 51172110), the Science Fund from the Ministry of Education of China (Grant No. IRT1148), the Specialized Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20113223110005), the Priority Academic Program Development of Jiangsu Provincial Higher Education Institutions (Grant No. YX03001), and the National Synergistic Innovation Center for Advanced Materials and the Synergetic Innovation Center for Organic Electronics and

  2. Isotopic generator for 212Pb and 212Bi

    International Nuclear Information System (INIS)

    A large potential exists for the use of short lived alpha emitting isotopes for therapeutic purposes. Most prior research has been performed with isotopes such as 211At which require a cyclotron for production. It obviously would be more convenient to use a long lived isotopic generator system. For this reason, we have undertaken a study of the properties of several such generators, one of which, 228Th, is described here

  3. Local Tumor Control, Visual Acuity, and Survival After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    International Nuclear Information System (INIS)

    Purpose: To evaluate long-term local tumor control, visual acuity, and survival after hypofractionated linear accelerator-based stereotactic photon radiotherapy in patients with choroidal melanoma. Methods and Materials: Between 1997 and 2007, 212 patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at a linear accelerator with 6-MV photon beams at the Medical University of Vienna in five fractions over 7 days. Twenty-four patients received a total dose of 70 Gy (five fractions of 14 Gy), 158 a total dose of 60 Gy (five fractions of 12 Gy) and 30 patients a total dose of 50 Gy (five fractions of 10 Gy) applied on the 80% isodose. Ophthalmologic examinations were performed at baseline and every 3 months in the first 2 years, every 6 months until 5 years, and once a year thereafter until 10 years after radiotherapy. Assessment of visual acuity, routine ophthalmologic examinations, and measurement of tumor base dimension and height using standardized A-scan and B-scan echography were done at each visit. Funduscopy and fluorescein angiography were done when necessary to document tumor response. Results: Median tumor height and volume decreased from 4.8 mm and 270.7 mm3 at baseline to 2.6 mm and 86.6 mm3 at the last individual follow-up, respectively (p < 0.001, p < 0.001). Median visual acuity decreased from 0.55 at baseline to hand motion at the last individual follow-up (p < 0.001). Local tumor control was 95.9% after 5 years and 92.6% after 10 years. Thirty-two patients developed metastatic disease, and 22 of these patients died during the follow-up period. Conclusion: Hypofractionated stereotactic photon radiotherapy with 70 to 50 Gy delivered in five fractions in 7 days is sufficient to achieve excellent local tumor control in patients with malignant melanoma of the choroid. Disease outcome and vision are comparable to those achieved with proton beam radiotherapy. Decreasing the total dose

  4. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA Study.

    Directory of Open Access Journals (Sweden)

    Martin D Hoffman

    Full Text Available Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1% and exercise-induced asthma (13.0%, but there was a low prevalence of serious medical issues including cancers (4.5%, coronary artery disease (0.7%, seizure disorders (0.7%, diabetes (0.7%, and human immunodeficiency virus (HIV infection (0.2%. In the year preceding enrollment, most (64.6% reported an exercise-related injury that resulted in lost training days (median of 14 days, but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each. The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5% involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (p<0.001 and less experienced (p<0.01 than those without injury. Stress fractures were more common (p<0.01 among women than men. We conclude that, compared with the general population, ultramarathon runners appear healthier and report fewer missed work or school days due to illness or injury. Ultramarathon runners have a higher prevalence of asthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving

  5. The identification of soil radionuclides in the area of Puspiptek and surrounding

    International Nuclear Information System (INIS)

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  6. 3′-hydroxy-3,4,5,4′-tetramethoxystilbene, the metabolite of resveratrol analogue DMU-212, inhibits ovarian cancer cell growth in vitro and in a mice xenograft model (United States)

    Piotrowska-Kempisty, Hanna; Ruciński, Marcin; Borys, Sylwia; Kucińska, Małgorzata; Kaczmarek, Mariusz; Zawierucha, Piotr; Wierzchowski, Marcin; Łażewski, Dawid; Murias, Marek; Jodynis-Liebert, Jadwiga


    In screening studies, the cytotoxic activity of four metabolites of resveratrol analogue 3,4,5,4′-tetramethoxystilbene (DMU-212) against A-2780 and SKOV-3 ovarian cancer cells was investigated. The most active metabolite, 3′-hydroxy-3,4,5,4′-tetramethoxystilbene (DMU-214), was chosen for further studies. The cytotoxicity of DMU-214 was shown to be higher than that of the parent compound, DMU-212, in both cell lines tested. Since DMU-212 was supposed to undergo metabolic activation through its conversion to DMU-214, an attempt was made to elucidate the mechanism of its anti-proliferative activity. We found that in SKOV-3 cells lacking p53, DMU-214 induced receptor-mediated apoptosis. In A-2780 cell line with expression of wild-type p53, DMU-214 modulated the expression pattern of p53-target genes driving intrinsic and extrinsic apoptosis pathways, as well as DNA repair and damage prevention. Regardless of the up-regulation of p48, p53R2, sestrins and Gaad45 genes involved in cancer cell DNA repair, we demonstrated the stronger anti-proliferative and pro-apoptotic effects of DMU-214 in A-2780 cells when compared to those in SKOV-3. Hence we verified DMU-214 activity in the xenograft model using SCID mice injected with A-2780 cells. The strong anti-proliferative activity of DMU-214 in the in vivo model allowed to suggest the tested compound as a potential therapeutic in ovarian cancer treatment. PMID:27585955

  7. Effects of WIN 55,212-2 (a non-selective cannabinoid CB1 and CB2 receptor agonist) on the protective action of various classical antiepileptic drugs in the mouse 6 Hz psychomotor seizure model


    Florek-Luszczki, Magdalena; Wlaz, Aleksandra; Kondrat-Wrobel, Maria W.; Tutka, Piotr; Jarogniew J Luszczki


    The aim of this study was to characterize the influence of WIN 55,212-2 (WIN—a non-selective cannabinoid CB1 and CB2 receptor agonist) on the anticonvulsant effects of various classical antiepileptic drugs (clobazam, clonazepam, phenobarbital and valproate) in the mouse 6 Hz-induced psychomotor seizure model. Limbic (psychomotor) seizure activity was evoked in albino Swiss mice by a current (32 mA, 6 Hz, 3 s stimulus duration) delivered via ocular electrodes. Drug-related adverse effects were...

  8. A randomized, multicentre study of directed daylight exposure times of 11/2 vs. 21/2 h in daylight-mediated photodynamic therapy with methyl aminolaevulinate in patients with multiple thin actinic keratoses of the face and scalp

    DEFF Research Database (Denmark)

    Wiegell, S.R.; Fabricius, S.; Philipsen, P.A.;


    Background: Actinic keratoses (AKs) are common dysplastic skin lesions that may differentiate into invasive squamous cell carcinomas. Although a superior cosmetic outcome of photodynamic therapy (PDT) is advantageous compared with equally effective treatments such as cryotherapy and curettage, the...... entire treatment area. Immediately after, patients left the clinic and exposed themselves to daylight according to the randomization. Daylight exposure was monitored with a wristwatch dosimeter and patients scored their pain sensation during treatment. Results: The mean lesion response rate at 3 months...... was 77% in the 11/2-h group and 75% in the 21/2-h group (P = 0·57). The mean duration of daylight exposure was 131 and 187 min in the two groups. The mean overall effective light dose was 9·4 J cm (range 0·2-28·3). Response rate was not associated with effective daylight dose, exposure duration...

  9. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    International Nuclear Information System (INIS)

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  10. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)


    Waldek, Achim Marcus


    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  11. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    International Nuclear Information System (INIS)

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  12. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  13. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications


    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon


    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  14. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    International Nuclear Information System (INIS)

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  15. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    International Nuclear Information System (INIS)

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  16. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)


    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  17. Chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 during puberty or adulthood reverses 3,4 methylenedioxymetamphetamine (MDMA)-induced deficits in recognition memory but not in effort-based decision making. (United States)

    Schulz, Sybille; Becker, Thorsten; Nagel, Ulrich; von Ameln-Mayerhofer, Andreas; Koch, Michael


    Cannabis and 3,4 methylenedioxymetamphetamine (MDMA, "ecstasy") are the most frequently combined illegal drugs among young adults in western societies. This study examined the effects of chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 (WIN) and MDMA on working memory and effort-based decision making in rats. Treatment consisted of MDMA (7.5 mg/kg), WIN (1.2 mg/kg), a combination of these substances (MDMA+WIN) or vehicle over a period of 25 days during puberty (PD40-65) or adulthood (PD80-105). Ten days after the last treatment, WIN reversed MDMA-induced working memory deficits in the object recognition test in animals treated during adulthood or puberty, but had no influence on impairment of adult rats in the effort-based T-maze task. No differences were observed between groups of pubertally treated rats in the decision making task. During a subsequent acute drug challenge MDMA and MDMA+WIN decreased high reward choices in both age groups, indicating MDMA-induced cost-aversive choice. Differential long-term interactions on the neuronal level in the hippocampus and MDMA-induced disturbances in cortico-limbic connections are suggested. PMID:23541493

  18. Measurement of the 115In(n,γ)116 m In reaction cross-section at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV (United States)

    Lawriniang, Bioletty Mary; Badwar, Sylvia; Ghosh, Reetuparna; Jyrwa, Betylda; Vansola, Vibha; Naik, Haladhara; Goswami, Ashok; Naik, Yeshwant; Datrik, Chandra Shekhar; Gupta, Amit Kumar; Singh, Vijay Pal; Pol, Sudir Shibaji; Subramanyam, Nagaraju Balabenkata; Agarwal, Arun; Singh, Pitambar


    The 115In(n,γ)116 m In reaction cross section at neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV was determined by using an activation and off-line γ-ray spectrometric technique. The monoenergetic neutron energies of 1.12 - 4.12 MeV were generated from the 7Li(p,n) reaction by using proton beam with energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at Bhabha Atomic Research Centre (BARC) and with energies of 5 and 6 MeV from the Pelletron facility at Tata Institute of Fundamental Research (TIFR), Mumbai. The 197Au(n,γ)198Au reaction cross-section was used as the neutron flux monitor.The 115In(n,γ)116 m In reaction cross section at neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV was determined by using an activation and off-line γ-ray spectrometric technique. The monoenergetic neutron energies of 1.12 - 4.12 MeV were generated from the 7Li(p,n) reaction by using proton beam with energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at Bhabha Atomic Research Centre (BARC) and with energies of 5 and 6 MeV from the Pelletron facility at Tata Institute of Fundamental Research (TIFR), Mumbai. The 197Au(n,γ)198 Au reaction cross-section was used as the neutron flux monitor. The 115In(n,γ)116 m In reaction cross-sections at neutron energies of 1.12 - 4.12 MeV were compared with the literature data and were found to be in good agreement with one set of data, but not with others. The 115In(n,γ)116 m In cross-section was also calculated theoretically by using the computer code TALYS 1.6 and was found to be slightly lower than the experimental data from the present work and the literature.)198Au reaction cross-section was used as the neutron flux monitor. The 115In(n,γ)116 m In reaction cross-sections at neutron energies of 1.12 - 4.12 MeV were compared with the literature data and were found to be in good agreement with one set of data, but not with others. The 115In(n,γ)116 m In cross-section was also calculated

  19. 42 CFR 2.12 - Applicability. (United States)


    ... abuse and neglect. The restrictions on disclosure and use in these regulations do not apply to the reporting under State law of incidents of suspected child abuse and neglect to the appropriate State or... proceedings which may arise out of the report of suspected child abuse and neglect. (d) Applicability...

  20. Calidad de Imagen del Telescopio UNAM212 (United States)

    Cobos, F. J.; Teiada de Vargas, C.


    El telescopio UNAM2l2, del Observatorio Astronómico Nacional, situado en la Sierra de San Pedro Mártir (Baja California, México), cumplira en un futuro muy cercano siete años de uso para fines de investigación astronómica. Aunque en este tiempo no se ha efectuado un estudio sistemático acerca de su comportamiento óptico y de los factores que influyen en la calidad de las imágenes, se han realizado pruebas diversas, estudios parciales y reuniones especificas, cuyos resultados no siempre se han difundido ampliamente y generalmente no se han presentado por escrito. Es por ello que hemos creido necesario intentar una recopilación de la información existente para poder con ella establecer un diagnóstjco que, aunque no sea definitivo, sirva de base para futuros trabajos tendientes a optimizar el comportamiento óptico del telescopio. Es evidente que un buen número de las conclusiones que se presentan son resultado del trabajo de muchas personas ó de esfuerzos colectivos. Asimismo, hemos tratado de localizar información bibliográfica que pueda ser de utilidad. Nuestro objetivo primordial ha consistido en centrarnos en la óptica del telescopio y su calidad, pero también se han considerado otros aspectos que puedan afectar las imágenes obtenidas tales como: celda del primario, `seeing' local y externo, flexiones posibles en la estructura mecánica del telescopio, etc.

  1. 19 CFR 10.212 - Definitions. (United States)


    ... free of duty and free of any quantitative limitations as provided in 19 U.S.C. 3721. Wholly assembled... machines. “Wholly formed on seamless knitting machines,” when used to describe apparel articles, has... machine to result in that article. When taken from the knitting machine, an apparel article created...

  2. 42 CFR 412.212 - National rate. (United States)


    ... discharge classified within a DRG, the national rate equals the product of— (1) The national average... under § 412.60(b)) for that DRG. (d) Adjusting for different area wage levels. CMS adjusts...

  3. 49 CFR 212.217 - Car inspector. (United States)


    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  4. 40 CFR 21.2 - Definitions. (United States)


    ....S.C. 1151, et seq. (f) Pollutant means dredged spoil, solid waste, incinerator residue, sewage..., wrecked or discarded equipment, rock, sand, cellar dirt and industrial, municipal, and agricultural waste... CFR part 121, and regulations of the Small Business Administration promulgated thereunder. (b)...

  5. ACCT 212 Course Tutorial/TutorialRank




    For more course tutorials visit Tutorial Purchased: 3 Times, Rating: A (TCO 1) The Accounting Equation is used to develop the organizations financial reports. (1) Describe what owners' equity values would be if Assets are $100,000 and Liabilities are $27,000 by showing the Accounting Equation (10 points) and (2) provide an explanation of what accounts could be found in owners' equity. (10 points)  (TCO 1) The financial statements present a compan...

  6. 43 CFR 17.212 - Employment criteria. (United States)


    ..., manual, or speaking skills the test results accurately reflect the applicant's or employee's job skills... shown to be job-related for the position in question, and (2) alternative job-related tests or criteria... test purports to measure). (c) All job qualifications must be shown to be directly related to the...

  7. 42 CFR 59.212 - Grantee accountability. (United States)


    ... due pursuant to subparts F, M, and O of 45 CFR part 74. Such total sum shall constitute a debt owed by... Intergovernmental Cooperation Act of 1968 (42 U.S.C. 4213), a State will not be held accountable for interest earned... the Intergovernmental Cooperation Act, means any one of the several States, the District of...

  8. 5 CFR 842.212 - Deferred retirement. (United States)


    ... this section, an employee or Member who has not attained the minimum retirement age, and who, after... following the date on which the individual attains the minimum retirement age or, if later, (ii) A date the... retirement age, and is reemployed before filing an application for retirement based on that separation,...

  9. PSYCHIATRIC DISORDER21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)


    950421 A study on therapeutic efficacy,side effectsand correlation between plasma concentration andtherapeutic effect of haloperridol decanoate on treat-ment of schizophrenia.ZHANG Hongyan(张鸿燕),etal.Ment Health Instit,Beijing Med Univ,Beijing,100083.Chin J Neurol & Psychiat 1994;27(5):283-285.Haloperidol decanoate (HD) was conducted in treat-ing 83 schizophrenics in nine hospitals for 24 weeks,meanwhile plasma drug concentration was measured.The results show that therapeutic effectiveness of HDis saticfactory in more than 50%;the static plasmaconcentration in recovery and obviously improved pa-

  10. 21.PSYCHIATRIC DISORDER 21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)


    920198 Kinetic observation of serum thyr-onormone level in schizophrenics.WANGXueyi (王学义),et al.Psychiatr Hosp,KailuanCoal Mining Administration,Tangshan,063001.Chin J Neurol & Psychiat 1991; 24 (5): 268-271.Measurements of serum T3,T4,RUR and FT4I

  11. 27 CFR 28.212 - Persons authorized. (United States)


    ... plants, bonded wine cellars, or taxpaid wine bottling houses, and persons who are wholesale liquor... OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback §...

  12. 45 CFR 212.3 - Eligible person. (United States)


    ... because of war, threat of war, invasion, or similar crisis. Such statement shall, if possible, incorporate... war, threat of war, invasion, or similar crisis, a determination by the Department of State that such... his return to, or entry into the United States; and (c) He is without resources immediately...

  13. 32 CFR 212.6 - Procedures. (United States)


    .... (i) No person because of race, color, creed, sex, age, disability, or national origin shall be... and salaries as employees of the non-Federal entity or as award recognition for services rendered to... be self-sustaining, primarily through dues, contributions, service charges, fees, or...

  14. 36 CFR 212.1 - Definitions. (United States)


    ... purchase unit, a land utilization project, Columbia River Gorge National Scenic Area, Land Between the..., measuring, and accepting completed work. Designated road, trail, or area. A National Forest System road, a...), as amended; 49 U.S.C. 1105(b)(3). Forest road and trail funds. Funds authorized or appropriated...

  15. 31 CFR 538.212 - Exempt transactions. (United States)


    ... authorize transactions incident to the exportation of software subject to the Export Administration Regulations, 15 CFR parts 730-774, or to the exportation of goods, technology or software for use in the... agricultural commodities listed in appendix A to this part 538), medicine, and medical devices. Note to §...

  16. 24 CFR 1710.212 - Financial information. (United States)


    ... statements shall be prepared in accordance with generally accepted accounting principles as prescribed by the Financial Accounting Standards Board and generally accepted auditing standards as prescribed by the American... URBAN DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting...

  17. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Directory of Open Access Journals (Sweden)

    Maurice O. Miller


    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  18. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus


    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  19. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)


    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  20. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  1. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  2. Coordination chemistry of the sup 212 Pb/ sup 212 Bi nuclear transformation: Alpha-emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Parks, N.J.; Harris, W.R.; Keen, C.L.; Cooper, S.R.


    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced {sup 205/206}Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, {sup 203}Pb (T{sub 1/2} = 51 hr).

