WorldWideScience

Sample records for actinium 210

  1. Spectroscopic and computational investigation of actinium coordination chemistry

    Science.gov (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.

    2016-08-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1- ligands (3.2+/-1.1) than AmIII (0.8+/-0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour.

  2. Spectroscopic and computational investigation of actinium coordination chemistry

    Science.gov (United States)

    Ferrier, Maryline G.; Batista, Enrique R.; Berg, John M.; Birnbaum, Eva R.; Cross, Justin N.; Engle, Jonathan W.; La Pierre, Henry S.; Kozimor, Stosh A.; Lezama Pacheco, Juan S.; Stein, Benjamin W.; Stieber, S. Chantal E.; Wilson, Justin J.

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, AcIII reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac–Cl and Ac–OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between AcIII and AmIII in HCl solutions indicate AcIII coordinates more inner-sphere Cl1– ligands (3.2±1.1) than AmIII (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique AcIII chemical behaviour. PMID:27531582

  3. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Science.gov (United States)

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development.

  5. Relativistic small-core pseudopotentials for actinium, thorium, and protactinium.

    Science.gov (United States)

    Weigand, Anna; Cao, Xiaoyan; Hangele, Tim; Dolg, Michael

    2014-04-03

    Small-core pseudopotentials for actinium, thorium, and protactinium have been energy-adjusted to multiconfiguration Dirac-Hartree-Fock reference data based on the Dirac-Coulomb-Breit Hamiltonian and the Fermi nucleus model. Corresponding optimized valence basis sets of polarized valence quadruple-ζ quality are presented. Atomic test calculations for the first four ionization potentials show satisfactory results at both the Hartree-Fock and the multireference averaged coupled-pair functional level. Highly correlated Fock-space coupled cluster calculations demonstrate that the new pseudopotentials yield ionization potentials, which are in excellent agreement with corresponding all-electron results and experimental data. The pseudopotentials and basis sets supplement a similar set previously published for uranium.

  6. Effects of spin-orbit coupling on actinium under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Rubio-Ponce, A.; Rivera, J. [Departamento de Ciencias Basicas, Universidad Autonoma Metropolitana-Azcapotzalco, Mexico (Mexico); Olguin, D. [Departamento de Fi sica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Mexico (Mexico)

    2015-04-15

    Actinium (Ac) is a radioactive metal and the first element of the actinide series. At ambient conditions Ac crystallizes in the fcc lattice, however, up to date its phase diagram is unknown. In the present work, we have studied the structural and electronic properties of Ac under hydrostatic pressure assuming the fcc structure as well as three hypothetical structures, namely the hcp, bcc, and sc, and for pressures up to 100 GPa. From our calculations, we found only one structural transition allowed, from the fcc to hcp, our calculated pressure was 39.85 GPa. The calculations were performed by means of the full potential linearized augmented plane wave (FLAPW) method and the generalized gradient approximation (GGA) for the exchange-correlation energy, where we have included in our study the spin-orbit coupling which is important for heavy elements. The total energy results were fitted to the third order Birch-Murnaghan's equation of state. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  8. Temporal Variations in Surface Concentrations of Terrestrial Lead 210 and Uranium 235 Radionucleides

    Science.gov (United States)

    Yoshimori, M.

    We have started to measure the surface concentrations of terrestrial radionucleides of lead 210 and uranium 235 in Tokyo (N35, E139) in 2002. Lead 210 which is a daughter nucleus of Rn-222 (uranium series) emits 46 keV gamma-ray with a half-life of 22.4 years, while uranium 235 (actinium series) emits a gamma-ray at 186 keV with a half-life of 0.7 billion years. The present measurement of the surface concentration of lead 210 exhibits two peaks in spring and fall, similar to the beryllium 7 seasonal variations, while the uranium 235 concentration does not vary with time within statistical errors. These two terrestrial radionucleides exhibit different temporal variations on the surface. We discuss possible explanations for the differences in the temporal variations from a point of view of differences in their altitude distribution.

  9. Report for General Research September 18 to December 11, 1950 (Actinium Volume)

    Energy Technology Data Exchange (ETDEWEB)

    Haring, M.M.

    1951-01-15

    The purpose of the research work presented in this volume is to develop a process for the separation and purification of actinium-227 produced by neutron bombardment of radium-226 and to develop methods by which uniform films of actinium metal may be deposited on metallic surfaces. The design work on the cave structure and mechanical equipment used in the actinium separation is proceeding on schedule. As the mechanical design phase is nearing completion the emphasis is being directed toward processing equipment. The process as well as the mechanical equipment has been adapted from the research work of F. T. Hagemann and the Remote Control Group at Argonne National Laboratory. Consequently, one of the first objectives is to become familiary with the chemistry of the process and the operation of the mechanical equipment. Cold runs have been made on the T.T.A. benzene extraction using lanthanum and barium in place of actinium and radium. No difficulty with the operation was observed. The formation of precipitates was one of the difficulties encountered with the process as the precipitates carry radium. It has been found that metals such as nickel cause these precipitates to form and should, therefore, be avoided in the construction of equipment. it was also found that a T.T.A. solution exposed to 0.5 curie of polonium over a period of days develops a precipitate. Some new mechanical features hav eshown promise. The use of copper-coated glassware which will hold together even though the glass is cracked has made it possible to replace custom-built heaters with standard heating mantles. A new graphite, silicone grease mixture appears to hold up in stopcocks handling benzene and, as a result, may eliminate the necessary of entering the cave for regreasing. Tests on the preparation of dense concrete have given results which meet the shielding requirements for the cave. A strippable paint and tape combination has been studied and specified to provide for decontamination of

  10. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  11. Lead-210 contamination

    Energy Technology Data Exchange (ETDEWEB)

    Gray, P. [Peter Gray and Associates, Tulsa, OK (United States)

    1997-12-31

    Nearly all scrap dealers, smelters and other recyclers routinely monitor for radioactivity in shipments entering their facility. These sensitive radiation gate monitors easily detect radium-226 and most other radioactive nuclides. However, the type of detector normally used, sodium iodide scintillation crystals, will not detect the low energy gamma radiation emitted by lead-210 and its progeny. Since lead-210 is a common radioactive contaminant in certain industries, contaminated scrap metal from these industries may avoid detection at the recycler. Lead-210 is a decay product of radon-222 which is produced in small concentrations with natural gas. As the natural gas liquids, particularly ethane and propane, are separated from the natural gas, the radon concentrates in the ethane/propane fraction. The natural gas industry, particularly gas processing facilities and industries using ethane and propane as feed stocks can be significantly contaminated with the radon decay products, especially lead-210, bismuth-210 and polonium-210. Unless the scrap metal is decontaminated before sending to the recycler, the lead-210 contaminated scrap may be processed, resulting in some degree of radioactive contamination of the recycling facilities. Methods of detecting the low energy gamma radiation associated with lead-210 include the pancake G-M detector and the thin crystal-thin window scintillation detector.

  12. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  13. ORIGINAL ARTICLE 210

    African Journals Online (AJOL)

    boaz

    18 (4): 210-217. TRANSCRIPTIONAL FACTOR INFLUENCE ON OTA PRODUCTION AND THE QUELLING ATTRIBUTE ... carcinogen following experiments on animals [1,2]. ... security. Some studies suggest that the mycotoxin biosynthesis.

  14. Thorium and actinium polyphosphonate compounds as bone-seeking alpha particle-emitting agents.

    Science.gov (United States)

    Henriksen, Gjermund; Bruland, Oyvind S; Larsen, Roy H

    2004-01-01

    The present study explores the use of alpha-particle-emitting, bone-seeking agents as candidates for targeted radiotherapy. Actinium and thorium 1,4,7,10 tetraazacyclododecane N,N',N'',N''' 1,4,7,10-tetra(methylene) phosphonic acid (DOTMP) and thorium-diethylene triamine N,N',N'' penta(methylene) phosphonic acid (DTMP) were prepared and their biodistribution evaluated in conventional Balb/C mice at four hours after injection. All three bone-seeking agents showed a high uptake in bone and a low uptake in soft tissues. Among the soft tissue organs, only kidney had a relatively high uptake. The femur/kidney ratios for 227Th-DTMP, 228-Ac-DOTMP and 227Th-DOTMP were 14.2, 7.6 and 6.0, respectively. A higher liver uptake of 228Ac-DOTMP was seen than for 227Th-DTMP and 227Th-DOTMP. This suggests that some demetallation of the 228Ac-DOTMP complex had occurred. The results indicate that 225Ac-DOTMP, 227Th-DOTMP and 227Th-DTMP have promising properties as potential therapeutic bone-seeking agents.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. Po-210 and Pb-210 as atmospheric tracers and global atmospheric Pb-210 fallout: a review.