  3. Coordination chemistry of the 212Pb/212Bi nuclear transformation: Alpha-emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced 205/206Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, 203Pb (T1/2 = 51 hr)

  4. Density functional theory studies of (TiO2)12 quantum ring and its electronic properties when doped with transition metal compounds%(TiO2)12量子环及过渡金属化合物掺杂对其电子性质影响的密度泛函理论研究

    Institute of Scientific and Technical Information of China (English)

    杨振清; 白晓慧; 邵长金


    In this paper, we have designed a new (TiO2)12 quantum ring structure and studied its geometry, average binding energy, and the electron density distributions using the generalized gradient approximation (GGA), which is based on the density functional theory (DFT) with the first-principles calculations. This new quantum ring structure is doped with transition metal compounds MoS2, MoSe2, MoTe2, WS2, WSe2 and WTe2 respectively, to modify its properties. Thus we can calculate and analyze their geometrics and electronic properties (such as average binding energies, energy levels, electronic density of states and the HOMO-LUMO electron density distributionsatc). We find that the (TiO2)12 quantum ring with a diameter of 1.059 nm seems to be of a two-dimensional structure with a center symmety which ensurs it a stable structure. In addition, the HOMO-LUMO orbital electron density in the quantum ring distributes evenly, and its energy gap is 3.17 eV which is very close to the experimental value of TiO2 semiconductor materials (3.2 eV). The energy gaps decrease substantially after introducing the transition metal compounds into the quantum ring. Among these results, the ring doped with WTe2 has the smallest energy gap (0.61 eV), and that with MoTe2 has the biggest energy gap (1.16 eV), but it is still smaller by about 2 eV than that of the (TiO2)12 quantum ring. Furthermore, other doping results have energy gap variation around 1 eV. The TiO2 clusters with this energy gap could make use most of the solar energy and so expand applications of TiO2.%本文采用第一性原理中基于密度泛函理论(DFT)的广义梯度近似(GGA)方法,设计了一种新的(TiO2)12量子环结构,研究了它的几何结构、平均结合能及电子云分布等属性.在此新型结构的基础上,分别采用过渡金属化合物MoS2, MoSe2, MoTe2, WS2, WSe2和WTe2进行掺杂,并分析了掺杂后体系的几何结构及电子属性(如平均结合能、能级结构、HOMO-LUMO轨道

  5. Quinoxaline–3-aminophenol–water (2/1/2

    Directory of Open Access Journals (Sweden)

    Maria Gdaniec


    Full Text Available The asymmetric unit of the title compound, 2C8H6N2·C6H7NO·2H2O, contains two quinoxaline molecules, one molecule of 3-aminophenol and two water molecules which are hydrogen bonded to form a two-dimensional polymeric structure. Each of the symmetry-independent quinoxaline molecules forms separate stacks of different symmetry. In one set of stacks, the molecules are related by a screw axis and are slightly tilted [dihedral angle = 7.12 (1°]. In the second set of stacks, adjacent molecules are parallel and related by an inversion center [interplanar distances = 3.376 (4 and 3.473 (4 Å].

  6. Dicty_cDB: SSJ212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATTCATAAATAAATAAAAAACAATAATAAA sequence update 1998.12.21 Translated Amino Acid sequence tkkkkkkke*naisstlff*il*r*i*iqtcnftir...c*vanyinkgyli*n ns*inkkq** Frame B: tkkkkkkke*naisstlff*il*r*i*iqtcnftirniipypkrc

  7. Dicty_cDB: SHG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XPXKA Translated Amino Acid sequence (All Frames) Frame A: ---GXAVGXAXGGAXAXGXFXFGGKKXXXYWKXXQGXSKXPXKA Frame B: ---gxxlxxlxxgxxxxgx...2002. 9.10 Translated Amino Acid sequence ---GXAVGXAXGGAXAXGXFXFGGKKXXXYWKXXQGXSK...lxlvxkxxxxtgxxxkxxxrxxxk Frame C: ---gcxwxcxwxgxcxwgfxfwwxkxxxllexxxrxfxgpxks Homolo

  8. 8 CFR 212.1 - Documentary requirements for nonimmigrants. (United States)


    ... Free Trade Agreement (NAFTA) pursuant to section 101(a)(15)(E) of the Act, shall be in possession of a... with the treaty concluded on February 3, 1944, between the United States and Mexico regarding the... classes: (a) Citizens of Canada or Bermuda, Bahamian nationals or British subjects resident in...

  9. 31 CFR 31.212 - Personal conflicts of interest. (United States)


    ... from each of them in writing about their personal, business, and financial relationships, as well as..., valuation, management, or disposition of troubled assets, the information shall be no less extensive than.... (d) Initial Certification. No later than ten business days after the effective date of...

  10. 释疑解惑第212

    Institute of Scientific and Technical Information of China (English)

    薄冰; 司树森


    问[931]joycesue17(在阅读中我不止一次见到这样的句子:The situation is, if anything, worsening rather than improving.我不知道if anything是什么意思,又其用法如何?请解释一下,谢谢!

  11. 40 CFR 156.212 - Personal protective equipment statements. (United States)


    ... type of equipment other than the product container may be used to mix, load, or apply the product, and....” (2) If the application of the product may result in overhead exposure to any handler (for example... Personal protective equipment statements. (a) Requirement. Each product shall bear the personal...

  12. 2-{1-[(2-Nitrobenzenesulfonamidomethyl]cyclohexyl}acetic acid

    Directory of Open Access Journals (Sweden)

    Nosheen Kanwal


    Full Text Available In the title compound, C15H20N2O6S, the C—SO2—NH—C torsion angle is 64.54 (14°. In the molecule, there is a bifurcated N—H...(O,O hydrogen bond, forming S(7 rings. In the crystal, inversion dimers are formed via O—H...O hydrogen bonds involving the carboxyl group, so forming R22(8 rings. These dimers are further linked via pairs of C—H...O hydrogen bonds, forming a C(6 chain propagating along the c-axis direction.

  13. 2-{1-[(2-Nitrobenzenesulfonamido)methyl]cyclohexyl}acetic acid


    Nosheen Kanwal; Erum Akbar Hussain; Onur Şahin; Orhan Büyükgüngör


    In the title compound, C15H20N2O6S, the C—SO2—NH—C torsion angle is 64.54 (14)°. In the molecule, there is a bifurcated N—H...(O,O) hydrogen bond, forming S(7) rings. In the crystal, inversion dimers are formed via O—H...O hydrogen bonds involving the carboxyl group, so forming R22(8) rings. These dimers are further linked via pairs of C—H...O hydrogen bonds, forming a C(6) chain propagating along the c-axis direct...

  14. Dicty_cDB: SFI212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence (All Frames) Frame A: tvgllxkhnk*frfgiiikllffkksnisiiylfiiyinqq*rkmnfreldtsngvkaae ssfrtkvvlareipwngfassnsitseqynlis...ts) Value EF677695_1( EF677695 |pid:none) Picea sitchensis clone WS02773_D06... 168 3e-40 AY225129_1( AY225129 |pid:none) Suaeda mari...kyftsiixlis*ysiii*nylcnlvinl**rycsslfrnwfsckfsstrqncs qgkdc*iiii...krlldyhyqp*eif*tmvrvtkk*simvsfvc*if*ilkngvmmifqlilkf*lmvllk ilii*vhliniklklfqvn*nghqfinqrdsgkris...21 AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 42 2e-09 26 AC116986 |AC116986.2 Dictyostelium dis

  15. Subtask 2.12 - Air Quality Assessment and Control

    Energy Technology Data Exchange (ETDEWEB)

    Laura Raymond


    Past particulate matter (PM) research projects conducted at the Energy & Environmental Research Center included data on PM size, morphology, and chemistry. The objective of this project was to improve automated analysis capabilities of the scanning electron microscope (SEM) equipped with an energy-dispersive spectrometer. The SEM is now able to perform particle-by-particle analysis on the desired number of particles and provide size, morphology, and chemistry information for each particle. A new x-ray and image analysis system was purchased and implemented for improvements to data acquisition and analysis. This new analysis system is equipped with a digital-pulse processor, allowing for the determination of pixel-by-pixel chemistry, which significantly enhances our ability to characterize PM and other materials. In addition, this system is personal computer-based, which allows programming of the SEM to perform the automated image analysis along with detailed chemical information. This permits the incorporation of particle classification algorithms within the same computer system as the analysis is conducted. Additionally, the new Spirit software can now integrate full SEM control with imaging, elemental identification, and electron backscatter diffraction (EBSD) operation. The EBSD system has also allowed for phase identification within the SEM. Reexamination of previous samples collected on a polycarbonate filter for ambient-air PM2.5 analysis has shown that crystalline identification of individual particles can be done without further sample preparation or modification of the sample and/or sampling substrate.

  16. Dicty_cDB: CHC212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsst...c*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyqlinkl...**itrxk elnnsvyhv--- ---tnkgk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nl*wklsri*kprttefqs lkmklml*iyy*mesqkvlkscalav

  17. 50 CFR 660.212 - Fixed gear fishery-prohibitions. (United States)


    ... vessel subject to subparts C and E a set net, trap or pot, longline, or commercial vertical hook-and-line... by Annex V of the International Convention for the Prevention of Pollution From Ships, 1973 (Annex V... permit with a longline or trap (pot) endorsement and longline and/or trap gear onboard in an...

  18. 42 CFR 495.212 - Limitation on review. (United States)


    ... methodology and standards for determining payment amounts and payment adjustments under the MA EHR EP... EHR user, including the means of demonstrating meaningful use and the selection of measures. (b) There... methodology and standards for determining payment amounts and payment adjustments under the MA EHR...

  19. 36 CFR 212.5 - Road system management. (United States)


    ... rules. Rules set forth under 36 CFR part 261 and this section shall apply to all National Forest System... resource and other management objectives adopted in the relevant land and resource management plan (36 CFR... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Road system management....

  20. Breastfeeding Strategy for Northern Ireland (PDF 212 KB)


    Department of Health; Social Services and Public Safety


    Northern Ireland has one of the lowest breastfeeding rates in the world. Low breastfeeding rates are associated with considerable morbidity, some mortality and increased health service costs for women and children. In Northern Ireland, several factors make the initiation and maintenance of breastfeeding particularly difficult; these include cultural attitudes, commercial promotion of artificial milks and obstacles for the working mother. The aim of the Strategy is to promote and support br...

  1. Dicty_cDB: AFG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ielielpeyvlsllfgsvmfvfififiiiayrfkeidqsvldelngdt pmtddnananskeldvvtqkdlssssnpiinn...nnnnnnstlgns Frame C: kkennyyykkwr*kknhqilvyqhqlii*ghqlmervhlkvnkviwkvlimkflfmegmk iifhhqlnilwvmkfvkgihtml*e

  2. Coordination chemistry of the {sup 212}Pb/{sup 212}Bi nuclear transformation: Alpha-emitting radiopharmaceuticals. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Parks, N.J.; Harris, W.R.; Keen, C.L.; Cooper, S.R.


    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced {sup 205/206}Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, {sup 203}Pb (T{sub 1/2} = 51 hr).

  3. 8 CFR 212.9 - Applicability of section 212(a)(32) to certain derivative third and sixth preference and... (United States)


    ... visa or for adjustment of status under section 245 of the Act, whether or not such derivative immigrant... is the spouse or child of a qualified third or sixth preference or nonpreference immigrant and who is... medical profession. Therefore, a derivative third or sixth preference or nonpreference immigrant...

  4. Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and Coast of Quintana Roo, Mexico

    International Nuclear Information System (INIS)

    Full text: We describe in this paper the results obtained by the project 'Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and coast of Quintana Roo, Mexico'. The purpose of the study is to identify and quantify the natural and anthropogenic radionuclides present from sediments, sand and seawater from several sites located along the coast of the Gulf of Mexico and the Caribean Sea. The samples are analysed in a Canberra Multichannel analyzer system for gamma spectrometry, equipped with a detector of hyper pure germanium and a Genie 2000 software, in the 'Laboratory of Radiological Analysis of Environmental Samples', belonging to the Physics Department, Faculty of Sciences, National Autonomous University of Mexico (UNAM). The geographic sites were samples were taken include the states of Tamaulipas, Veracruz, Tabasco, Campeche, Yucatan and Quintana Roo. The results of this studies will be published at the end of the project and we hope they will be useful for the national health and industrial sectors. Until now we have identified and measured the presence of natural radionuclides such as Potassium-40 (K-40), Bismuth 212 (Bi-212), Lead-212 (Pb-212), Bismuth-214 (Bi-214), Lead-214 (Pb-214), Radium-226 (Ra-226), Actinium 228 (Ac-228), Uranium-235 (U-235), as well as some anthropogenic radionuclides found near the Laguna Verde Nuclear Power Plant. The project is scheduled to last for three years, finishing in 2009. At its ending we shall be able to present conclusions and identify some tendencies, in connection with the background and possible radioactive contamination of the studied zones. This project takes place under the auspice of the 'Program of Support to Projects of Research and Technological Innovation' of the National Autonomous University of Mexico. (author)

  5. Study on laser atomic spectroscopy

    International Nuclear Information System (INIS)

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  6. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    International Nuclear Information System (INIS)

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  7. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    International Nuclear Information System (INIS)

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  8. Yeast Interacting Proteins Database: YDL167C, YBR212W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ; localizes to stress granules induced by glucose deprivation; predicted to be involved in ribosome biogenesi... induced by glucose deprivation; predicted to be involved in ribosome biogenesis Rows with this bait...ial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; expressed in station...; overexpression impairs mitochondrial function; expressed in stationary phase Rows with this prey as pre...sed by (YPD) - Not affected by(YPD) - Interologs - Expression similarit

  9. 21 CFR 212.50 - What production and process controls must I have? (United States)


    ..., the name and radioactivity or other measurement of each active pharmaceutical ingredient and each... active pharmaceutical ingredient and each inactive ingredient per batch or per unit of radioactivity...

  10. 36 CFR 212.51 - Designation of roads, trails, and areas. (United States)


    ... administrative use by the Forest Service; (5) Use of any fire, military, emergency, or law enforcement vehicle for emergency purposes; (6) Authorized use of any combat or combat support vehicle for...

  11. AB212. Clinical study on the treatment of lifelong premature ejaculation with Paroxetine hydrochloride and tamsulosin (United States)

    Li, Yan-Feng; Zhang, Chao; Li, Bo-Jun


    Objective There are quite a few researches about SSRIs and alpha-receptor blockers on the treatment of premature ejaculation (PE), but few researches focus on the combination use of them. In this study, we evaluate the efficacy and safety of combine and alone use of paroxetine hydrochloride and tamsulosin on the treatment of lifelong PE. Methods 352 cases of men with 18–65 years of age, a history of lifelong PE and an intra-vaginal ejaculation latency time (IELT) premature ejaculation profile (PEP), the adverse events (AEs) and vital sign measurements were recorded at each visit. All the data were statistically analyzed. Results The reliable data from 322 patients were achieved. The geometric mean IELT in group A was significantly increased from 1.15 to 8.13 min after treatment (Pejaculation, satisfaction with sexual intercourse, ejaculation-related personal distress, and ejaculation-related interpersonal difficulty were significantly improved in all groups after treatment (P<0.001). The mean PEP scores in group C have more significant improvements than that in group A and B (P<0.01). The prevalence of AEs in group A, B, C were 9.26% (10 cases), 3.81% (4 cases) and 8.26% (9 cases), respectively. Conclusions Paroxetine hydrochloride combined with tamsulosin produce more better therapeutic effects than use them separately. It could be a priority for the treatment of lifelong PE.

  12. Tank 241-AX-103, cores 212 and 214 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the analytical laboratory report for tank 241-AX-103 push mode core segments collected between July 30, 1997 and August 11, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-AX-103 Push Mode Core Sampling and Analysis Plan (TSAP) (Comer, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT), plutonium 239 (Pu239), and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Conner, 1997). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report

  13. Assessment of Gastroesophageal Reflux in Children(2-12 Month) Based on Clinical Findings and Ultrasonography


    F Jassemi Zergani; R Farahi Rostami; F Hakim; Z Jannat Alipour; Karimi, K.; Z Fotokian


    Introduction: Gastroesophageal reflux is a common gastrointestinal disorder among infants, which can cause complications, such as esophagitis and Barrett's esophagus if its diagnosis and treatment are delayed. On the other hand, similarity of Gastro esophageal Reflux symptoms with symptoms of other childhood diseases makes its diagnosis and treatment difficult. So a proper tool for early screening and diagnostic test is essential. Methods: This study was conducted on 221 infants(2 to 12 month...

  14. Differential Regulation of Behavioral Tolerance to WIN55,212-2 by GASP1


    Martini, Lene; Thompson, Dawn; Kharazia, Viktor; Whistler, Jennifer L.


    Cannabinoid agonists have shown some promise clinically as analgesics, in particular for cancer pain, in which they have the additional benefit of decreasing nausea. However, as for most other drugs, the long-term use of cannabinoids is limited by the development of tolerance. Several molecular mechanisms have been proposed to explain drug tolerance, including receptor downregulation. The cannabinoid 1 (CB1) receptors can be downregulated in vitro through an interaction with the G-protein-cou...

  15. From a music therapists' diary 3/12 1996 - 2/12 1997

    DEFF Research Database (Denmark)

    Bergstrøm-Nielsen, Carl


    Graphic sketches made within a period of one year. They were made right after the sessions. Purpose was to investigate possibilities in graphic representation and to let various observarions and thoughts about the therapy become graspable. Around one third of the total quantity has been selected ...

  16. 48 CFR 52.212-4 - Contract Terms and Conditions-Commercial Items. (United States)


    ... at 5 CFR part 1315. (3) Electronic Funds Transfer (EFT). If the Government makes payment by EFT, see...) and Office of Management and Budget (OMB) prompt payment regulations at 5 CFR part 1315. (h) Patent... accordance with the Prompt Payment Act (31 U.S.C. 3903) and prompt payment regulations at 5 CFR part 1315....

  17. 49 CFR 212.213 - Motive power and equipment (MP&E) inspector. (United States)


    ... of determining compliance with all sections of the Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Locomotive Safety Standards (49 CFR part 229), Safety Appliance Standards (49 CFR part 231), and Power Brake Standards (49 CFR part 232), to make reports of...


    International Nuclear Information System (INIS)

    Over 400 million barrels (64 million m3) of oil have been produced from the shallow-shelf carbonate reservoirs in the Pennsylvanian (Desmoinesian) Paradox Formation in the Paradox Basin, Utah and Colorado. With the exception of the giant Greater Aneth field, the other 100 plus oil fields in the basin typically contain 2 to 10 million barrels (0.3-1.6 million m3) of original oil in place. Most of these fields are characterized by high initial production rates followed by a very short productive life (primary), and hence premature abandonment. Only 15 to 25 percent of the original oil in place is recoverable during primary production from conventional vertical wells. An extensive and successful horizontal drilling program has been conducted in the giant Greater Aneth field. However, to date, only two horizontal wells have been drilled in small Ismay and Desert Creek fields. The results from these wells were disappointing due to poor understanding of the carbonate facies and diagenetic fabrics that create reservoir heterogeneity. These small fields, and similar fields in the basin, are at high risk of premature abandonment. At least 200 million barrels (31.8 million m3) of oil will be left behind in these small fields because current development practices leave compartments of the heterogeneous reservoirs undrained. Through proper geological evaluation of the reservoirs, production may be increased by 20 to 50 percent through the drilling of low-cost single or multilateral horizontal legs from existing vertical development wells. In addition, horizontal drilling from existing wells minimizes surface disturbances and costs for field development, particularly in the environmentally sensitive areas of southeastern Utah and southwestern Colorado

  19. Assessment of Gastroesophageal Reflux in Children(2-12 Month Based on Clinical Findings and Ultrasonography

    Directory of Open Access Journals (Sweden)

    F Jassemi Zergani


    Full Text Available Introduction: Gastroesophageal reflux is a common gastrointestinal disorder among infants, which can cause complications, such as esophagitis and Barrett's esophagus if its diagnosis and treatment are delayed. On the other hand, similarity of Gastro esophageal Reflux symptoms with symptoms of other childhood diseases makes its diagnosis and treatment difficult. So a proper tool for early screening and diagnostic test is essential. Methods: This study was conducted on 221 infants(2 to 12 months with initial symptoms of gastro esophageal reflux(frequent vomiting, restlessness after feeding, no weight gain, coughing repeatedly and refusing to eat that referred to pediatric Clinic of Rajai Hospital in Tonekabon. Data was collected with demographic and infant gastro esophageal reflux questionnaire by use of the information in records and interview with parents. Then the samples were examined via sonography for gastroesophagial reflux. Results: After initial screening based on infants gastro esophageal reflux tool, gastro esophageal reflux by ultrasound was positive in 63/3% of infants. The mean esophageal diameter was (20/73±2/54mm in infants with gastro esophageal reflux and (23/71±2/35mm in infants without gastro esophageal reflux. Conclusion: Due to the similarity of gastro esophageal Reflux symptoms with clinical symptoms of other childhood diseases, use of an initial screening measurement for early assessment of gastro esophageal reflux in infants is necessary. Moreover, appropriate, available and low costs diagnostic method with little complication seems essential such as ultrasonography for confirm diagnosis and early treatment.

  20. 38 CFR 21.212 - General policy in furnishing supplies during periods of rehabilitation. (United States)


    ... placed at a distinct disadvantage in pursuing the course. (e) Supplies for special projects and theses. The amount of supplies that VA may authorize for special projects, including theses, may not exceed the amount generally needed by similarly circumstanced nonveterans in meeting course or...

  1. 36 CFR 212.81 - Use by over-snow vehicles. (United States)


    ..., emergency, or law enforcement vehicle for emergency purposes; (3) Authorized use of any combat or combat support vehicle for national defense purposes; (4) Law enforcement response to violations of law... authorization issued under Federal law or regulations. (c) Establishment of restrictions and prohibitions....

  2. Case 212: chronic lymphocytic inflammation with pontine perivascular enhancement responsive to steroids. (United States)

    Bag, Asim K; Davenport, Jake J; Hackney, James R; Roy, Rasmoni; Fathallah-Shaykh, Hassan M


    History A previously healthy 23-year-old white man presented to the emergency department of our hospital with a 2-month history of dysarthria, progressively worsening vertigo, and difficulty walking. A diagnosis of retinitis pigementosa was made in this patient's childhood. He did not have any history of congenital syphilis. He did not have a history of nausea or vomiting, fever, weight loss, headache, photophobia, seizure, extremity weakness, or sensory disturbance. Physical examination revealed dysarthria, dysmetria, and ataxia. Kernig and Brudzinski signs were absent, and pathergy test results were negative. Laboratory evaluation revealed normal complete and differential blood counts and normal serum chemistry, including a normal serum angiotensin-converting enzyme level. Analysis of his serum was negative for antinuclear antibody (or ANA), cytoplasmic antineutrophil cvtoplasmic antibody (or cANCA), Sjögren syndrome antigens A and B (SS-A and SS-B, respectively), antitissue transglutaminase and antiendomysial antibodies, and paraneoplastic profile. Serum analysis was also negative for human immunodeficiency virus type 1 and type 2 RNA, Venereal Disease Research Laboratory (VDRL) test, rapid plasma regain (RPR), and fluorescent treponemal antibody absorption. Cerebrospinal fluid (CSF) analysis revealed clear fluid, a normal glucose level (64 mg/dL [3.6 mmol/L]; normal range, 40-70 mg/dL [2.2-3.9 mmol/L]), an elevated protein level (97 mg/dL; normal range, 12-60 mg/dL), and an elevated white blood cell count (7/mm(3) [0.007 ×10(9)/L] in tube 1 and 17/mm(3) [0.017 × 10(9)/L] in tube 2) with 84% lymphocytes. CSF immunoglobulin G level was elevated (30.1 mg/dL; normal, RPR test results for CSF were negative. CSF did not grow any bacteria, fungus, or acid-fast bacillus at culture. CSF flow cytometry did not reveal a monoclonal lymphoid population. Initial imaging included brain magnetic resonance (MR) imaging. Computed tomography (CT) images of the chest, abdomen, and pelvis were normal (not shown). The patient's clinical symptoms and imaging findings responded to treatment with a high dose of oral steroids. However, the patient's symptoms exhibited clinical and radiologic progression after several attempts to taper the steroid dose. PMID:25420171

  3. Stage Movement with Scripts and More Work with Scenes. TAP (Theatre Arts Package) 211 and 212. (United States)

    Engelsman, Alan; Thalden, Irene

    The purpose of these lessons is to provide learning experiences which facilitate junior high and senior high school actors' mastery of stage movements when working with scripts. Suggested exercises include practice in finding motivation for actors' stage movements, acting a scene (from "West Side Story"), and interpreting and acting scenes of…

  4. 48 CFR 252.212-7000 - Offeror representations and certifications-Commercial items. (United States)


    ... regulations of the President. (b) Certification. By submitting this offer, the Offeror, if a foreign person, company or entity, certifies that it— (1) Does not comply with the Secondary Arab Boycott of Israel;...

  5. 36 CFR 212.10 - Maximum economy National Forest System roads. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Maximum economy National... economy National Forest System roads. The Chief may acquire, construct, reconstruct, improve, and maintain... Forest Service in locations and according to specifications which will permit maximum economy...

  6. 20 CFR 725.212 - Conditions of entitlement; surviving spouse or surviving divorced spouse. (United States)


    ... due to pneumoconiosis at the time of death or to have died due to pneumoconiosis. A surviving spouse... establish that the deceased miner's death was due to pneumoconiosis in order to establish entitlement...

  7. 48 CFR 52.212-3 - Offeror Representations and Certifications-Commercial Items. (United States)


    ...); □ Foreign government; □ International organization per 26 CFR 1.6049-4; □ Other _____. (5) Common parent... force or humanitarian organization; (5) Consist of providing goods or services that are used only to.... Restricted business operations means business operations in Sudan that include power production...

  8. Sensitivity and uncertainty analysis for the mixed-oxide thermal lattice U-L212

    International Nuclear Information System (INIS)

    The sensitivities of a mixed oxide (2Wt%PuO2 - 8% 240Pu) fueled, light water moderated critical lattice experiment carried out at Battelle Northwest Laboratories under EPRI sponsorship have been determined. A two-dimensional diffusion theory analysis was performed and the sensitivity of the eigenvalue (k) and four reaction rate ratios to changes in nuclear data have been determined. The sensitivity analysis capability was extended to include upscattering and multi-dimension ability. A covariance matrix has been developed for 239Pu, and the uncertainty associated with calculated performance parameters due to uncertainties in nuclear data has been obtained

  9. (2-Acetylphenolato(2-{1-[2-(morpholin-4-ylethylimino]ethyl}phenolato(thiocyanato-κNcobalt(III

    Directory of Open Access Journals (Sweden)

    Chen-Yi Wang


    Full Text Available The title mononuclear cobalt(III complex, [Co(C14H19N2O2(C8H7O2(NCS], was obtained by the reaction of 2-acetylphenol, 2-(morpholin-4-ylethylamine, ammonium thiocyanate and cobalt nitrate in methanol. The CoIII atom is coordinated by one phenolate O, one imine N, and one amine N atom of the tridentate Schiff base ligand, two O atoms of the 2-acetylphenolate anion and one thiocyanate N atom. This results in a fairly regular fac-CoN3O3 octahedral coordination geometry for the metal ion. The dihedral angle between the two benzene rings is 88.3 (3°.

  10. 49 CFR 212.231 - Highway-rail grade crossing inspector. (United States)


    ... Grade Crossing Signal System Safety Rules (49 CFR part 234); (3) Knowledge of operating practices and... the Grade Crossing Signal System Safety Rules (49 CFR part 234), including the remedial action... determining compliance with Grade Crossing Signal System Safety Rules (49 CFR part 234), to make reports...

  11. 36 CFR 212.9 - Principles for sharing use of roads. (United States)


    ... and economically serve the contemplated use, unless the Chief determines that the safety and economy... Service and intermingled and adjacent private and public lands and for the use and development of the... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Principles for sharing use...

  12. AB212. Clinical study on the treatment of lifelong premature ejaculation with Paroxetine hydrochloride and tamsulosin


    Li, Yan-Feng; Zhang, Chao; Li, Bo-jun


    Objective There are quite a few researches about SSRIs and alpha-receptor blockers on the treatment of premature ejaculation (PE), but few researches focus on the combination use of them. In this study, we evaluate the efficacy and safety of combine and alone use of paroxetine hydrochloride and tamsulosin on the treatment of lifelong PE. Methods 352 cases of men with 18–65 years of age, a history of lifelong PE and an intra-vaginal ejaculation latency time (IELT)

  13. Design of a multi-band RF front-end between 2-12 GHz.


    Yu, Sang


    The state-of-the-art standard for short range wireless data transmission is the Ultra Wide Band radio (UWB) standard. UWB provides the maximum data rate of 480 Mbit/s. However, for some data transmission applications this is far from sufficient. Since there already are a lot of research and development activities in wireless technology, the demands on even higher data rates is considered as necessary. The research group of Communication Electronics at ITN has a new concept to design a radio f...

  14. Aviation Structural Mechanic, First Class, 2-12. Military Curriculum Materials for Vocational and Technical Education. (United States)

    Ohio State Univ., Columbus. National Center for Research in Vocational Education.

    This self-paced, individualized course, adapted from military curriculum materials for use in vocational and technical education, teaches students the skills needed to become aviation structural mechanics (first class). The course materials consist of three pamphlets. The first pamphlet covers aircraft maintenance management, records, and reports…

  15. Generator method of 225Ac production without a carrier for nuclear medicine

    International Nuclear Information System (INIS)

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  16. 50 CFR 226.212 - Critical habitat for 13 Evolutionarily Significant Units (ESUs) of salmon and steelhead... (United States)


    ... as defined by the ordinary high-water line (33 CFR 319.11). In areas where ordinary high-water line...-ways. In areas within Navy security zones identified at 33 CFR 334 that are outside the areas described...); McCarty Creek (48.7275, -122.2188); Plumbago Creek (48.6088, -122.0949); Pond Creek (48.6958,...

  17. CALiPER Report 21.2. Linear (T8) LED Lamp Performance in Five Types of Recessed Troffers

    Energy Technology Data Exchange (ETDEWEB)



    Although lensed troffers are numerous, there are many other types of optical systems as well. This report looks at the performance of three linear (T8) LED lamps—chosen primarily based on their luminous intensity distributions (narrow, medium, and wide beam angles)—as well as a benchmark fluorescent lamp in five different troffer types. Also included are the results of a subjective evaluation. Results show that linear (T8) LED lamps can improve luminaire efficiency in K12-lensed and parabolic-louvered troffers, effect little change in volumetric and high-performance diffuse-lensed type luminaires, but reduce efficiency in recessed indirect troffers. These changes can be accompanied by visual appearance and visual comfort consequences, especially when LED lamps with clear lenses and narrow distributions are installed. Linear (T8) LED lamps with diffuse apertures exhibited wider beam angles, performed more similarly to fluorescent lamps, and received better ratings from observers. Guidance is provided on which luminaires are the best candidates for retrofitting with linear (T8) LED lamps.

  18. 21 CFR 212.1 - What are the meanings of the technical terms used in these regulations? (United States)


    ... active pharmaceutical ingredient. In-process material means any material fabricated, compounded, blended... the Federal Food, Drug, and Cosmetic Act, as amended (21 U.S.C. 321 et seq.). Active pharmaceutical... pharmaceutical ingredient, analytical supplies, and other components, including container-closure systems and...

  19. Radiogenic Side Effects After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    Energy Technology Data Exchange (ETDEWEB)

    Dunavoelgyi, Roman [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Dieckmann, Karin [Department of Radiology, Medical University of Vienna, Vienna (Austria); Gleiss, Andreas [Section of Clinical Biometrics, Medical University of Vienna, Vienna (Austria); Sacu, Stefan; Kircher, Karl; Georgopoulos, Michael [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Georg, Dietmar [Department of Radiology, Medical University of Vienna, Vienna (Austria); Zehetmayer, Martin, E-mail: [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Poetter, Richard [Department of Radiology, Medical University of Vienna, Vienna (Austria)


    Purpose: To evaluate side effects of hypofractionated stereotactic photon radiotherapy for patients with choroidal melanoma. Patients and Methods: Two hundred and twelve patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at the Medical University of Vienna between 1997 and 2007 with a Linac with 6-MV photon beams in five fractions with 10, 12, or 14 Gy per fraction. Examinations for radiogenic side effects were performed at baseline and every 3 months in the first 2 years, then every 6 months until 5 years and then once a year thereafter until 10 years after radiotherapy. Adverse side effects were assessed using slit-lamp examination, funduscopy, gonioscopy, tonometry, and, if necessary, fundus photography and fluorescein angiography. Evaluations of incidence of side effects are based on an actuarial analysis. Results: One hundred and eighty-nine (89.2%) and 168 (79.2%) of the tumors were within 3 mm of the macula and the optic disc, respectively. The five most common radiotherapy side effects were retinopathy and optic neuropathy (114 cases and 107 cases, respectively), cataract development (87 cases), neovascular glaucoma (46 cases), and corneal epithelium defects (41 cases). In total, 33.6%, 38.5%, 51.2%, 75.5%, and 77.6% of the patients were free of any radiation retinopathy, optic neuropathy, cataract, neovascular glaucoma, or corneal epithelium defects 5 years after radiotherapy, respectively. Conclusion: In centrally located choroidal melanoma hypofractionated stereotactic photon radiotherapy shows a low to moderate rate of adverse long-term side effects comparable with those after proton beam radiotherapy. Future fractionation schemes should seek to further reduce adverse side effects rate while maintaining excellent local tumor control.

  20. Damage thresholds of various materials irradiated by 100-ps pulses of 21.2-nm laser radiation

    Czech Academy of Sciences Publication Activity Database

    Hájková, Věra; Chalupský, Jaromír; Wabnitz, H.; Feldhaus, J.; Störmer, M.; Hecquet, Ch.; Mocek, Tomáš; Kozlová, Michaela; Polan, Jiří; Homer, Pavel; Rus, Bedřich; Juha, Libor

    Bellingham: SPIE, 2009 - (Juha, L.; Bajt, S.; Sobierajski, R.), 736110/1-736110/6. (Proceedings of SPIE. 7361). ISBN 9780819476357. ISSN 0277-786x. [Damage to VUV, EUV, and X-Ray Optics II. Prague (CZ), 21.04.2009-23.04.2009] R&D Projects: GA AV ČR KAN300100702; GA MŠk LC510; GA MŠk(CZ) LC528; GA MŠk LA08024; GA AV ČR IAA400100701 Grant ostatní: LASERLAB-EUROPE(XE) RII3-CT-2003-506350 Institutional research plan: CEZ:AV0Z10100523 Keywords : soft x-ray laser * damage to x-ray optics * laser ablation * damage thresholds * single- shot damage Subject RIV: BH - Optics, Masers, Lasers

  1. Study of damages induced in DNA by X-UV laser irradiation at 21.2 nm

    Czech Academy of Sciences Publication Activity Database

    Cassou, K.; Ros, D.; Kazamias, S.; Klisnick, A.; Jamelot, G.; Guilbaud, O.; Rus, Bedřich; Kozlová, Michaela; Polan, Jiří; Präg R., Ansgar; Stupka, Michal; Eot-Houllier, G.; Sage, E.; Běgusová, Marie; Štísová, Viktorie; du Penhoat, M.A.H.; Touati, A.; Chétioui, A.


    Roč. 127, - (2005), s. 177-180. ISSN 1155-4339. [Colloque sur les Sources cohérentes et incohérentes UV, VUV et X - Applications et développements récents /7./. Saint-Etienne, 07.06.04-11.06.04] R&D Projects: GA MŠk(CZ) LN00A100; GA AV ČR(CZ) IAA1010014 Grant ostatní: EU(XE) HPRI-00108 Institutional research plan: CEZ:AV0Z10100523 Keywords : radiation biology * X-ray laser * DNA plasmid Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.389, year: 2005

  2. 国外新批准上市的药物新制剂新剂型(212

    Institute of Scientific and Technical Information of China (English)



  3. 9,10-Bis{2-[1-(2-pyridylmethylimidazolium-3-yl]ethoxy}anthracene bis(hexafluoridophosphate

    Directory of Open Access Journals (Sweden)

    Li-Hui Guo


    Full Text Available The cation of the title compound, C36H34N6O22+·2PF6−, lies across a crystallographic inversion centre. The imidazole and pyridine rings form dihedral angles of 82.28 (5° and 11.87 (7°, respectively, with the anthracene ring system. The crystal packing is stabilized by π–π interactions between the pyridine ring and the central ring of anthracene, with a ring centroid–centroid distance of 3.684 (3 Å. The PF6− anion is disordered over three different positions with occupancies of 0.284 (6, 0.354 (8 and 0.362 (9.

  4. Is asthma in 2-12 year-old children associated with physician-attended recurrent upper respiratory tract infections?

    NARCIS (Netherlands)

    Hak, Eelko; Rovers, Maroeska M; Sachs, Alfred P E; Stalman, Wim A B; Verheij, Theo J M


    In a prevalence study, we evaluated whether recurrent physician-attended URTI episodes are more common in asthmatic children as compared to age- and gender-matched controls. URTI proneness, defined as > or = 5 episodes of rhinitis/pharyngitis, sinusitis, laryngitis/tracheitis or otitis media in a 24

  5. Background information and biorefinery status, potential and Sustainability: Task 2.1.2 Market and Consumers; Carbohydrates


    Bos, H.L.; Harmsen, P.F.H.; Annevelink, E.


    This report was produced to give an overview of present and future market for biorefinery products based on carbohydrates. Various studies show that there is a wealth of possible molecules and products that can be produced from carbohydrates. Carbohydrates already find significant application in starch products and cellulose plastics and fibres. However, for a biorefinery to operate in an economically sustainable way, applications for (preferably all) biomass ingredients need to be found. Pre...