    Science.gov (United States)

    Baskaran, M

    2011-05-01

    Over the past ∼ 5 decades, the distribution of (222)Rn and its progenies (mainly (210)Pb, (210)Bi and (210)Po) have provided a wealth of information as tracers to quantify several atmospheric processes that include: i) source tracking and transport time scales of air masses; ii) the stability and vertical movement of air masses iii) removal rate constants and residence times of aerosols; iv) chemical behavior of analog species; and v) washout ratios and deposition velocities of aerosols. Most of these applications require that the sources and sink terms of these nuclides are well characterized. Utility of (210)Pb, (210)Bi and (210)Po as atmospheric tracers requires that data on the (222)Rn emanation rates is well documented. Due to low concentrations of (226)Ra in surface waters, the (222)Rn emanation rates from the continent is about two orders of magnitude higher than that of the ocean. This has led to distinctly higher (210)Pb concentrations in continental air masses compared to oceanic air masses. The highly varying concentrations of (210)Pb in air as well the depositional fluxes have yielded insight on the sources and transit times of aerosols. In an ideal enclosed air mass (closed system with respect to these nuclides), the residence times of aerosols obtained from the activity ratios of (210)Pb/(222)Rn, (210)Bi/(210)Pb, and (210)Po/(210)Pb are expected to agree with each other, but a large number of studies have indicated discordance between the residence times obtained from these three pairs. Recent results from the distribution of these nuclides in size-fractionated aerosols appear to yield consistent residence time in smaller-size aerosols, possibly suggesting that larger size aerosols are derived from resuspended dust. The residence times calculated from the (210)Pb/(222)Rn, (210)Bi/(210)Pb, and (210)Po/(210)Pb activity ratios published from 1970's are compared to those data obtained in size-fractionated aerosols in this decade and possible reasons for

  17. 210Pb dating

    Science.gov (United States)

    Swarzenski, Peter W.

    2014-01-01

    Roughly fifty years ago, a small group of scientists from Belgium and the United States, trying to better constrain ice sheet accumulation rates, attempted to apply what was then know about environmental lead as a potential geochronometer. Thus Goldberg (1963) developed the first principles of the 210Pb dating method, which was soon followed by a paper by Crozaz et al. (1964), who examined accumulation history of Antarctic snow using 210Pb. Shortly thereafter, Koide et al. (1972, 1973) adapted this technique to unravel sediment deposition and accumulation records in deep-sea environments. Serendipitously, they chose to work in a deep basin off California, where an independent and robust age model had already been developed. Krishanswami et al. (1971) extended the use of this technique to lacustrine deposits to reconstruct depositional histories of lake sediment, and maybe more importantly, contaminant inputs and burial. Thus, the powerful tool for dating recent (up to about one century old) sediment deposits was established and soon widely adopted. Today almost all oceanographic or limnologic studies that address recent depositional reconstructions employ 210Pb as one of several possible geochronometers (Andrews et al., 2009; Gale, 2009; Baskaran, 2011; Persson and Helms, 2011). This paper presents a short overview of the principles of 210Pb dating and provides a few examples that illustrate the utility of this tracer in contrasting depositional systems. Potential caveats and uncertainties (Appleby et al., 1986; Binford, 1990; Binford et al., 1993; Smith, 2001; Hancock et al., 2002) inherent to the use and interpretation of 210Pb-derived age-models are also introduced. Recommendations as to best practices for most reliable uses and reporting are presented in the summary.