  6. SU-E-T-212: Influence of the Modulation Index On Daily Quality Assurance in Rapid Arc Treatments

    International Nuclear Information System (INIS)

    Purpose: At our Institute some measured parameters for daily quality assurance (DQA) of dynamic arc therapy plans showed an unexpected behavior, therefore an investigation of the influence of the magnitude of modulation was conducted. Methods: In our clinical practice all DQAs of dynamic arc therapy plans are measured and analyzed prior to treatments using commercial software. For this study these plans were additionally exported to our in-house software written in MATLAB.The developed software extracted the leaf position, gantry angle, cumulative meterset weight of each control point (CP) and the total number of Monitor Units (MU) of each arc. Based on this information we calculated the leaf travel distance, irradiated segment area, number of MUs and dose rate for each CP. These data allowed us to calculate the modulation indexes (MI) of the plans, applying five different definitions of MI. The results were then correlated to the results of our DQA measurements.To validate the software, additional plans of known MIs were created and analyzed. For confirmation, the calculated parameters were compared to the segmented treatment table (STT) coming from the treatment planning system. Results: All calculated CP-parameters matched the STT by 99% or better. For linac 1, the comparison of the MI evaluation and the DQA results showed a slight tendency: 91.3% failed DQA plans had a MI lower than the average value. For this definition we consider that the lower the MI the higher the modulation. The results of the linac 2 present no significant relevance due to the low sample sizes for each DQA software. Conclusion: Available data and given definitions of the modulation index do not bring conclusive results; one cannot find a clear and distinct correlation with the failure of the DQA. The ongoing analysis with an increased sample size might lead to another conclusion

  7. Performance and application of a very high-speed 2-12 μm ultraspectral FTIR imager (United States)

    Dombrowski, Mark; Szczesniak, Martin; Lorenz, Jim; Beecroft, Mike; Ferguson, Jamie; Catanzaro, Brian


    As an offshoot of hyperspectral imaging, which typically acquires tens to slightly more than 100 spectral bands, ultraspectral imaging, with typically more than 1000 bands, provides the ability to use molecular or atomic lines to identify surface or airborne contaminants. Surface Optics Corporation has developed a very high-speed Fourier Transform Infrared (FTIR) imaging system. This system operates from 2 μm to 12 μm, collecting 128 ×128 images at up to 10,000 frames-per-second. The high-speed infrared imager is able to synchronize to almost any FTIR that provides at least mirror direction and laser clock signals. FTIRs rarely produce a constant scan speed, due to the need to physically move a mirror or other optical device to introduce an optical path difference between two beams. The imager is able to track scan speed jitter, as well as changes in position of the zero path difference (ZPD) position, and perform real-time averaging if desired. Total acquisition time is dependent on the return stroke speed of the FTIR, but 16 cm -1 (1024 point) spectral imagery can be generated in less than 1/5 second , with 2 cm -1 (8192 point) spectral imagery taking proportionately longer. The imager is currently configured with X-Y position stages to investigate surface chemistry of varied objects. Details of the optical design, focal plane array, and electronics that allow this high-speed FTIR imager to function are presented. Results of using the imager for several applications are also presented.

  8. 2-{1-[(2-Nitro­benzene­sulfonamido)­meth­yl]cyclo­hexyl}acetic acid


    Kanwal, Nosheen; Akbar Hussain, Erum; Şahin, Onur; Büyükgüngör, Orhan


    In the title compound, C15H20N2O6S, the C—SO2—NH—C torsion angle is 64.54 (14)°. In the mol­ecule, there is a bifurcated N—H⋯(O,O) hydrogen bond, forming S(7) rings. In the crystal, inversion dimers are formed via O—H⋯O hydrogen bonds involving the carboxyl group, so forming R 2 2(8) rings. These dimers are further linked via pairs of C—H⋯O hydrogen bonds, forming a C(6) chain propagating along the c-axis direction.

  9. Radiogenic Side Effects After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    International Nuclear Information System (INIS)

    Purpose: To evaluate side effects of hypofractionated stereotactic photon radiotherapy for patients with choroidal melanoma. Patients and Methods: Two hundred and twelve patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at the Medical University of Vienna between 1997 and 2007 with a Linac with 6-MV photon beams in five fractions with 10, 12, or 14 Gy per fraction. Examinations for radiogenic side effects were performed at baseline and every 3 months in the first 2 years, then every 6 months until 5 years and then once a year thereafter until 10 years after radiotherapy. Adverse side effects were assessed using slit-lamp examination, funduscopy, gonioscopy, tonometry, and, if necessary, fundus photography and fluorescein angiography. Evaluations of incidence of side effects are based on an actuarial analysis. Results: One hundred and eighty-nine (89.2%) and 168 (79.2%) of the tumors were within 3 mm of the macula and the optic disc, respectively. The five most common radiotherapy side effects were retinopathy and optic neuropathy (114 cases and 107 cases, respectively), cataract development (87 cases), neovascular glaucoma (46 cases), and corneal epithelium defects (41 cases). In total, 33.6%, 38.5%, 51.2%, 75.5%, and 77.6% of the patients were free of any radiation retinopathy, optic neuropathy, cataract, neovascular glaucoma, or corneal epithelium defects 5 years after radiotherapy, respectively. Conclusion: In centrally located choroidal melanoma hypofractionated stereotactic photon radiotherapy shows a low to moderate rate of adverse long-term side effects comparable with those after proton beam radiotherapy. Future fractionation schemes should seek to further reduce adverse side effects rate while maintaining excellent local tumor control.

  10. Time intervals from first symptom to treatment of cancer: a cohort study of 2,212 newly diagnosed cancer patients

    DEFF Research Database (Denmark)

    Hansen, Rikke P; Vedsted, Peter; Sokolowski, Ineta; Søndergaard, Jens; Olesen, Frede

    Delay in diagnosis of cancer may worsen prognosis. The aim of this study is to explore patient-, general practitioner (GP)- and system-related delay in the interval from first cancer symptom to diagnosis and treatment, and to analyse the extent to which delays differ by cancer type....

  11. (2E-1-Phenyl-2-[1-(2-phenylprop-2-en-1-ylpyrrolidin-2-ylidene]ethanone

    Directory of Open Access Journals (Sweden)

    Lee G. Madeley


    Full Text Available The title compound, C21H21NO, is a vinylogous amide (enaminone produced by reaction of 1-(2-phenylprop-2-en-1-ylpyrrolidine-2-thione with phenacyl bromide. In the molecule, the phenyl rings are twisted from the mean plane of the pyrrolidine ring by 11.2 (1 and 67.3 (1°. In the crystal, weak C—H...O hydrogen bonds link the molecules related by translation along the b axis into chains.

  12. 8 CFR 1212.9 - Applicability of section 212(a)(32) to certain derivative third and sixth preference and... (United States)


    ... nonpreference immigrant under section 203(a)(8) of the Act, who is also a graduate of a medical school, is eligible for an immigrant visa or for adjustment of status under section 245 of the Act, whether or not... nonpreference immigrant and who is also a graduate of a medical school as defined by section 101(a)(41) of...

  13. Optical method for the measurement of the isotope ratio 13CO2/12CO2 for medical applications

    International Nuclear Information System (INIS)

    Currently, stable isotope measurements in breath tests using 13C-labeled substrates become more and more desirable, but their usage in medical applications is still limited by the very expensive and complex technique of mass spectrometry. A special light source is used to build a new non dispersive isotope-selective infrared spectrometer (ndirs) with a good isotope selectivity. The accuracy of the ndirs is 6,5 %o and is quite good. We present first results for a stabilized light source that give rise to get an accuracy better than ±1,5 %o. (author)

  14. Evaluating calibration strategies for isotope ratio infrared spectroscopy for atmospheric 13CO2/12CO2 measurement

    Directory of Open Access Journals (Sweden)

    X. Lee


    Full Text Available Isotope ratio infrared spectroscopy (IRIS provides an in-situ technique for measuring δ13C in atmospheric CO2. A number of methods have been proposed for calibrating the IRIS measurements, but few studies have systematically evaluated their accuracy for atmospheric applications. In this study, we carried out laboratory and ambient measurements with two commercial IRIS analyzers and compared the accuracy of four calibration strategies. We found that calibration based on the 12C and 13C mixing ratios (Bowling et al., 2003 and that based on linear interpolation of the measured delta using the mixing ratio of the major isotopologue (Lee et al., 2005 yielded accuracy better than 0.06‰. Over a 7-day atmospheric measurement in Beijing, the two analyzers differed by 9.44 ± 1.65‰ (mean ± 1 standard deviation of hourly values before calibration and agreed to within −0.02 ± 0.18‰ after properly calibration. However, even after calibration the difference between the two analyzers showed a slight correlation with concentration, and this concentration dependence propagated through the Keeling analysis resulting in a much larger difference of 2.44‰ for the Keeling intercept. The high sensitivity of the Keeling analysis to the concentration dependence underscores the challenge of IRIS for atmospheric research.

  15. 2.1.2. A Novel Lead(II MOF Constructed Through 2-Fold Non-linear FDA as Linker

    Directory of Open Access Journals (Sweden)

    Ya-feng Li*, Yan Liu, Wen-yuan Gao, Jing-jing Lu


    Full Text Available A unique three-dimensional metal-organic framework —— Pb(FDA (FDA = furan-2,5-dicarboxylic acid has been hydrothermally synthesized and structurally determined by single-crystal X-ray analysis. The crystal is of tetragonal system, space group I41/a, C6H2O5Pb, Mr = 361.27, a = 13.863(2 Å, b = 13.863(2 Å, c = 13.998(3 Å, V = 2690.0(8 Å3, Z = 16, Dc = 3.568 g/cm3, F(000 = 2560, ?(MuK? = 25.060 mm-1, Rint = 7.32%, R1 = 2.59% and wR1 = 5.88% for 1543 observed reflections with I > 2?(I. Pb cation is six-coordinated by oxygens of FDA, showing the hemi directed geometry. Pb cations are connected into zigzag chain along b direction in bc planar by FDA, which is furthermore linked to three-dimensional framework with very tiny aperture by bridged carboxyl oxygens of FDA. The elemental analyses, PXRD, FTIR spectra and the thermal stability have been structurally characterized.

  16. VEGFR3 Inhibition Chemosensitizes Ovarian Cancer Stemlike Cells through Down-Regulation of BRCA1 and BRCA212 (United States)

    Lim, Jaeyoung; Yang, Kun; Taylor-Harding, Barbie; Wiedemeyer, W. Ruprecht; Buckanovich, Ronald J.


    In ovarian cancer, loss of BRCA gene expression in tumors is associated with improved response to chemotherapy and increased survival. A means to pharmacologically downregulate BRCA gene expression could improve the outcomes of patients with BRCA wild-type tumors. We report that vascular endothelial growth factor receptor 3 (VEGFR3) inhibition in ovarian cancer cells is associated with decreased levels of both BRCA1 and BRCA2. Inhibition of VEGFR3 in ovarian tumor cells was associated with growth arrest. CD133+ ovarian cancer stemlike cells were preferentially susceptible to VEGFR3-mediated growth inhibition. VEGFR3 inhibition–mediated down-regulation of BRCA gene expression reversed chemotherapy resistance and restored chemosensitivity in resistant cell lines in which a BRCA2 mutation had reverted to wild type. Finally, we demonstrate that tumor-associated macrophages are a primary source of VEGF-C in the tumor microenvironment. Our studies suggest that VEGFR3 inhibition may be a pharmacologic means to downregulate BRCA genes and improve the outcomes of patients with BRCA wild-type tumors. PMID:24862760

  17. Assistive Technology for Infants, Toddlers, and Young Children with Disabilities. PACER Center ACTion Information Sheets: PHP-c212 (United States)

    PACER Center, 2014


    Research shows that assistive technology (AT) can help young children with disabilities to learn developmental skills. Its use may help infants and toddlers to improve in many areas such as: (1) social skills including sharing and taking turns; (2) communication skills; (3) attention span; (4) fine and gross motor skills; and (5) self confidence…

  18. Skeletal muscle ACC2 S212 phosphorylation is not required for the control of fatty acid oxidation during exercise


    O’Neill, Hayley M.; Lally, James S.; Galic, Sandra; Pulinilkunnil, Thomas; Ford, Rebecca J; Dyck, Jason R.B.; van Denderen, Bryce J.; Kemp, Bruce E.; Steinberg, Gregory R


    During submaximal exercise fatty acids are a predominant energy source for muscle contractions. An important regulator of fatty acid oxidation is acetyl-CoA carboxylase (ACC), which exists as two isoforms (ACC1 and ACC2) with ACC2 predominating in skeletal muscle. Both ACC isoforms regulate malonyl-CoA production, an allosteric inhibitor of carnitine palmitoyltransferase 1 (CPT-1); the primary enzyme controlling fatty acyl-CoA flux into mitochondria for oxidation. AMP-activated protein kinase...

  19. Oahu Hyperspectral Imagery 2000 (212-0612-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  20. 2-(1,2-Dihydro-2-oxopyridin-3-yl-1,3-benzothiazol-3-ium bromide monohydrate

    Directory of Open Access Journals (Sweden)

    Kim Potgieter


    Full Text Available The title hydrated molecular salt, C12H9N2OS+·Br−·H2O, the aza-substituted six-membered ring is present as its keto tautomer instead of its aromatic tautomer. The dihedral angle between the fused ring system and the pyridinone ring in the cation is 6.91 (6°. In the crystal, bifurcated N—H...(O,Br and O—H...Br hydrogen bonds and S...O contacts [S...O = 3.0526 (10 Å] connect the components into a three-dimensional network. The closest centroid–centroid distance between two π-systems is 3.7420 (7 Å between two benzene rings.

  1. 48 CFR 52.212-5 - Contract Terms and Conditions Required To Implement Statutes or Executive Orders-Commercial Items. (United States)


    ...). ___(2) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010)(Pub. L. 110-252, Title VI... required by the clause— (i) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010) (Pub. L... Business Ethics and Conduct (APR 2010) (Pub. L. 110-252, Title VI, Chapter 1 (41 U.S.C. 251 note)). (B)...

  2. DOE CALiPER Program, Report 21.2: Linear (T8) LED Lamp Performance in Five Types of Recessed Troffers

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Naomi J.; Perrin, Tess E.; Royer, Michael P.; Wilkerson, Andrea M.; Beeson, Tracy A.


    Although lensed troffers are numerous, there are many other types of optical systems as well. This report looked at the performance of three linear (T8) LED lamps chosen primarily based on their luminous intensity distributions (narrow, medium, and wide beam angles) as well as a benchmark fluorescent lamp in five different troffer types. Also included are the results of a subjective evaluation. Results show that linear (T8) LED lamps can improve luminaire efficiency in K12-lensed and parabolic-louvered troffers, effect little change in volumetric and high-performance diffuse-lensed type luminaires, but reduce efficiency in recessed indirect troffers. These changes can be accompanied by visual appearance and visual comfort consequences, especially when LED lamps with clear lenses and narrow distributions are installed. Linear (T8) LED lamps with diffuse apertures exhibited wider beam angles, performed more similarly to fluorescent lamps, and received better ratings from observers. Guidance is provided on which luminaires are the best candidates for retrofitting with linear (T8) LED lamps.

  3. SU-E-J-212: MR Diffusion Tensor Imaging for Assessment of Tumor and Normal Brain Tissue Responses of Juvenile Pilocytic Astrocytoma Treated by Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Hou, P; Park, P; Li, H; Zhu, X; Mahajan, A; Grosshans, D [M.D. Anderson Cancer Center, Houston, TX (United States)


    Purpose: Diffusion tensor imaging (DTI) can measure molecular mobility at the cellular level, quantified by the apparent diffusion coefficient (ADC). DTI may also reveal axonal fiber directional information in the white matter, quantified by the fractional anisotropy (FA). Juvenile pilocytic astrocytoma (JPA) is a rare brain tumor that occurs in children and young adults. Proton therapy (PT) is increasingly used in the treatment of pediatric brain tumors including JPA. However, the response of both tumors and normal tissues to PT is currently under investigation. We report tumor and normal brain tissue responses for a pediatric case of JPA treated with PT assessed using DTI. Methods: A ten year old male with JPA of the left thalamus received passive scattered PT to a dose of 50.4 Gy (RBE) in 28 fractions. Post PT, the patient has been followed up in seven years. At each follow up, MRI imaging including DTI was performed to assess response. MR images were registered to the treatment planning CT and the GTV mapped onto each MRI. The GTV contour was then mirrored to the right side of brain through the patient’s middle line to represent normal brain tissue. ADC and FA were measured within the ROIs. Results: Proton therapy can completely spare contra lateral brain while the target volume received full prescribed dose. From a series of MRI ADC images before and after PT at different follow ups, the enhancement corresponding to GTV had nearly disappeared more than 2 years after PT. Both ADC and FA demonstrate that contralateral normal brain tissue were not affect by PT and the tumor volume reverted to normal ADC and FA values. Conclusion: DTI allowed quantitative evaluation of tumor and normal brain tissue responses to PT. Further study in a larger cohort is warranted.

  4. Evolution of the passive and active microwave signatures of a large sea ice feature during its 212-year drift through the Arctic Ocean (United States)

    Gohin, Francis; Cavanié, Alain; Ezraty, Robert


    Although estimation of the total ice concentration from special sensor microwave imagers (SSM/I) has proven to be successful, none of the various algorithms developed to discriminate new and older ice provide satisfying results. While the strong contrast between the emissivity of sea ice and that of open water can be utilized to provide reliable estimators of the total ice concentration, passive microwave characteristics of second-year and multiyear ice may locally evolve in different ways, even during the cold season. Scatterometers, as the active microwave instrument in wind mode (AMI-wind) on board the European Remote Sensing Satellites (ERS), provide backscatter data which have a higher sensitivity to the surface topography of ice and a better stability in time, at a resolution compatible with the SSM/I measurements. Here we present the evolutions of the microwave properties of an ice feature appearing along the shores of Novosibirskiye Ostrova (New Siberian Islands) at the end of July 1992 as the ice ages during its 3-year drift toward the Fram Strait. The track of this well-defined ice surface is easily followed on the maps of the backscatter coefficient provided by the AMI-wind during the cold season. In summer, because of melting, the ice undergoes critical changes which alter its microwave signatures and hamper automatic tracking. Moreover, on approaching the Fram Strait the resolution of the scatterometer is not sufficient to capture the complex and rapid transformations of the ice cover. To compensate for this, buoy data obtained from the International Arctic Buoy Program are used, alone during summers or together with satellite data, to build basin-wide ice displacement fields. These displacement fields, successively applied to each pixel of the ice feature selected, provide a series of Lagrangian observations. During the drift, which ends in May 1995, the active and passive signatures evolve coherently, except for the cold season 1992-1993 when unrealistic multiyear ice concentrations are deduced from the brightness temperatures, which, at that time, are much less stable than the backscatter coefficient over the ice surface tracked, identified as second-year ice.

  5. Federal Education Tax Benefits: Who Receives Them and to What Extent Do They Shape the Price of College Attendance? Stats in Brief. NCES 2012-212 (United States)

    Radford, Alexandria Walton; Berkner, Lutz


    This Statistics in Brief applies IRS rules and data to a nationally representative sample of 2007-08 undergraduates to estimate who received education tax benefits and looks at the extent to which these benefits shaped their price of college attendance. Key findings include: (1) Nearly one-half of all 2007-08 undergraduates were estimated to have…

  6. SU-E-J-212: MR Diffusion Tensor Imaging for Assessment of Tumor and Normal Brain Tissue Responses of Juvenile Pilocytic Astrocytoma Treated by Proton Therapy

    International Nuclear Information System (INIS)

    Purpose: Diffusion tensor imaging (DTI) can measure molecular mobility at the cellular level, quantified by the apparent diffusion coefficient (ADC). DTI may also reveal axonal fiber directional information in the white matter, quantified by the fractional anisotropy (FA). Juvenile pilocytic astrocytoma (JPA) is a rare brain tumor that occurs in children and young adults. Proton therapy (PT) is increasingly used in the treatment of pediatric brain tumors including JPA. However, the response of both tumors and normal tissues to PT is currently under investigation. We report tumor and normal brain tissue responses for a pediatric case of JPA treated with PT assessed using DTI. Methods: A ten year old male with JPA of the left thalamus received passive scattered PT to a dose of 50.4 Gy (RBE) in 28 fractions. Post PT, the patient has been followed up in seven years. At each follow up, MRI imaging including DTI was performed to assess response. MR images were registered to the treatment planning CT and the GTV mapped onto each MRI. The GTV contour was then mirrored to the right side of brain through the patient’s middle line to represent normal brain tissue. ADC and FA were measured within the ROIs. Results: Proton therapy can completely spare contra lateral brain while the target volume received full prescribed dose. From a series of MRI ADC images before and after PT at different follow ups, the enhancement corresponding to GTV had nearly disappeared more than 2 years after PT. Both ADC and FA demonstrate that contralateral normal brain tissue were not affect by PT and the tumor volume reverted to normal ADC and FA values. Conclusion: DTI allowed quantitative evaluation of tumor and normal brain tissue responses to PT. Further study in a larger cohort is warranted

  7. 77 FR 67557 - Special Conditions: ATR-GIE Avions de Transport Regional, Models ATR42-500 and ATR72-212A... (United States)


    ... Privacy Act Statement can be found in the Federal Register published on April 11, 2000 (65 FR 19477-19478... electronic form of all comments received into any FAA docket, including the name of the individual sending... configuration may allow the exploitation of network security vulnerabilities resulting in intentional...

  8. « A Bactrian Deed of Manumission ». Silk Road Art and Archaeology, 5, (1997-8), pp. 191-212


    La Vaissière, Étienne de


    L’A. présente un contrat bactrien de libération d’esclave, désormais conservé au Japon, mais provenant sans doute du Tokharestan (il est rédigé dans la cité de Lan que les sources chinoises situent dans cette région). Il date probablement de 479. L’A. en donne une édition, une traduction, un commentaire philologique et historique, des photos, ainsi qu’un glossaire. Parmi les points les plus intéressants historiquement, mentionnons l’existence d’un βαγοβανδαγο bactrien, ce qui peut conduire à ...

  9. Report on current state of the art and major knowledge gaps to characterize water stress in different sectors. Aquastress D2.1.2 - Final report


    Manez, M.; Inman, D.; S. Schmidt; Tarnacki, K.; Preziosi, E.; Koundouri, P.; S. Loubier; Sullivan, C.; Panebianco, S.; Van den Wyngaert, I.; Bauer, M.; Moors, E.; Olsthoorn, A.


    With this report we have tried to rise the awareness within the project on the still existing knowledge gaps in the different sectors of the water consumers: domestic sector, agricultural sector, environmental sector and industrial sector (including tourism). Our internal experts have dedicated an extra chapter to every sector. This report summarizes the state of the art of water stress in the sectors and represents the basis for the development of the test-site reports delivered by WP 2.2

  10. 25 CFR 1000.212 - What is the role of the Tribe/Consortium when a bureau initiates a public meeting? (United States)


    ... AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT.../Consortium should meet to plan and discuss the conduct of the meeting, meeting protocols, and general... 25 Indians 2 2010-04-01 2010-04-01 false What is the role of the Tribe/Consortium when a...

  11. QCL - Optical-Feedback Cavity Enhanced Absorption Spectroscopy For The Analysis Of Atmospheric 13CO2/12CO2 In Ice-Core Gas Bubbles (United States)

    Gorrotxategi Carbajo, Paula; Romanini, Daniele; Maisons, Gregory; Carras, Mathieu; Chappellaz, Jerome; Kerstel, Erik


    In the context of a globally warming climate it is crucial to study the climate variability in the past and to understand the underlying mechanisms. The composition of gas stored in bubbles in polar ice presents a paleo-climate archive that provides a powerful means to study the exact mechanisms involved in the ~40% increase in the atmospheric CO2 concentration between glacial and interglacial climates. It is particularly important to understand such natural coupling between climate and the carbon cycle, as it will partly determine what natural feedback can be expected on the atmospheric CO2 concentration in a future warmer world. The source of the CO2 released into the atmosphere during previous deglaciations can be constrained from isotopic measurements by the fact that the different CO2 reservoirs (terrestrial biosphere, oceans) and associated mechanisms (biological or physical) have different isotopic signatures. Unfortunately, such isotope studies have been seriously hampered by the experimental difficulty of extracting the CO2 without contamination or fractionation, and measuring the isotope signal off-line on an isotope ratio mass spectrometer (IRMS). Here we present an alternative method that leverages the extreme sensitivity afforded by Optical Feedback Cavity Enhanced Absorption Spectroscopy (OF-CEAS) in the Mid-Infrared [1]. This region of the spectrum is accessed by a custom-developed Quantum Cascade Laser operating near 4.35 µm. The feedback to the laser of light that has been spectrally filtered by a high-finesse, V-shaped enhancement cavity has the effect of spectrally narrowing the laser emission and to auto-lock the laser frequency to one of the cavity's longitudinal modes, with clear advantages in terms of acquisition time and signal-to-noise ratio of the measurement. The line strengths in this region are about 5 orders of magnitude higher than in the more easily accessible NIR region near 1.6 µm and about 1000 times higher than at 2 µm. The instrument is temperature stabilization at the mK-level. Together with a small cavity volume of ~20 mL, this enables the analysis of nmol-sized samples with high precision (spectroscopy with a quantum cascade laser, Opt. Lett., 35, 3607, 2010. [2] Morville J., Kassi S., Chenevier M., and Romanini D.: Fast, low-noise, mode-by-mode, cavity-enhanced absorption spectroscopy by diode-laser self-locking, Appl. Phys., B 80, 1027-1038, 2005.

  12. Measurement of 13CO2/12CO2 abundance by nondispersive infrared heterodyne ratiometry as an alternative to gas isotope ratio mass spectrometry

    International Nuclear Information System (INIS)

    The authors report the performance of a prototype nondispersive infrared heterodyne ratiometer in the analysis of seven reference gas samples containing 3.0% CO2 in air, and isotopic enrichments from -85 to +329 δ per thousand vs. PDB as measured by gas isotope ratio mass spectrometry. The instrument response in volts-1 (V-1) varied from -0.51 to 1.22 over the range of -85 to +329 per thousand. A mean instrument response with a 0.0015 standard deviation (0.375 per thousand) required 110 s of signal averaging at a 1-s sampling rate. The calibration curve of instrument response vs. δ per thousand was linear over the entire range and had a slope of 0.003 89 +/- 0.000 03 (SD), an intercept of -0.168 +/- 0.005, and a standard error of 0.009. With this curve, 45 s of data acquisition at a mean instrument response of -0.280 V-1 attained a standard deviation of +/- 1.3 per thousand at -28.7 per thousand. Nondispersive infrared heterodyne ratiometry can analyze the 13C content of respiratory gas samples with acceptable accuracy and sensitivity for clinical studies

  13. The safety obligation of result. A new application to radiation protection. Orleans Court of social security affairs. Judgement of the 27 of August 2013 (nr 0123/212)

    International Nuclear Information System (INIS)

    After having recalled the French legal framework related to radiation protection, the author reports and discusses a case which illustrates what is at stake for an employer in terms of radiation protection; and also the importance of the concept of safety obligation of result which appeared for the compensation of victims of asbestos. Here, the case concerns a man who has been working in a base nuclear installation operated by EDF, and who developed a cancer which has been acknowledged as a professional disease. The author outlines some aspects of the case which could make one think of a non-responsibility of the company. He analyses the decision taken by the Court, discusses the consequences for companies of the nuclear sector, and outlines the important role of the expert in radiation protection

  14. Regiospecific Indentification of 2-(12-Ricinoleoylricinoleoyl)-1,3-diricinoleoyl-glycerol in Castor Oil by Mass Spectrometry and sn-1,3 Specific Lipase (United States)

    (12-Ricinoleoylricinoleoyl)diricinoleoylglycerol (RRRR), a tetraacylglycerol, was identified earlier in castor oil. Using ESI-MS4, 95% of the 12-ricinoleoylricinoleoyl chain was identified at the sn-2 position on the glycerol backbone of RRRR. Regiospecific location of the 12-ricinoleoylricinoleoyl ...

  15. 76 FR 61558 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller... (United States)


    ... published in the Federal Register on May 11, 2011 (76 FR 27281). That NPRM proposed to correct an unsafe... Register on May 11, 2011 (76 FR 27281) or on the determination of the cost to the public. Since we published the NPRM in the Federal Register on May 11, 2011 (76 FR 27281), we changed the AD Docket No....

  16. 76 FR 27281 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller... (United States)


    ... Statement in the Federal Register published on April 11, 2000 (65 FR 19477-78). Discussion The European... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant...

  17. I. The metabolic properties of plutonium and allied materials

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, J.G.


    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  18. NCBI nr-aa BLAST: CBRC-TTRU-01-1130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1130 ref|ZP_02091246.1| hypothetical protein FAEPRAM212_01517 [Faecali...bacterium prausnitzii M21/2] gb|EDP21696.1| hypothetical protein FAEPRAM212_01517 [Faecalibacterium prausnitzii M21/2] ZP_02091246.1 0.008 28% ...

  19. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  20. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    International Nuclear Information System (INIS)

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  1. Design, construction, operation, and evaluation of solar systems for industrial process-heat applications in the intermediate-temperature range (212/sup 0/F to 550/sup 0/F). Environmental assessment

    Energy Technology Data Exchange (ETDEWEB)



    The environmental impacts are assessed for a proposed 50,000 square foot field of single axis tracking, concentrating solar collectors along the Ohio River in southern Ohio. The facility is planned to produce process steam for use in the production of polystyrene. Absorbed solar energy would heat an aliphatic hydrocarbon synthetic heat transfer fluid to a maximum temperature of 500/sup 0/F. The existing environment is briefly described, particularly regarding air quality. The potential environmental impacts of the solar process heat system on the air, water, soil, endangered species and archaeological and historical resources are examined, including risks due to flood and glare and a comparison of alternatives. Also included are a Consent Judgment relating to two coal-fired boilers in violation of EPA regulations, property data of Gulf Synfluid 4CS (a candidate heat transfer fluid), piping and instrumentation diagrams and schematics, site grade and drainage plan, geological survey map, subsurface soil investigation, Ohio endangered species list, Ohio Archaeological Counsel certification list, and a study of heat transfer fluids and their properties. (LEW)

  2. Band mapping of the weakly off-stoichiometric Heusler alloy Ni.sub.49.7./sub.Mn.sub.29.1./sub.Ga.sub.21.2./sub. in the austenitic phase

    Czech Academy of Sciences Publication Activity Database

    Polyak, Yaroslav; Drchal, Václav; Kudrnovský, Josef; Heczko, Oleg; Honolka, Jan; Cháb, Vladimír; Kopeček, Jaromír; Lančok, Ján


    Roč. 91, č. 16 (2015), "165115-1"-"165115-11". ISSN 1098-0121 R&D Projects: GA ČR GA13-30397S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : Ni 2 MnGa * transitions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014

  3. Women in Iran. Gender Politics in the Islamic Republic. Westport - Connecticut - London, Greenwood Press, 2002, 303 p.Women in Iran. Emerging Voices in the Women’s Movement. Westport - Connecticut - London, Greenwood Press, 2002, 212 p.




    Dans ces deux volumes, l’A. examine la question du genre et plus précisément l’articulation des politiques et du genre avant et après la révolution en Iran. Dans le chapitre introductif du premier volume, après avoir établi le fondement théorique de son analyse, l’A. se propose d’explorer le patriarcat en tant que système approprié influant sur les réclamations des femmes et sur l’articulation des exigences et des objectifs de leurs mouvements. Tout en précisant que genre et patriarcat ne son...

  4. The "RA" Expeditions: The Archaeological and Anthropological Background. The "RA" Expeditions: The Coriolis Effect. The "RA" Expeditions: The Papyrus Reed. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 211, 212, 213. [Project COAST]. (United States)

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. These are: (1) The "RA" Expeditions: The Archaeological and Anthropological Background; (2) The "RA" Expeditions: The Coriolis Effect; and (3) The "RA" Expeditions: The Papyrus Reed. Each of the three units are designed for students in grades 6-12. Each unit contains teacher…

  5. Sequenciamento gênico: prelúdio para o entendimento da diversidade do gênero "Tetragonisca" (HYMENOPTERA, APIDAE. DOI: 10.7902/ecb.v3i2.12

    Directory of Open Access Journals (Sweden)

    Bárbara Silva Siqueira Maurício


    Full Text Available As abelhas do gênero Tetragonisca (Hymenoptera, Apidae, conhecidas por “Jataís”, apresentam problemas no que diz respeito ao status taxonômico de suas espécies (T. angustula e T. fiebrigi e ao caráter utilizado para tal classificação. Com o objetivo de estabelecer as relações filogenéticas das espécies envolvidas, o presente trabalho tem por objetivo padronizar o processo de amplificação de DNA (via PCR para sequenciamento. Um teste de gradiente envolvendo os genes selecionados (COI, CytB e EF1a foi realizado. Após a análise dos produtos de PCR nas 4 temperaturas testadas, foram escolhidas as temperaturas de 52°C para a amplificação de COI e 51°C para os genes CytB e EF1a. O fragmento CytB se mostrou mais variável e com mais autapomorfias quando comparado aos demais. O fragmento de EF1a mesmo sendo o maior fragmento sequenciado, apresentou-se menos variável.

  6. Synthesis, crystal structure, and magnetic properties of the coordination polymer [Fe(NCS)2(1,2-bis(4-pyridyl)-ethylene)]n showing a two step metamagnetic transition. (United States)

    Wöhlert, Susanne; Wriedt, Mario; Fic, Tomasz; Tomkowicz, Zbigniew; Haase, Wolfgang; Näther, Christian


    Reaction of iron(II) thiocyanate with an excess of trans-1,2-bis(4-pyridyl)-ethylene (bpe) in acetonitrile at room temperature leads to the formation of [Fe(NCS)(2)(bpe)(2)·(bpe)] (1), which is isotypic to its Co(II) analogue. Using slightly different reaction conditions the literature known compound [Fe(NCS)(2)(bpe)(2)(H(2)O)(2)] (2) was obtained as a phase pure material. Simultaneous differential thermoanalysis and thermogravimetry prove that the hydrate 2 transforms into the anhydrate [Fe(NCS)(2)(bpe)(2)] (3), that decomposes on further heating into the new ligand-deficient 1:1 compound of composition [Fe(NCS)(2)(bpe)](n) (4), which can also be obtained directly by thermal decomposition of 1. Further investigations reveal that 4 can also be prepared under solvothermal conditions, and single crystal structure analysis shows that the iron(II) cations are linked via μ-1,3 bridging thiocyanato anions into chains, that are further connected into layers by the bpe ligands. Magnetic measurements, performed on powder samples, prove that 1 and 2 show only Curie-Weiss behavior, whereas in 4 antiferromagnetic ordering with a Néel temperature of 5.0 K is observed. At T < 4.0 K a two-step metamagnetic transition occurs at applied magnetic fields of 1300 and 1775 Oe. The magnetic properties are discussed and compared with those of related compounds. PMID:23276282

  7. Synthesis of N-[2-3H] acetyl-D-muramyl-L-alanyl-D-iso-glutaminyl-L-alanyl-2-(1',2'-dipalmitoyl-sn-glycero-3'-phosphoryl) ethylamide of high specific radioactivity

    International Nuclear Information System (INIS)

    The title compound (MTP-cephalin) was synthesised with specific activity of 22 Ci mmol-1 and with radiochemical purity of 96-98% by a direct radiochemical synthesis using [3H] muramyl dipeptide. Several unsuccessful approaches to the target compound are documented. (author)

  8. Sorption studies of radioelements on geological materials


    Berry, J. A; 油井 三和; 北村 暁


    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  9. Purification of cerium, neodymium and gadolinium for low background experiments


    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  10. LASL experience in decontamination of the environment

    International Nuclear Information System (INIS)

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  11. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    Energy Technology Data Exchange (ETDEWEB)



    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  12. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura


    IKEDA, Nagao


    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  13. History of the unraveling of the natural decay series

    International Nuclear Information System (INIS)

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  14. History of the unraveling of the natural decay series

    International Nuclear Information System (INIS)

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  15. System for recovery of daughter isotopes from a source material (United States)

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID


    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  16. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    International Nuclear Information System (INIS)

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  17. Measurement of protein synthesis: In vitro comparison of Sc-44-DOTA-Puromycin vs. [H-3-Methyl]-Methionine and S-35-Methionine

    Czech Academy of Sciences Publication Activity Database

    Eigner, Sebastian; Beckford, Denis R.; Fellner, M.; Loktionova, N.; Piel, M.; Roesch, F.; Machulla, H.J.; Melichar, František; Eigner-Henke, Kateřina


    Roč. 54, Suppl. 1 (2011), S212-S212. ISSN 0362-4803 Institutional research plan: CEZ:AV0Z10480505 Keywords : Biochemistry & Molecular Biology * Pharmacology & Pharmacy * Chemistry Subject RIV: CE - Biochemistry

  18. 12 CFR 560.120 - Letters of credit and other independent undertakings to pay against documents. (United States)


    ... (International Chamber of Commerce (ICC) Publication No. 500) (available from ICC Publishing, Inc., 212/206-1150... Credits (ICC Publication No. 525) (available from ICC Publishing, Inc., 212/206-1150). (b) Safety...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-2615 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2615 ref|XP_710348.1| CTA212 antisense protein [Candida albicans SC531...4] ref|XP_710331.1| CTA212 antisense protein [Candida albicans SC5314] gb|EAK91068.1| CTA212 antisense [Candida albicans SC5314] gb|EAK91085.1| CTA212 antisense protein [Candida albicans SC5314] XP_710348.1 0.20 29% ...

  20. Dicty_cDB: Contig-U11652-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kkwklnhqii*tmekivnllqtfnl*k***ktn Frame B: ps*svsl*scvvsvleslisfchhtlmcifd*tyfssr*ghmfgaciirplrirsvlhnf rdlreca...t 838 |||||| Sbjct: 833 gttcat 838 Score = 420 bits (212), Expect = e-117 Identities = 212/212 (100%) Str...||||||||||||||||||||||||||| Sbjct: 181 cagagatttacgagagtgcgcctcacaaaatt 212 Score = 224 bits (113), Expec...tctgctgatg 618 |||||||||||||||||||| Sbjct: 367 acatgcctcatctgctgatg 386 Score = 210 bits (106), Expec...Seq.d (1223 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significa


    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot


    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or


    International Nuclear Information System (INIS)

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  3. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State


    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

  5. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    International Nuclear Information System (INIS)

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  6. Mixed valency of the RE and Ac ions in solid states

    International Nuclear Information System (INIS)

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  7. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    International Nuclear Information System (INIS)

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  8. Purification of cerium, neodymium and gadolinium for low background experiments

    Directory of Open Access Journals (Sweden)

    Boiko R.S.


    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  9. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters (United States)

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration


    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  10. Purification of cerium, neodymium and gadolinium for low background experiments (United States)

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.


    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  11. Secondary School Teachers Don’t Have Time to Engage in the Most Important Aspects of Information Literacy Due to Curricular Pressures. A Review of: Williams, D. and C. Wavell. “Secondary School Teachers’ Conceptions of Student Information Literacy.” Journal of Librarianship and Information Science 39.4 (2007: 199-212.