  18. Po-210 and Pb-210 as atmospheric tracers and global atmospheric Pb-210 fallout: a Review

    Energy Technology Data Exchange (ETDEWEB)

    Baskaran, M., E-mail: Baskaran@wayne.ed [Department of Geology, Wayne State University, Detroit, MI-48202 (United States)

    2011-05-15

    Over the past {approx}5 decades, the distribution of {sup 222}Rn and its progenies (mainly {sup 210}Pb, {sup 210}Bi and {sup 210}Po) have provided a wealth of information as tracers to quantify several atmospheric processes that include: i) source tracking and transport time scales of air masses; ii) the stability and vertical movement of air masses iii) removal rate constants and residence times of aerosols; iv) chemical behavior of analog species; and v) washout ratios and deposition velocities of aerosols. Most of these applications require that the sources and sink terms of these nuclides are well characterized. Utility of {sup 210}Pb, {sup 210}Bi and {sup 210}Po as atmospheric tracers requires that data on the {sup 222}Rn emanation rates is well documented. Due to low concentrations of {sup 226}Ra in surface waters, the {sup 222}Rn emanation rates from the continent is about two orders of magnitude higher than that of the ocean. This has led to distinctly higher {sup 210}Pb concentrations in continental air masses compared to oceanic air masses. The highly varying concentrations of {sup 210}Pb in air as well the depositional fluxes have yielded insight on the sources and transit times of aerosols. In an ideal enclosed air mass (closed system with respect to these nuclides), the residence times of aerosols obtained from the activity ratios of {sup 210}Pb/{sup 222}Rn, {sup 210}Bi/{sup 210}Pb, and {sup 210}Po/{sup 210}Pb are expected to agree with each other, but a large number of studies have indicated discordance between the residence times obtained from these three pairs. Recent results from the distribution of these nuclides in size-fractionated aerosols appear to yield consistent residence time in smaller-size aerosols, possibly suggesting that larger size aerosols are derived from resuspended dust. The residence times calculated from the {sup 210}Pb/{sup 222}Rn, {sup 210}Bi/{sup 210}Pb, and {sup 210}Po/{sup 210}Pb activity ratios published from 1970&apos

  19. Polonium-210 budget in cigarettes

    Energy Technology Data Exchange (ETDEWEB)

    Khater, A.E.M. E-mail: khater_ashraf@yahoo.com)

    2004-07-01

    Due to the relatively high activity concentrations of {sup 210}Po and {sup 210}Pb that are found in tobacco and its products, cigarette smoking highly increases the internal intake of both radionuclides and their concentrations in the lung tissues. That might contribute significantly to an increase in the internal radiation dose and in the number of instances of lung cancer observed among smokers. Samples of most frequently smoked fine and popular brands of cigarettes were collected from those available on the Egyptian market. {sup 210}Po activity concentrations were measured by alpha spectrometry, using surface barrier detectors, following the radiochemical separation of polonium. Samples of fresh tobacco, wrapping paper, fresh filters, ash and post-smoking filters were spiked with {sup 208}Po for chemical recovery calculation. The samples were dissolved using mineral acids (HNO{sub 3}, HCl and HF). Polonium was spontaneously plated-out on stainless steel disks from diluted HCl solution. The {sup 210}Po activity concentration in smoke was estimated on the basis of its activity in fresh tobacco and wrapping paper, fresh filter, ash and post-smoking filters. The percentages of {sup 210}Po activity concentrations that were recovered from the cigarette tobacco to ash, post-smoking filters, and smokes were assessed. The results of this work indicate that the average (range) activity concentration of {sup 210}Po in cigarette tobacco was 16.6 (9.7-22.5) mBq/cigarette. The average percentages of {sup 210}Po content in fresh tobacco plus wrapping paper that were recovered by post-smoking filters, ash and smoke were 4.6, 20.7 and 74.7, respectively. Cigarette smokers, who are smoking one pack (20 cigarettes) per day, are inhaling on average 123 mBq/d of {sup 210}Po and {sup 210}Pb each. The annual effective doses were calculated on the basis of {sup 210}Po and {sup 210}Pb intake with the cigarette smoke. The mean values of the annual effective dose for smokers (one pack per

  20. Polonium-210 budget in cigarettes.

    Science.gov (United States)

    Khater, Ashraf E M

    2004-01-01

    Due to the relatively high activity concentrations of (210)Po and (210)Pb that are found in tobacco and its products, cigarette smoking highly increases the internal intake of both radionuclides and their concentrations in the lung tissues. That might contribute significantly to an increase in the internal radiation dose and in the number of instances of lung cancer observed among smokers. Samples of most frequently smoked fine and popular brands of cigarettes were collected from those available on the Egyptian market. (210)Po activity concentrations were measured by alpha spectrometry, using surface barrier detectors, following the radiochemical separation of polonium. Samples of fresh tobacco, wrapping paper, fresh filters, ash and post-smoking filters were spiked with (208)Po for chemical recovery calculation. The samples were dissolved using mineral acids (HNO(3), HCl and HF). Polonium was spontaneously plated-out on stainless steel disks from diluted HCl solution. The (210)Po activity concentration in smoke was estimated on the basis of its activity in fresh tobacco and wrapping paper, fresh filter, ash and post-smoking filters. The percentages of (210)Po activity concentrations that were recovered from the cigarette tobacco to ash, post-smoking filters, and smokes were assessed. The results of this work indicate that the average (range) activity concentration of (210)Po in cigarette tobacco was 16.6 (9.7-22.5) mBq/cigarette. The average percentages of (210)Po content in fresh tobacco plus wrapping paper that were recovered by post-smoking filters, ash and smoke were 4.6, 20.7 and 74.7, respectively. Cigarette smokers, who are smoking one pack (20 cigarettes) per day, are inhaling on average 123 mBq/d of (210)Po and (210)Pb each. The annual effective doses were calculated on the basis of (210)Po and (210)Pb intake with the cigarette smoke. The mean values of the annual effective dose for smokers (one pack per day) were estimated to be 193 and 251 microSv from

  1. 7 CFR 210.13 - Facilities management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Facilities management. 210.13 Section 210.13... Participation § 210.13 Facilities management. Link to an amendment published at 74 FR 66216, Dec. 15, 2009. (a..., the added text is set forth as follows: § 210.13 Facilities management. (c) Food safety program....

  2. Applications of PB-210/RA-226 and PO-210/PB-210 disequilibria in the study of marine geochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Bacon, M. P.

    1976-02-01

    The distribution of /sup 210/Pb and /sup 210/Po in dissolved (less than 0.4 micron) and particulate (greater than 0.4 micron) phases was measured at ten stations in the tropical and eastern North Atlantic and at two stations in the Pacific. Both radionuclides occur principally in the dissolved phase. Unsupported /sup 210/Pb activities, maintained by flux from the atmosphere, were present in the surface mixed layer and penetrated into the thermocline to depths of about 500 m. Dissolved /sup 210/Po was ordinarily present in the mixed layer at less than equilibrium concentrations, suggesting rapid biological removal of this nuclide. Particulate matter was enriched in /sup 210/Po, with /sup 210/Po//sup 210/Pb activity ratios greater than 1.0, similar to those reported for phytoplankton. Box-model calculations yield a 2-y residence time for /sup 210/Pb and a 0.6-y residence time for /sup 210/Po in the mixed layer. These residence times are considerably longer than the time calculated for turnover of particles in the mixed layer (about 0.1 y). At depths of 100 to 300 m, /sup 210/Po maxima occurred and unsupported /sup 210/Po was frequently present. Calculations indicate that at least 50 percent of the /sup 210/Po removed from the mixed layer is re-cycled within the thermocline. Similar calculations for /sup 210/Pb suggest much lower re-cycling efficiencies.

  3. Polonium-210 as a poison.

    Science.gov (United States)