    Directory of Open Access Journals (Sweden)

    Lotta Haglund


    Full Text Available Objective – To examine school teachers’ understanding of student information literacy and to look at the implications of the findings for developing information literacy in students.Design – Qualitative research design (group discussions; verbal and written reflections.Setting – Secondary schools in the United Kingdom.Subjects – Secondary school teachers with various subject specializations.Methods – The study initially involved 31 secondary school teachers; 24 from seven schools in Scotland and seven from two schools in England. Participant teachers were self-selecting. The study took a phenomenographic approach. Teachers’ perceptions of their students’ abilities and their experiences and perceptions of their role in developing these abilities were examined through data collection in three stages. During the first stage, group discussions established the teacher’s initial conceptions of information literacy. Participants also filled out an information task grid which, together with focus questions, ensured that discussions were kept in the realm of practice. During the second stage of data collection, teachers observed and reflected on their students’ use of information in classroom activities. This was accompanied by informal site visits during which 26 of the participants were introduced to information literacy frameworks and definitions in order to contextualize reflections and discussions. Field notes were used to record these informal meetings. Six participants provided written feedback on reflections. In the third and final stage, a summary of themes from the first two stages was sent to 23 of the participants prior to a second group discussion in order to try to stimulate further reflection. Discussions were audio recorded and transcribed. The transcribed data were analyzed for the dimensions of variation of teachers’ conceptions of student information literacy and key elements associated with each category of description were determined.Main Results – The data revealed six main conceptions of student information literacy among the teachers: “finding information,” “linguistic understanding,” “makingmeaning,” “skills,” “critical awareness ofsources,” and “independent learning.” There was no particular hierarchy in their conceptualization, although independent learning seemed to be the ultimate goal. Teachers’ conceptions in the beginning ofthe study focused on the ability to find information, whereas after a period of reflection and further discussions, a broader and more complex understanding of information literacy appeared. Table 1 simplifies some of the data from the table in the article and shows conceptualizations as well as some of the contextual elements. Teachers felt that they had at least some control over the development of student ability to find information, develop skills, and critically appraise sources, even though these were not the highest learning priority outcomes. However, in the three areas of ability which the teachers regarded as of high learning priority (linguistic understanding, making meaning and independent learning, they felt that they had little control over the development of these abilities in the students.Conclusion – The teachers’ conceptions of student information literacy overlapped with the ideas in existing models and frameworks for information literacy. However, some areas of information literacy were not addressed by the teachers, i.e., ethical issues in the use of information. In the categories of description of high learning priority, the main reason for the low sense of control by the teachers seemed to be curricular pressures – “our content is prescribed and time allocated doing each of these things is prescribed so we have got limited room for maneuvering” (206. The teachers tended to regard information literacy as process and skills-orientated, with little connection to learning. The authors note that other research also suggests that school librarians also have difficulty relating information finding to learning in specific subject disciplines. There is a clear gap here as the authors point out that “there is a danger that students will not understand the significance of learning with information for academic achievement or for independent learning” (209.The authors suggest that the way forward for further development of information literacy in the classroom and library is through dialogue and that “librarian-teacher collaborations needs to be founded on shared understanding of the complex inter-relationship between information and learning” (209.

  12. 8 CFR 245.23 - Adjustment of aliens in T nonimmigrant classification. (United States)


    ... pursuant to 8 CFR 214.11(s); (2) The alien is described in sections 212(a)(3), 212(a)(10)(C), or 212(a)(10...-entered using an advance parole document issued under 8 CFR 245.2(a)(4)(ii)(B), the date that the alien...) Inapplicability of 8 CFR 245.1 and 245.2. Sections 245.1 and 245.2 of this chapter do not apply to aliens...

  13. 22 CFR 40.53 - Uncertified foreign health-care workers. (United States)


    ....S.C. 1182(r), respectively, and the regulations found at 8 CFR 212.15. (b) Paragraph (a) of this... a non-clinical health care occupation as described in 8 CFR 212.15(b)(1); or (2) Who is the immigrant or nonimmigrant spouse or child of a foreign health care worker and who is seeking to accompany...

  14. 77 FR 59339 - Acquisition of Commercial Items (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Defense Acquisition Regulations System 48 CFR Part 212 Acquisition of Commercial Items CFR Correction 212.504 In Title 48 of the Code of Federal Regulations, Chapter 2 (Parts 201--299), revised as of...

  15. 7 CFR 330.100 - Definitions. (United States)


    ... which are not genetically engineered as defined in 7 CFR 340.1 which can directly or indirectly injure... 330.212, “plant pest” means any living stage of any insects, mites, nematodes, slugs, snails, protozoa....212, plant pest means any living stage of insects, mites, nematodes, slugs, snails, protozoa, or...

  16. Susceptibility of irradiated steels to hydrogen embrittlement (United States)

    Rossin, A. D.


    Investigation determined whether irradiated pressure-vessel steels 4340 and 212-B are susceptible to hydrogen embrittlement and to catastrophic failure. Hydrogen-charging conditions which completely embrittled 4340 steel had negligible effect on 212-B steel in tensile and delayed-failure tests.

  17. 27 CFR 27.41 - Computation of effective tax rate. (United States)


    ... distilled spirits derived from eligible flavors exceed 21/2% of the total proof gallons in the batch (100.9 − (21/2%) × 3.371.8 = 16.6). Batch Record Distilled spirits 2249.1 proof gallons. Eligible wine...

  18. Chameleons out of disguise: sex chromosomes revealed

    Czech Academy of Sciences Publication Activity Database

    Rovatsos, M.; Johnson Pokorná, Martina; Altmanová, M.; Kratochvíl, L.

    Brno: Ústav biologie obratlovců AV ČR, 2015 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 212-212 ISBN 978-80-87189-18-4. [Zoologické dny. 12.02.2015-13.02.2015, Brno] Institutional support: RVO:67985904 Keywords : sex chromosomes Subject RIV: EG - Zoology

  19. 77 FR 20314 - 2-Propenoic Acid, 2-Methyl-, 2-Ethylhexyl Ester, Telomer With 1-Dodecanethiol, Ethenylbenzene and... (United States)


    ... a number average molecular weight (MW) greater than or equal to 10,000 daltons. Additionally, the... salt, 2, 2'-(1,2- diazenediyl)bis -initiated, minimum number average molecular weight (in amu), 1,200... polymer's number average MW of 1,212 is greater than 1,000 and less than 10,000 daltons. The...

  20. Inleiding

    NARCIS (Netherlands)

    Koper, Rob


    Koper, R. (2004). Inleiding. In: Van Geloven, M., Koper, R. & Van der Veen, J., E-learning trends (pp. 6-7). Utrecht, Stichting Digitale Universiteit.
    Ook beschikbaar in dspace: 212">

  1. Migration distance and the effect of North Atlantic Oscillation on the spring arrival of birds in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Čapek, Miroslav


    Roč. 57, č. 3 (2008), s. 212-220. ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : climate * NAO * phenology * temperature * weather * migration of birds * wintering area Subject RIV: EH - Ecology, Behaviour Impact factor: 0.522, year: 2008

  2. A text in Romani from 1622

    DEFF Research Database (Denmark)

    Bakker, Peter

    this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212.......this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212....

  3. 78 FR 56817 - Paper and Paper-Based Packaging Promotion, Research and Information Order; Referendum Procedures (United States)


    ... Federal Register on January 2, 2013. One rule pertained to the proposed Order (78 FR 188) and a second rule pertained to proposed referendum procedures (78 FR 212). Both rules provided for 60-day comment... Register on January 2, 2013 (78 FR 212). Copies of the rule were mailed by USDA to all known...

  4. News from the Biological Stain Commission No. 14

    DEFF Research Database (Denmark)

    Lyon, Hans O


    In the 14(th) issue of News from the Biological Stain Commission (BSC) the BSC's International Affairs Committee presents information from the meetings of ISO/TC 212/WG 3, In vitro diagnostic products, and from the final plenary meeting of ISO/TC 212, Clinical laboratory testing and in vitro...

  5. Purification system of gram-amount neptunium using anion exchange chromatography

    International Nuclear Information System (INIS)

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  6. A francium-223 reservoir source

    International Nuclear Information System (INIS)

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  7. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  8. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    International Nuclear Information System (INIS)

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  9. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  10. Theoretical Study on Properties of New Isotope 265Bh

    Institute of Scientific and Technical Information of China (English)


    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  11. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    International Nuclear Information System (INIS)

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  12. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    Energy Technology Data Exchange (ETDEWEB)



    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  13. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    International Nuclear Information System (INIS)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  14. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    International Nuclear Information System (INIS)

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)

  15. Bis[μ-N,N′-bis(2,6-diisopropylphenylethene-1,2-diamido]-1,4(η2;1:2κ4N:N;3:4κ4N:N-bis(diethyl ether-1κO,4κO-di-μ-hydrido-2:3κ4H:H-2,3-dichromium(II-1,4-dilithium(I pentane hemisolvate

    Directory of Open Access Journals (Sweden)

    Uwe Rosenthal


    Full Text Available The title compound, [Cr2Li2(C26H36N22(μ-H2(C4H10O2]·0.5C5H12, is a binuclear chromium complex bridged by two hydrogen atoms. Each chromium atom is coordinated in a distorted square-planar geometry by one chelating bis(2,6-diisopropylphenylethene-1,2-diamido ligand via its two N atoms. Additionally, two diametrically opposed lithium ether adducts coordinate in an η4 mode on the backbone of the ligands. There is a crystallographic inversion center in the middle of the Cr2H2 ring. One of the isopropyl groups is disordered over two positions in a 0.567 (7:0.433 (7 ratio. Disorder is also observed in the pentane hemisolvate molecule.

  16. Resveratrol analogue 3,4,4′,5-tetramethoxystilbene inhibits growth, arrests cell cycle and induces apoptosis in ovarian SKOV‐3 and A-2780 cancer cells

    International Nuclear Information System (INIS)

    In the screening studies, cytotoxicity of 12 methylated resveratrol analogues on 11 human cancer cell lines was examined. The most active compound 3,4,4′5-tetramethoxystilbene (DMU-212) and two ovarian cancer cell lines A-2780 (IC50 = 0.71 μM) and SKOV-3 (IC50 = 11.51 μM) were selected for further investigation. To determine the mechanism of DMU-212 cytotoxicity, its ability to induce apoptosis was examined. DMU-212 arrested cell cycle in the G2/M or G0/G1 phase which resulted in apoptosis of both cell lines. The expression level of 84 apoptosis-related genes was investigated. In SKOV-3 cells DMU-212 caused up-regulation of pro-apoptotic Bax, Apaf-1 and p53 genes, specific to intrinsic pathway of apoptosis, and a decrease in Bcl-2 and Bcl 2110 mRNA expressions. Conversely, in A-2780 cells an increased expression of pro-apoptotic genes Fas, FasL, TNF, TNFRSF10A, TNFRSF21, TNFRSF16 specific to extracellular mechanism of apoptosis was observed. There are no data published so far regarding the receptor mediated apoptosis induced by DMU-212. The activation of caspase-3/7 was correlated with decreased TRAF-1 and BIRC-2 expression level in A-2780 cells exposed to DMU-212. DMU-212 caused a decrease in CYP1A1 and CYP1B1 mRNA levels in A-2780 by 50% and 75%, and in SKOV-3 cells by 15% and 45%, respectively. The protein expression was also reduced in both cell lines. It is noteworthy that the expression of CYP1B1 protein was entirely inhibited in A-2780 cells treated with DMU-212. It can be suggested that different CYP1B1 expression patterns in either ovarian cell line may affect their sensitivity to cytotoxic activity of DMU-212. -- Highlights: ► DMU-212 was the most cytotoxic among 12 O-methylated resveratrol analogues. ► DMU-212 arrested cell cycle at G2/M and G0/G1phase ► DMU-212 triggered mitochondria- and receptor‐mediated apoptosis. ► DMU-212 entirely inhibited CYP1B1 protein expression in A-2780 cells.

  17. Resveratrol analogue 3,4,4′,5-tetramethoxystilbene inhibits growth, arrests cell cycle and induces apoptosis in ovarian SKOV‐3 and A-2780 cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Piotrowska, Hanna; Myszkowski, Krzysztof; Ziółkowska, Alicja [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland); Kulcenty, Katarzyna [Chair of Medical Biotechnology, Poznan University of Medical Sciences, Poznan (Poland); Wierzchowski, Marcin [Department of Chemical Technology of Drugs, Poznan University of Medical Sciences, Poznan (Poland); Kaczmarek, Mariusz [Department of Clinical Immunology, Poznan University of Medical Sciences, Poznan (Poland); Murias, Marek [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland); Kwiatkowska-Borowczyk, Eliza [Chair of Medical Biotechnology, Poznan University of Medical Sciences, Poznan (Poland); Department of Cancer Diagnostics and Immunology, Greater Poland Cancer Centre, Poznan (Poland); Jodynis-Liebert, Jadwiga, E-mail: [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland)


    In the screening studies, cytotoxicity of 12 methylated resveratrol analogues on 11 human cancer cell lines was examined. The most active compound 3,4,4′5-tetramethoxystilbene (DMU-212) and two ovarian cancer cell lines A-2780 (IC{sub 50} = 0.71 μM) and SKOV-3 (IC{sub 50} = 11.51 μM) were selected for further investigation. To determine the mechanism of DMU-212 cytotoxicity, its ability to induce apoptosis was examined. DMU-212 arrested cell cycle in the G2/M or G0/G1 phase which resulted in apoptosis of both cell lines. The expression level of 84 apoptosis-related genes was investigated. In SKOV-3 cells DMU-212 caused up-regulation of pro-apoptotic Bax, Apaf-1 and p53 genes, specific to intrinsic pathway of apoptosis, and a decrease in Bcl-2 and Bcl 2110 mRNA expressions. Conversely, in A-2780 cells an increased expression of pro-apoptotic genes Fas, FasL, TNF, TNFRSF10A, TNFRSF21, TNFRSF16 specific to extracellular mechanism of apoptosis was observed. There are no data published so far regarding the receptor mediated apoptosis induced by DMU-212. The activation of caspase-3/7 was correlated with decreased TRAF-1 and BIRC-2 expression level in A-2780 cells exposed to DMU-212. DMU-212 caused a decrease in CYP1A1 and CYP1B1 mRNA levels in A-2780 by 50% and 75%, and in SKOV-3 cells by 15% and 45%, respectively. The protein expression was also reduced in both cell lines. It is noteworthy that the expression of CYP1B1 protein was entirely inhibited in A-2780 cells treated with DMU-212. It can be suggested that different CYP1B1 expression patterns in either ovarian cell line may affect their sensitivity to cytotoxic activity of DMU-212. -- Highlights: ► DMU-212 was the most cytotoxic among 12 O-methylated resveratrol analogues. ► DMU-212 arrested cell cycle at G2/M and G0/G1phase ► DMU-212 triggered mitochondria- and receptor‐mediated apoptosis. ► DMU-212 entirely inhibited CYP1B1 protein expression in A-2780 cells.

  18. Anisotropic Cell Expansion Is Affected through the Bidirectional Mobility of Cellulose Synthase Complexes and Phosphorylation at Two Critical Residues on CESA31[OPEN (United States)

    Liu, Yanmei; Bauer, Stefan


    Here we report that phosphorylation status of S211 and T212 of the CESA3 component of Arabidopsis (Arabidopsis thaliana) cellulose synthase impacts the regulation of anisotropic cell expansion as well as cellulose synthesis and deposition and microtubule-dependent bidirectional mobility of CESA complexes. Mutation of S211 to Ala caused a significant decrease in the length of etiolated hypocotyls and primary roots, while root hairs were not significantly affected. By contrast, the S211E mutation stunted the growth of root hairs, but primary roots were not significantly affected. Similarly, T212E caused a decrease in the length of root hairs but not root length. However, T212E stunted the growth of etiolated hypocotyls. Live-cell imaging of fluorescently labeled CESA showed that the rate of movement of CESA particles was directionally asymmetric in etiolated hypocotyls of S211A and T212E mutants, while similar bidirectional velocities were observed with the wild-type control and S211E and T212A mutant lines. Analysis of cell wall composition and the innermost layer of cell wall suggests a role for phosphorylation of CESA3 S211 and T212 in cellulose aggregation into fibrillar bundles. These results suggest that microtubule-guided bidirectional mobility of CESA complexes is fine-tuned by phosphorylation of CESA3 S211 and T212, which may, in turn, modulate cellulose synthesis and organization, resulting in or contributing to the observed defects of anisotropic cell expansion. PMID:26969722

  19. MicroRNAs and drug addiction

    Directory of Open Access Journals (Sweden)

    Paul J Kenny


    Full Text Available Drug addiction is considered a disorder of neuroplasticity in brain reward and cognition systems resulting from aberrant activation of gene expression programs in response to prolonged drug consumption. Noncoding RNAs are key regulators of almost all aspects of cellular physiology. MicroRNAs (miRNAs are small (~21–23 nucleotides noncoding RNA transcripts that regulate gene expression at the post-transcriptional level. Recently, microRNAs were shown to play key roles in the drug-induced remodeling of brain reward systems that likely drives the emergence of addiction. Here, we review evidence suggesting that one particular miRNA, miR-212, plays a particularly prominent role in vulnerability to cocaine addiction. We review evidence showing that miR-212 expression is increased in the dorsal striatum of rats that show compulsive-like cocaine-taking behaviors. Increases in miR-212 expression appear to protect against cocaine addiction, as virus-mediated striatal miR-212 over-expression decreases cocaine consumption in rats. Conversely, disruption of striatal miR-212 signaling using an antisense oligonucleotide increases cocaine intake. We also review data that identify two mechanisms by which miR-212 may regulate cocaine intake. First, miR-212 has been shown to amplify striatal CREB signaling through a mechanism involving activation of Raf1 kinase. Second, miR-212 was also shown to regulate cocaine intake by repressing striatal expression of methyl CpG binding protein 2 (MeCP2, consequently decreasing protein levels of brain-derived neurotrophic factor (BDNF. The concerted actions of miR-212 on striatal CREB and MeCP2/BDNF activity greatly attenuate the motivational effects of cocaine. These findings highlight the unique role for miRNAs in simultaneously controlling multiple signaling cascades implicated in addiction.

  20. AcEST: DK962130 [AcEST

    Lifescience Database Archive (English)


  1. The Use of Patient-Specific Intra-Operative Guides for Total Knee Arthroplasty (TKA

    Directory of Open Access Journals (Sweden)

    Hendrik P. Delport


    Conclusions: We conclude that this novel technique hereby described has major benefits: less operative time and proper implant positioning, but more prospective studies are mandatory. [Arch Clin Exp Surg 2012; 1(4.000: 206-212

  2. Fiber Intake and Childhood Appendicitis. (United States)

    Brender, Jean D.; And Others


    Parents of 135 children with appendicitis and of 212 comparison children were interviewed about their children's diet. Results suggest that a liberal intake of whole-grain breads and cereals may decrease the risk of appendicitis during childhood. (KH)

  3. Drainage Basins Used for Assessing Trends in Concentration of Pesticides in Streams of the United States, 1992-2010 (United States)

    U.S. Geological Survey, Department of the Interior — This dataset consists of drainage basin boundaries for 212 U.S. Geological Survey (USGS) stream sites sampled in the National Water-Quality Assessment (NAWQA)...

  4. Uuring : Eesti autostumisel on Lääne-Euroopaga võrreldes palju arenguruumi

    Index Scriptorium Estoniae


    Autostumisest Eestis ja Euroopa Liidu liikmesriikides, Euroopa Komisjoni poolt tellitud Eurobaromeetri uuringu tulemustest. Lisa: 2006. aastal esmaregistreeriti Eestis kokku 74 212 sõiduautot, aasta varem 60 626 sõiduautot.

  5. Radionuclide diffusion into undisturbed and altered crystalline rocks

    Czech Academy of Sciences Publication Activity Database

    Havlová, V.; Večerník, P.; Najser, J.; Sosna, K.; Breiter, Karel


    Roč. 76, Dec. 2012 (2012), s. 3191-3201. ISSN 0026-461X Institutional support: RVO:67985831 Keywords : disposal * granite * radionuclide diffus * ion * sampling protocols Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.212, year: 2012

  6. Report on the geoarchaeological survey in the area of Sabaloka, the sixth Nile cataract, Sudan=Zpráva o geoarcheologickém průzkumu v oblasti Sabaloky, šestého nilského kataraktu, v Súdánu

    Czech Academy of Sciences Publication Activity Database

    Suková, L.; Cílek, Václav; Lisá, Lenka; Lisý, Pavel; Bushara, M.


    Roč. 4, č. 3 (2010), s. 40-53. ISSN 1802-212X Institutional research plan: CEZ:AV0Z30130516 Keywords : Nile * Holocene * sedimentology * archaeology * landscape * rock art Subject RIV: DB - Geology ; Mineralogy

  7. USGS Oil and Gas Assessment Database (United States)

    U.S. Geological Survey, Department of the Interior — The U.S. Geological Survey (USGS) has assessed undiscovered oil and natural gas potential for 212 geological provinces throughout the world as part of the US Oil...

  8. Chapter Leadership Profiles among Citizen Activists in the Drunk Driving Movement. (United States)

    Ungerleider, Steven; Bloch, Steven


    Study of Mothers Against Drunk Drivers (MADD) analyzed the chapter emphasis, levels of satisfaction and relationship to national office on several measures. Surveying 212 chapters, MADD leadership provided profile of independent, autonomous activists in the drunk driving countermeasure movement. (Author)

  9. EDLnet D2.5 Europeana Outline Functional Specification For development of an operational European Digital Library


    Dekkers, Makx; Gradmann, Stefan; Meghini, Carlo


    1 INTRODUCTION .....................................................................................5 2 FUNCTIONAL SPECIFICATION PRINCIPLES & METHODOLOGY BACKGROUND AND CONTEXT.......................................................................5 2.1 Methodology 5 2.1.1 Use Case Analysis........................................................................................................................5 2.1.2 Use Case Management ...............................................

  10. Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Lee County (United States)

    NSGIC GIS Inventory (aka Ramona) — The RGB one-foot orthophotos to be mapped consists of 2,212 cells (approximately 2000 square miles) flown with a Z/I Intergraph DMC airborne digital sensor. The...

  11. 27 CFR 19.34 - Computation of effective tax rate. (United States)


    ... added. (c) The following is an example of the use of the formula. BATCH RECORD Distilled spirits 2249.1... distilled spirits derived from eligible flavors exceed 21/2%) of the total proof gallons in the batch...

  12. 77 FR 17085 - Agency Information Collection Activities: Form I-612; Extension of an Existing Information... (United States)


    ... Collection Under Review; Form I- 612, Application for Waiver of the Foreign Residence Requirement of Section...: Application for Waiver of the Foreign Residence Requirement of Section 212(e) of the Immigration...

  13. 75 FR 11898 - Agency Information Collection Activities: Form I-612, Extension of a Currently Approved... (United States)


    ... Information Collection Under Review: Form I- 612, Application for Waiver of the Foreign Residence Requirement... for Waiver of the Foreign Residence Requirement of Section 212(e) of the Immigration and...

  14. Waiting for the existential revolution in Europe

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jan


    Roč. 12, č. 1 (2014), s. 190-212. ISSN 1474-2640 Institutional support: RVO:68378122 Keywords : European Union * post-communism countries * European integration Subject RIV: AG - Legal Sciences Impact factor: 0.628, year: 2014

  15. 30 CFR 207.5 - Contract and sales agreement retention. (United States)


    ... production are to be maintained by the lessee and made available upon request during normal working hours to authorized MMS, State or Indian representatives, other MMS or BLM officials, auditors of the General... with 30 CFR part 212....

  16. Poetika mlčení

    Czech Academy of Sciences Publication Activity Database

    Lahoda, Vojtěch

    Řevnice: Arbor vitae, 2012 - (Srp, K.), s. 212-233 ISBN 978-80-7467-021-3 Institutional support: RVO:68378033 Keywords : loneliness * wakeful sleep * melancholy * sadness Subject RIV: AL - Art, Architecture, Cultural Heritage

  17. 75 FR 52768 - Withdrawal of Approval of New Animal Drug Applications; Dichlorophene and Toluene Capsules (United States)


    ... INFORMATION CONTACT: John Bartkowiak, Center for Veterinary Medicine (HFV-212), Food and Drug Administration... Veterinary Medicine, and in accordance with Sec. 514.116 Notice of withdrawal of approval of application (21... Veterinary Medicine. BILLING CODE 4160-01-S...

  18. 77 FR 55413 - New Animal Drugs; Chorionic Gonadotropin; Naloxone; Oxymorphone; Oxytocin (United States)


    ... FURTHER INFORMATION CONTACT: David Alterman, Center for Veterinary Medicine (HFV-212), Food and Drug... Drugs and redelegated to the Center for Veterinary Medicine, 21 CFR parts 510 and 522 are amended as... Veterinary Medicine. BILLING CODE 4160-01-P...

  19. 4 CFR 21.5 - Protest issues not for consideration. (United States)


    ... time limits set forth in § 21.2. (f) Protests which lack a detailed statement of the legal and factual... business size standards and North American Industry Classification System (NAICS) standards. Challenges...

  20. Successful Use of Hydroxocobalamin and Sodium Thiosulfate in Acute Cyanide Poisoning: A Case Report with Follow-up

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Vaněčková, M.; Seidl, Z.; Diblik, P.; Kuthan, P.; Urban, P.; Navrátil, Tomáš; Pelclová, D.


    Roč. 117, č. 3 (2015), s. 209-212. ISSN 1742-7835 Institutional support: RVO:61388955 Keywords : glycosylated hemoglobin * hydroxocobalamin * lactic acid Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.377, year: 2014

  1. K ústní zkoušce z češtiny (Máj Karla Hynka Máchy)

    Czech Academy of Sciences Publication Activity Database

    Ibrahim, Robert


    Roč. 64, č. 5 (2014), s. 209-212. ISSN 0009-0786 Institutional support: RVO:68378068 Keywords : Czech secondary school-leaving examination * text edition * theory of verse Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. Surface functionalization of mesoporous antimony doped tin oxide by metalorganic reaction

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Haase, F.; Rathouský, Jiří; Fattakhova-Rohlfing, D.


    Roč. 137, č. 1 (2012), s. 207-212. ISSN 0254-0584 Institutional support: RVO:61388955 Keywords : oxides * organometallic compounds * chemical synthesis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.072, year: 2012

  3. Altitudinal and seasonal differences of tick communities in dogs from pastoralist tribes of Northern Kenya

    Czech Academy of Sciences Publication Activity Database

    D'Amico, G.; Dumitrache, M.O.; Široký, P.; Albrechtová, K.; Sloboda, M.; Domsa, C.; Sándor, A.D.; Balázsi, R.; Kanyari, P. W. N.; Modrý, David; Mihalca, A. D.


    Roč. 212, 3-4 (2015), s. 318-323. ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Altitudinal distribution * Rhipicephalus sanguineus * Rhipicephalus pulchellus * Rhipicephalus armatus Subject RIV: CE - Biochemistry Impact factor: 2.460, year: 2014

  4. AcEST: BP914438 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ibosome biogenesis protein BOP1 OS=Homo sa... 105 1e-22 sp|O74399|YOCD_SCHPO Unch... WR V D ++ LT ++ ++ + G++ Sbjct: 166 RDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQF 212 >sp|O74399|YOCD_SCH

  5. Neuromuscular paralysis induced in insect larvae by the proteinic venom of a parasitic wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel

    New York: Nova Science Publishers, 2012 - (Berhardt, L.), s. 195-212 ISBN 978-1-62100-889-7 Institutional research plan: CEZ:AV0Z50070508 Keywords : neuromuscular paralysis Subject RIV: ED - Physiology

  6. Yeast effects on Pinot noir wine phenolics, color, and tannin composition. (United States)

    Carew, Anna L; Smith, Paul; Close, Dugald C; Curtin, Chris; Dambergs, Robert G


    Extraction and stabilization of wine phenolics can be challenging for wine makers. This study examined how yeast choice affected phenolic outcomes in Pinot noir wine. Five yeast treatments were applied in replicated microvinification, and wines were analyzed by UV-visible spectrophotometry. At bottling, yeast treatment Saccharomyces cerevisiae RC212 wine had significantly higher concentrations of total pigment, free anthocyanin, nonbleachable pigment, and total tannin and showed high color density. Some phenolic effects were retained at 6 months' bottle age, and RC212 and S. cerevisae EC1118 wines showed increased mean nonbleachable pigment concentrations. Wine tannin composition analysis showed three treatments were associated with a higher percentage of trihydroxylated subunits (skin tannin indicator). A high degree of tannin polymerization was observed in wines made with RC212 and Torulaspora delbruekii , whereas tannin size by gel permeation chromatography was higher only in the RC212 wines. The results emphasize the importance of yeast strain choice for optimizing Pinot noir wine phenolics. PMID:24011384

  7. Evidence for Amazonian highly viscous lavas in the southern highlands on Mars

    Czech Academy of Sciences Publication Activity Database

    Brož, Petr; Hauber, E.; Platz, T.; Balme, M.


    Roč. 415, 1 April (2015), s. 200-212. ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Mars surface * volcanology * lava dome Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014

  8. Je nutné studovat možná rizika nanomateriálů pro lidské zdraví?

    Czech Academy of Sciences Publication Activity Database

    Topinka, Jan


    Roč. 90, č. 4 (2011), s. 212-213. E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z50390703 Keywords : nanomaterials * nanosafety * nanotoxicology Subject RIV: DN - Health Impact of the Environment Quality

  9. Thoron (220Rn)-concentration in homes: first results of a pilot project

    International Nuclear Information System (INIS)

    First measurements of thoron gas concentrations in homes show that the indoor thoron concentration is less influenced by the thoron content in soil or by convective entry processes. The indoor concentration is dominated by thoron concentrations of building materials and by the surface layer of walls and floors. Measurements in typical indoor air without additional aerosol sources yield 212Pb size distributions with a media diameter of the accumulation mode of about 200 nm. An average fraction of 13% of the activity is associated with particles of the nuclei mode with diameters d between 10 - 100 nm and about 5% of the activity was determined to be unattached (d 212Pb)/C(220Rn) of 0.05 and C(212Bi)/C(212Pb) of 0.4. (orig.)

  10. 77 FR 19177 - Beaverhead-Deerlodge National Forest, Jefferson Ranger District, Montana, Boulder River Salvage... (United States)


    ...-commercially thin Douglas-fir and burn slash on 8,212 acres within 102 units. Approximately 210 miles of...; ] DEPARTMENT OF AGRICULTURE Forest Service Beaverhead-Deerlodge National Forest, Jefferson Ranger...

  11. O symetrii tokamaku

    Czech Academy of Sciences Publication Activity Database

    Mlynář, Jan


    Roč. 59, č. 4 (2009), s. 207-212. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20430508 Keywords : Tokamak * symmetry * drifts * transport * H-mode Subject RIV: BL - Plasma and Gas Discharge Physics

  12. Rem Koolhaas. Utopie ve sférách globálního trhu

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    -, Č. 19-20 (2006), s. 212-214. ISSN 1210-6887 Institutional research plan: CEZ:AV0Z80330511 Keywords : Rem Koolhaas * contemporary architecture * utopia of architectural production Subject RIV: AL - Art , Architecture, Cultural Heritage

  13. High-Precision Instrumentation for CO2 Isotope Ratio Measurements Project (United States)

    National Aeronautics and Space Administration — Knowing atmospheric 13CO2/12CO2 ratios precisely is important to understanding biogenic and anthroprogenic sources and sinks for carbon. Currently available field...

  14. The abundance of a farmland specialist bird, the skylark, in three European regions with contrasting agricultural management

    Czech Academy of Sciences Publication Activity Database

    Koleček, Jaroslav; Reif, J.; Weidinger, K.


    Roč. 212, December (2015), s. 30-37. ISSN 0167-8809 Institutional support: RVO:68081766 Keywords : Crops * Extensive farming * Landscape mosaic * Seasonal change Subject RIV: EH - Ecology, Behaviour Impact factor: 3.402, year: 2014

  15. Hatchling sex ratio and female mating status in the great reed warbler, Acrocephalus arundinaceus (Aves, Passeriformes): further evidence for offspring sex ratio manipulation

    Czech Academy of Sciences Publication Activity Database

    Trnka, A.; Prokop, P.; Kašová, M.; Sobeková, Karolina; Kocian, Ľ.


    Roč. 79, č. 2 (2012), s. 212-217. ISSN 1125-0003 Institutional support: RVO:68081766 Keywords : Great reed warbler * sex ratio * social polygyny Subject RIV: EG - Zoology Impact factor: 0.890, year: 2012

  16. Determination of 232U daughter products released from HTGR fuel during refabrication. Part 2

    International Nuclear Information System (INIS)

    During the heat treatment step of High Temperature Gas-Cooled Reactor (HTGR) fuel beads, the 233U-loaded fuel beads are exposed to temperatures as high as 17000C. Since 233U fuel beads unavoidably contain a small percentage of 232U, decay products of 232U might be released during the heat treatment step. To avoid shielding requirements, experiments were conducted using 232Th-loaded fuel beads rather than 232U-loaded fuel beads. Decay products of 232U and 232Th are the same after 228Th. Experimental data were obtained by monitoring the 583 and 2614 keV gamma emissions of 208Tl. Computer simulations of the decay process and experimental data were used to infer what relative amount of the daughter products was removed. The carbonization step (300 to 5000C) has an effect on the loss of daughter products in the conversion step. Using uncarbonized fuel beads, approximately 50 percent of 220Rn was removed at 3000C and approximately 20 percent of 220Rn was removed at 2000C. At most, 5 percent of 220Rn was removed from uncarbonized beads at 250C. Marginal 220Rn loss was detected at 1000C using pre-carbonized beads. At 14000C, 92 percent 212Pb, 70 to 90 percent 212Bi, and 0 percent 224Ra losses were observed. At 16000C, 100 percent 212Pb, 80 to 100 percent 212Bi, and 3 to 7 percent 224Ra losses were observed. At 17500C, 100 percent 212Pb, 80 to 100 percent 212Bi, and 62 percent 224Ra losses were observed. At 18000C, 100 percent 212Pb, 80 to 100 percent 212Bi, and 86 percent 224Ra losses were observed

  17. Monitoramento da população de Phytophthora infestans na região da Zona da Mata de Minas Gerais de 1998 a 2000 Monitoring Phytophthora infestans population in the Zona da Mata region of Minas Gerais, Brazil, from 1998 to 2000


    AILTON REIS; Nelson D. Suassuna; Alfenas, Acelino C; EDUARDO S. G. MIZUBUTI


    Foram caracterizados 212 isolados de Phytophthora infestans obtidos de 51 lavouras de tomate (Lycopersicon esculentum)e batata (Solanum tuberosum), em sete municípios da Zona da Mata, MG. Todos os isolados tiveram o grupo de compatibilidade determinado; 96 isolados foram caracterizados para a isoenzima glucose 6-fosfato-isomerase (Gpi); 71 isolados foram analisados quanto à resistência ao metalaxyl; e determinou-se o espectro de virulência de 46 isolados. Todos os 212 isolados testados foram ...

  18. Monitoramento da população de Phytophthora infestans na região da Zona da Mata de Minas Gerais de 1998 a 2000




    Foram caracterizados 212 isolados de Phytophthora infestans obtidos de 51 lavouras de tomate (Lycopersicon esculentum)e batata (Solanum tuberosum), em sete municípios da Zona da Mata, MG. Todos os isolados tiveram o grupo de compatibilidade determinado; 96 isolados foram caracterizados para a isoenzima glucose 6-fosfato-isomerase (Gpi); 71 isolados foram analisados quanto à resistência ao metalaxyl; e determinou-se o espectro de virulência de 46 isolados. Todos os 212 isolados testados foram ...

  19. A quantitative radiochemical method for the determination of the major sources of natural radioactivity in ores and minerals (United States)

    Rosholt, John Nicholas, Jr.


    The determination of Th232, Rn222, and Pb210 by isolation and subsequent activity analysis of some of their short-lived daughter products is described. The sulfides of bismuth and polonium are precipitated out of solutions of thorium or uranium ores, and the alpha particle activity of PO214. PO212 and PO210 is determined by scintillation counting techniques. PO214 activity is used to determine Rn222, PO212 activity for Th232, and PO210 for Pb210.

  20. AcEST: DK960524 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0007_K11 608 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_K11. 5' end seq ... Query: 212 ARNPELMREMMRNTDRAMSNIEASPEGFNMLRRMYETVEEPF ... 337 RNPELMREMMRNTDRAMSNIE+SPEGFNMLRRMYETV+EPF ... Sbjc ... t: 214 VRNPELMREMMRNTDRAMSNIESSPEGFNMLRRMYETVQEPF ... 255 Score = 43.9 bits (102), Expect = 0.007 Identi ... Query: 212 ARNPELMREMMRNTDRAMSNIEASPEGFNMLRRMYETVEEPF ... 337 ARNPELMREMMRNTDRAMSNIE+SPEGFNMLRRMYETV+EPF ... Sbj ... ct: 203 ARNPELMREMMRNTDRAMSNIESSPEGFNMLRRMYETVQEPF ... 244 Score = 50.8 bits (120), Expect = 6e-05 Identi ...

  1. Draft genome sequence of Coxiella burnetii Dog Utad, a strain isolated from a dog-related outbreak of Q fever

    Directory of Open Access Journals (Sweden)

    F. D’amato


    Full Text Available Coxiella burnetii Dog Utad, with a 2 008 938 bp genome is a strain isolated from a parturient dog responsible for a human familial outbreak of acute Q fever in Nova Scotia, Canada. Its genotype, determined by multispacer typing, is 21; the only one found in Canada that includes Q212, which causes endocarditis. Only 107 single nucleotide polymorphisms and 16 INDELs differed from Q212, suggesting a recent clonal radiation.

  2. Neutralization og negative charges in F-loop of nicotinic acetylcholine alfa3beta4 receptors impairs the action of agonists and slows receptor desensitization

    Czech Academy of Sciences Publication Activity Database

    Lindovský, Jiří; Kaniaková, Martina; Krůšek, Jan; Vyskočil, František

    Geneva : Swiss Society for Neuroscience, 2008. s. 212-212. ISBN 92-990014-3-X. [FENS. Forum of European Neuroscience /6./. 12.07.2008-16.07.2008, Geneva] R&D Projects: GA MŠk(CZ) LC554; GA AV ČR(CZ) IAA100110501; GA AV ČR(CZ) IAA5011411 Institutional research plan: CEZ:AV0Z50110509 Keywords : spo2 * acetylcholine * nicotine Subject RIV: ED - Physiology

  3. Simultaneous Estimation of Metformin HCl and Gliclazide by Q- Analysis Method

    Directory of Open Access Journals (Sweden)

    Jyotsna R. Chopade


    Full Text Available Q- Analysis method for simultaneous estimation of Metformin HCl and Gliclazide in tablet dosage form have been developed. The method was simple, precise, accurate, reproducible and economical. Linearity was observed in the concentration range of 2-12 μg/ml for GLZ and 2-12 μg/ml for MET. The result of analysis have been validated as per ICH Guidelines.

  4. Simultaneous Estimation of Metformin HCl and Gliclazide by Q- Analysis Method


    Jyotsna R. Chopade; SANJEEV V. DESHPANDE; Sandesh Shah


    Q- Analysis method for simultaneous estimation of Metformin HCl and Gliclazide in tablet dosage form have been developed. The method was simple, precise, accurate, reproducible and economical. Linearity was observed in the concentration range of 2-12 μg/ml for GLZ and 2-12 μg/ml for MET. The result of analysis have been validated as per ICH Guidelines.

  5. 22 CFR 41.21 - Foreign Officials-General. (United States)


    ...)(15)(A)(iii), 101(a)(15)(G)(v), and 212(d)(8), and in the definition of the NATO-7 visa symbol, means... the NATO-1 through NATO-5 visa symbols, means the spouse and unmarried sons and daughters, whether by...(a)(15)(A)(iii), 101(a)(15)(G)(v), and 212(d)(8), and in classification under the NATO-7 visa...

  6. EST Table: FS806218 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS806218 E_FL_fmgV_20B08_F_0 10/09/28 74 %/212 aa ref|XP_970542.1| PREDICTED: similar to brix...B12626-PA 10/09/10 74 %/212 aa gi|91090402|ref|XP_970542.1| PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS911686 fmgV ...

  7. It is more than personal: Development and validation of a multidimensional privacy orientation scale


    Baruh, Lemi; Cemalcılar, Zeynep


    Running Head: MULTIDIMENSIONAL PRIVACY ORIENTATION SCALE 1 It's More than Personal: Development and Validation of a Multidimensional Privacy Orientation Scale Lemi Baruh Department of Media and Visual Arts College of Social Sciences and Humanities Koç University Turkey E-Mail: Phone: +90 212 338 1133 Fax: +90 212 338 3760 Zeynep Cemalcılar Department of Psychology College of Social Sciences and Humanities Koç University Turkey ...

  8. Spawning migration of brown trout, Salmo trutta in the Morávka reservoir

    Czech Academy of Sciences Publication Activity Database

    Piecuch, J.; Lojkásek, B.; Lusk, Stanislav; Marek, T.


    Roč. 56, č. 2 (2007), s. 201-212. ISSN 0139-7893 R&D Projects: GA AV ČR IAA6093105; GA AV ČR 1QS500450513 Institutional research plan: CEZ:AV0Z60930519 Keywords : reproductive migration * tributary * trap * diel activity * environmental factors Subject RIV: EH - Ecology, Behaviour Impact factor: 0.376, year: 2007

  9. Mechanism of the Ca2+-induced enhancement of the intrinsic factor VIIa activity

    DEFF Research Database (Denmark)

    Bjelke, Jais R; Olsen, Ole H; Fodje, Michel; Svensson, L Anders; Bang, Susanne; Bolt, Gert; Kragelund, Birthe B; Persson, Egon


    between the Ca(2+)-binding loop and the N-terminal tail. Crystal structures of tissue factor-bound FVIIa(D212N) and FVIIa(V158D/E296V/M298Q) revealed altered hydrogen bond networks, resembling those in factor Xa and thrombin, after introduction of the D212N and E296V mutations plausibly responsible for...

  10. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  11. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)


    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  12. Preliminary radiological safety assessment for decommissioning of thoria dissolver of the ²³³U pilot plant, Trombay. (United States)

    Priya, S; Srinivasan, P; Gopalakrishnan, R K


    The thoria dissolver, used for separation of (233)U from reactor-irradiated thorium metal and thorium oxide rods, is no longer operational. It was decided to carry out assessment of the radiological status of the dissolver cell for planning of the future decommissioning/dismantling operations. The dissolver interiors are expected to be contaminated with the dissolution remains of irradiated thorium oxide rods in addition to some of the partially dissolved thoria pellets. Hence, (220)Rn, a daughter product of (228)Th is of major radiological concern. Airborne activity of thoron daughters (212)Pb (Th-B) and (212)Bi (Th-C) was estimated by air sampling followed by high-resolution gamma spectrometry of filter papers. By measuring the full-energy peaks counts in the energy windows of (212)Pb, (212)Bi and (208)Tl, concentrations of thoron progeny in the sampled air were estimated by applying the respective intrinsic peak efficiency factors and suitable correction factors for the equilibration effects of (212)Pb and (212)Bi in the filter paper during the delay between sampling and counting. Then the thoron working level (TWL) was evaluated using the International Commission on Radiological Protection (ICRP) methodology. Finally, the potential effective dose to the workers, due to inhalation of thoron and its progeny during dismantling operations was assessed by using dose conversion factors recommended by ICRP. Analysis of filter papers showed a maximum airborne thoron progeny concentration of 30 TWLs inside the dissolver. PMID:21447504

  13. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for


    International Nuclear Information System (INIS)

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and


    Energy Technology Data Exchange (ETDEWEB)

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.


    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  16. Synthesis of functionalized cobaltacarboranes based on the closo-[(1,2-C2B9H11)(2)-3,3 '-Co](-) ion bearing polydentate ligands for separation of M3+ cations from nuclear waste solutions. Electrochemical and liquid-liquid extraction study of selective transfer of M3+ metal cations to an organic phase. Molecular structure of the closo-[(8-(2-CH3O-C5H4-O)-(CH2CH2O)(2)-1,2-C2B9H10)-(1 ',2 '-C2B9H11)-3,3 '-Co]Na determined by X-ray diffraction analysis

    Czech Academy of Sciences Publication Activity Database

    Plešek, Jaromír; Grüner, Bohumír; Heřmánek, Stanislav; Báča, Jiří; Mareček, Vladimír; Jänchenová, Hana; Lhotský, Alexandr; Holub, Karel; Selucký, P.; Rais, J.; Císařová, I.; Čáslavský, Josef


    Roč. 21, 9-10 (2002), s. 975-986. ISSN 0277-5387 R&D Projects: GA MŠk LN00A028; GA MŠk LB98233; GA ČR GA104/01/0142; GA ČR GA203/99/M037; GA ČR GA104/99/1096 Institutional research plan: CEZ:AV0Z4032918 Keywords : carboranes * carba metallaboranes * dicarbollides Subject RIV: CA - Inorganic Chemistry Impact factor: 1.414, year: 2002

  17. Variation of the ground-level air concentration of the thoron decay products - Munic-Neuherberg 1989-2000

    International Nuclear Information System (INIS)

    Seasonal and long-term variation of the ground-level air concentration of the thoron decay product 212Pb (10.6 h), representative of the equilibrium equivalent thoron concentration (EECRn-220), was investigated from 1989 through 2000 at Munich-Neuherberg. For this, 212Pb and 212Bi filter activities were determined gamma-spectrometrically during aerosol collection, and daily mean 212Pb concentrations (or EECRn220) were calculated. The resulting time series were analysed. The measurements yielded a long-term average concentration of 0.0835 Bq m-3. Daily mean concentrations varied from ≤0.01 to 0.34 Bq m-3, monthly mean concentrations from 0,032 to 0,16 Bq m-3, and annual mean concentrations ranged from 0.075 to 0.090 Bq m-3. An average annual effective dose of 1.5 μSv due to outdoor thoron progeny concentration was estimated, which corresponds to about 2% of the dose due to the average short-lived radon progeny concentration (EECRn-222) of 8.4 Bq m-3 measured at Munich-Neuherberg in the same period. The seasonal pattern of 212Pb activity concentration in the atmosphere is characterised by two maxima each year: the first in May and the second in September. Low concentrations are observed from November through February. The most probably reason for this seasonal behaviour is the extremely reduced flux of thoron gas from the ground during the winter months and the enhanced flux in the summer months. Due to strong rain showers from June to July, airborne 212Pb is distinctly washed out from the atmosphere in these months. This overcompensates the enhanced production of thoron decay products due to the enhanced flux in the warm summer months and yields the concentration minimum between May and September. For June, a statistical significant relationship (R2=0.58, p212Pb air concentration and precipitation by regression analysis. (orig.)


    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  19. Formerly utilized MED/AEC sites remedial action program. Radiological survey of the E. I. Du Pont de Nemours and Co. , Deepwater, New Jersey. Final report

    Energy Technology Data Exchange (ETDEWEB)



    The results of a radiological survey of the E. I. Du Pont Company, Deepwater, New Jersey, are presented in this report. During the 1940's this site was used for development of a process for the conversion of uranium oxide to produce uranium tetrafluoride and small quantities of uranium metal. The survey included measurements of the following: residual alpha and beta--gamma contamination levels, both fixed and transferable, in the one remaining uranium tetrafluoride operations building; external gamma radiation levels at 1 m above the surface inside this building and at outdoor locations where radioactive materials were handled; radon and radon daughter concentrations in the air in the operations building; uranium, radium, actinium, and thorium concentrations in soil and water on and near the site; and the airborne concentrations of uranium, thorium, and radium in the operations building. Elevated concentrations of uranium were found in residues from the operations building and in some surface and subsurface soil samples. Alpha and beta--gamma contamination levels in some areas of the operations building were above the limits of current federal guidelines set for the release of property for unrestricted use. 18 figures, 11 tables.

  20. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    International Nuclear Information System (INIS)

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  1. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO{sub 2} and TBP Complex

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)


    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO{sub 3} Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO{sub 3} Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO{sub 3} Complex.

  2. Tumor immunotargeting using innovative radionuclides. (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques


    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  3. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré


    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  4. Purification of lanthanides for double beta decay experiments (United States)

    Polischuk, O. G.; Barabash, A. S.; Belli, P.; Bernabei, R.; Boiko, R. S.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Tretyak, V. I.


    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain 238U, 226Ra and 232,228Th typically on the level of ˜ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO2, Nd2O3 and Gd2O3. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R&D of the methods to remove the pollutions with improved efficiency is in progress.

  5. Radionuclides in coastal swampland soils in South Australia - An unusual distribution?

    International Nuclear Information System (INIS)

    A plant processing uranium ore was constructed during the 1950's on coastal swamplands at Port Pirie, South Australia, with tailings and chemical residues stored in clay-lined dams on site. Environmental soil samples collected recently from this area showed an unusual radionuclide distribution which suggested possible contamination from the former uranium plant nearby. On subsequent investigation it appears this distribution is a general property of swampland soils. The concentration of uranium in these soils is significantly greater (2-10 times) than that of its decay products, with an observed range of uranium concentrations from 50 to 300 Bq/kg. In contrast, 'normal' soils in South Australia contain between 5 and 60 Bq/kg, with decay products close to secular equilibrium. In addition, actinium (and its parent, protactinium) occur in sediments in greater concentration than expected - 6 to 36 Bq/kg compared with a 'normal soil' range of 0.2 to 3 Bq/kg. Results obtained suggest: organic residues in the sediments play a major part in the concentration of radionuclides; and the probable source of radionuclides is sea-water. These observations are consistent with results of other workers who examined the incorporation of stable trace metals into coastal swampland sediments in South Australia. Representative data are presented and discussed

  6. Study of Thorium Utilization in a Large Scale Sodium Cooled Fast Reactor

    International Nuclear Information System (INIS)

    The breeding performance of 232Th in fast reactor is better than 238U, since the capture cross section of 232Th is slightly higher than 238U under the fast neutron spectrum. There are much less fission neutrons in the blanket, so the proportion of neutron with energy above 6MeV (the threshold energy of (n,2n) reaction of 232Th) is very small. Therefore, the 233U produced in fast reactor blanket would have high purity. In this paper, an large scale fast reactor core was taken as the reference core for 232Th utilization study. In the calculation results, the whole capability of 233U production is about 443kg/(GWe•a) in the blanket; at the end of the first cycle (160EFPD), the 233U production per unit mass of 232Th is about 10.71g/(kgTh), and the weight fraction of 232U in actinium is less than 0.019%. It is an attractive technology option to produce 233U in the blanket. (author)

  7. A Critical Review of Alpha Radionuclide Therapy-How to Deal with Recoiling Daughters? (United States)

    de Kruijff, Robin M; Wolterbeek, Hubert T; Denkova, Antonia G


    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  8. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters? (United States)

    de Kruijff, Robin M.; Wolterbeek, Hubert T.; Denkova, Antonia G.


    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  9. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    Directory of Open Access Journals (Sweden)

    Robin M. de Kruijff


    Full Text Available This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET. Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium, 223Ra, and 225Ac (actinium can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue.

  10. Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

    International Nuclear Information System (INIS)

    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y-1. From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g-1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y-1 ranging from 2.79 to 14.17 mSv y-1. (authors)

  11. Emanations and 'induced' radioactivity: from mystery to (mis)use

    International Nuclear Information System (INIS)

    The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD (210Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

  12. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.


    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  13. Development of an Ultra-Low Background Liquid Scintillation Counter for Trace Level Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Erchinger, Jennifer L.; Orrell, John L.; Aalseth, Craig E.; Bernacki, Bruce E.; Douglas, Matthew; Finn, Erin C.; Fuller, Erin S.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Panisko, Mark E.; Shaff, Sarah M.; Warren, Glen A.; Wright, Michael E.


    Low-level liquid scintillation counting (LSC) has been established as one of the radiation detection techniques useful in elucidating environmental processes and environmental monitoring around nuclear facilities. The Ultra-Low Background Liquid Scintillation Counter (ULB-LSC) under construction in the Shallow Underground Laboratory at Pacific Northwest National Laboratory aims to further reduce the MDAs and/or required sample processing. Through layers of passive shielding in conjunction with an active veto and 30 meters water equivalent overburden, the background reduction is expected to be 10 to 100 times below typical analytic low-background liquid scintillation systems. Simulations have shown an expected background of around 14 counts per day. A novel approach to the light collection will use a coated hollow light guide cut into the inner copper shielding. Demonstration LSC measurements will show low-energy detection, spectral deconvolution, and alpha/beta discrimination capabilities, from trials with standards of tritium, strontium-90, and actinium-227, respectively. An overview of the system design and expected demonstration measurements will emphasize the potential applications of the ULB-LSC in environmental monitoring for treaty verification, reach-back sample analysis, and facility inspections.

  14. Enhanced radioactivity due to natural oil and gas production and related radiological problems

    International Nuclear Information System (INIS)

    Within the scope of a research contract, the following aspects are considered: External radiation exposure at production sites; internal radiation exposures during cleaning operations such as removing of scale by sand blasting; problems of waste disposal; internal radiation exposure due to radon inhalation by consumers; the origin of the high radium content of brines from oil and gas fields. Enhanced dose rates up to 50 μSv/h have been found at the external surface of saltwater tanks, but 72% of the 160 sites investigated did not show any increase above the natural background. Brines from gas contained radium-226 up to 286 Bq/1 and scale up to 1 kBq/g. In brines and scale from oil fields radium-228 was usually the dominating radionuclide. Some samples contained significant amounts of lead-210 and even actinium-227, too, but practically no uranium or thorium. The radon-222 concentrations in natural gas samples varied between 0.004 and 4 Bq/l with an average value of 0.6 Bq/l. Related radiological problems are discussed. (orig./HP)

  15. Neutron measurements with miniature fission chambers

    International Nuclear Information System (INIS)

    This report analyses the use and qualification of miniature fission chambers for two types of neutron measurements: 1) relative measurements in nuclear power reactors, or nuclear irradiation reactors. We consider the problem of burnable fissile material in detectors, under important neutron exposures and conclude on recommending the use of regenerating neutron detectors. 2) Measurements of integral physical parameters in experimental reactors. This method has been applied to measurements of fission rates in detectors with strong alpha-rays emitter deposits in order to establish standard tables of physical parameters. It has been used in particular for detectors including very radioactive actinium series. After a discussion of the instrumentation choice and data processing, specific to each measurements, we provide results on: 1) the technological and neutron behaviour of regenerating miniature fission chambers, in the swimming pool reactor 'TRITON', under a neutron exposure of 7.1020 n cm-2 and a gamma-rays exposure of 1,5.1011 rads about. The fissile material is 235U and the fertile material 234U. 2) The integral measurements of effective cross sections for 241Am and 238Pu in the experimental reactor 'MINERVE' use for study of problems of fast neutron reactors

  16. Quantification of radionuclide transfer in terrestrial and freshwater environments: A summary

    International Nuclear Information System (INIS)

    Exposure may occur as a result of incidental releases and discharges from all stages of the nuclear fuel cycle. This includes uranium mines, fuel fabrication facilities, reactors, reprocessing plants and low, intermediate and high level radioactive waste repository sites. Each of these releases involves mainly fission and neutron activation products as well as actinides. Uranium mining and fuel fabrication also involve radionuclides of the uranium, actinium and thorium decay series. In addition, some industries such as mineral sands production and processing, phosphate ore processing, coal burning and oil and gas production can generate naturally occurring radioactive materials (NORMs) as waste. Other sources of human exposure include nuclear weapon testing and radiation accidents or incidents. Any radiological assessments are based on an analysis of radionuclide transport patterns and processes governing radionuclide behaviour in the environment. Therefore, it is an aim of the IAEA to support Member States to enhance their capability for evaluating radionuclide transport, geochemical and biochemical enrichment, and radiation effects on human beings and other biota

  17. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    International Nuclear Information System (INIS)

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

  18. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

    International Nuclear Information System (INIS)

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO3 Complex

  19. Exposure to radioactive aerosols in mining and milling operations: the importance of 227Ac and 231Pa

    International Nuclear Information System (INIS)

    'Full-Text:' 227Ac (half-life of 21.8 y) is the daughter or 231Pa; a beta emitter and parent of a subseries with five short-lived alpha-emitters. 231Pa (half-life of 3.27x104 y) is an alpha-emitter of the actinium series, the decay chain of 235U. As daughters of this uranium isotope they are thought to be unimportant as a radiological hazard, despite the fact that their ALI values for ingestion and inhalation are the lowest of any other radionuclide. Both nuclides can be considered as being in secular equilibrium with uranium in most geological media and so the mass concentration of 231Pa is the same of the 226Ra and that of 227Ac is the same of the 210Pa, to mention only two radionuclides of radiological concern. It is shown in this paper that if 231Pa and 227Ac are considered in the evaluations of dose commitments incurred by inhalation of aerosols in mining and milling operations, the results can be 70% higher than those calculated by the methodology of ICRP Publication 47. (author)

  20. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin

    International Nuclear Information System (INIS)

    The objective of this work was to establish a new procedure for 228Ra determination of natural waters via preconcentration of radium on MnO2 and separation of its daughter, 228Ac, using Diphonix ion exchange resin. Following removal of potential interferences via passage through an initial Diphonix Resin column, the first daughter of 228Ra, 228Ac, is isolated by chromatographic separation via a second Diphonix column. A holding time of >30 h for 228Ac ingrowth in between the two column separations ensures secular equilibrium. Barium-133 is used as a yield tracer. Actinium-228 is eluted from the second Diphonix Resin with 5 ml 1 M 1-Hydroxyethane-1,1-diphosphonic acid (HEDPA) and quantified by addition of scintillation cocktail and LSC counting. Radium (and 133Ba) from the load and rinse solutions from the 2nd Diphonix column may be prepared for alpha spectrometry (for determination of 223Ra, 224Ra, and 226Ra) by BaSO4 microprecipitation and filtration. Decontamination tests indicate that U, Th, and Ra series nuclides do not interfere with these measurements, although high contents of 90Sr (90Y) require additional treatment for accurate measurement of 228Ra. Addition of stable Sr as a 'hold back' carrier during the initial MnO2 preconcentration step was shown to remove most 90Sr interference