    Harrison, John; Leggett, Rich; Lloyd, David; Phipps, Alan; Scott, Bobby

    2007-03-01

    The death of Alexander Litvinenko on 23 November 2006 has brought into focus scientific judgements concerning the radiotoxicity of polonium-210 ((210)Po). This paper does not consider the specific radiological circumstances surrounding the tragic death of Mr Litvinenko; rather, it provides an evaluation of published human and animal data and models developed for the estimation of alpha radiation doses from (210)Po and the induction of potentially fatal damage to different organs and tissues. Although uncertainties have not been addressed comprehensively, the reliability of key assumptions is considered. Concentrating on the possibility of intake by ingestion, the use of biokinetic and dosimetric models to estimate organ and tissue doses from (210)Po is examined and model predictions of the time-course of dose delivery are illustrated. Estimates are made of doses required to cause fatal damage, taking account of the possible effects of dose protraction and the relative biological effectiveness (RBE) of alpha particles compared to gamma and x-rays. Comparison of LD(50) values (dose to cause death for 50% of people) for different tissues with the possible accumulation of dose to these tissues suggests that bone marrow failure is likely to be an important component of multiple contributory causes of death occurring within a few weeks of an intake by ingestion. Animal data on the effects of (210)Po provide good confirmatory evidence of intakes and doses required to cause death within about 3 weeks. The conclusion is reached that 0.1-0.3 GBq or more absorbed to blood of an adult male is likely to be fatal within 1 month. This corresponds to ingestion of 1-3 GBq or more, assuming 10% absorption to blood. Well-characterised reductions in white cell counts would be observed. Bone marrow failure is likely to be compounded by damage caused by higher doses to other organs, including kidneys and liver. Even if the bone marrow could be rescued, damage to other organs can be

  4. Baseline concentration of Polonium-210 ((210)Po) in tuna fish.

    Science.gov (United States)

    Khan, M Feroz; Wesley, S Godwin

    2016-06-15

    Several species of tuna fish were analyzed for (210)Po content in their edible muscle tissues. This study was carried out as a part of baseline data generation around a large nuclear power plant situated at Kudankulam, southeast coast of India. The concentration of (210)Po in the muscle tissue ranged from 40.9±5.2 to 92.5±7.9Bq/kg of fresh fish, and the highest activity was recorded for the tuna Euthynnus affinis and the lowest for Auxis thazard. The committed effective dose to the local residents was calculated to be 62.7-141.8μSvyear(-1). Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. {sup 210}Po and {sup 210}Pb intake by the Portuguese population: The contribution of seafood in the dietary intake of {sup 210}Po and {sup 210}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, F.P. [Instituto Nacional de Engenharia e Tecnolgia Industrial, Savavem (Portugal)

    1995-10-01

    Through analysis of {sup 210}Po and {sup 210}Pb in the diet, the average ingestion rate for the Portuguese population is estimated at 1.2 and 0.47 Bq d{sup -1} per capita for {sup 210}Po and {sup 210}Pb, respectively. Detailed analysis of foods indicate that seafood alone contributes up to 70% of the {sup 210}Po ingestion rate, whereas cerals, vegetables, and meat altogether contribute 79% of the {sup 210}Pb ingestion rate. Consumption of seafood, both in terms of quantities (kg d{sup -1} per person) and preferential consumption of certain marine species, is the cause of the relatively high intake of {sup 210}Po and high {sup 210}Po:{sup 210}Pb ratio in the diet in comparison with other countries. Other {sup 210}Po and {sup 210}Pb sources, namely inhalation of surface air and cigarette smoke, contribute only a small percentage of the adsorption of these radionuclides in the blood. Estimated total body burdens of {sup 210}Po and {sup 210}Pb in adult men, 70 Bq, are 3.5 times higher than estimates for humans living in normal radioactivity regions and consuming a reference diet. Average whole body effective doses for the adult from the Portuguese population are estimated at about 85 {mu}Sv y{sup -1} from {sup 210}Po and 170 {mu}Sv y{sup -1} from {sup 210}Pb adsorbed with the diet. Effective dose from {sup 210}Po in the diet may vary from 25 {mu}Sv y{sup -1} in an heavy consumer of sardines, to 1,000 {mu}Sv y{sup -1} in an hypothetical heavy consumer of molluscs. 46 refs., 2 figs., 4 tabs.

  6. 46 CFR 132.210 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Classification. 132.210 Section 132.210 Shipping COAST... Portable and Semiportable Fire Extinguishers § 132.210 Classification. (a) Each portable fire extinguisher... Classification Type Size Halon 1211, 1301, and 1211-1301 mixtures kgs. (lbs.) Foam, liters (gallons)...

  7. 28 CFR 36.210 - Smoking.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Smoking. 36.210 Section 36.210 Judicial... COMMERCIAL FACILITIES General Requirements § 36.210 Smoking. This part does not preclude the prohibition of, or the imposition of restrictions on, smoking in places of public accommodation....

  8. 22 CFR 513.210 - Voluntary exclusion.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Voluntary exclusion. 513.210 Section 513.210... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) Effect of Action § 513.210 Voluntary exclusion. Persons who accept voluntary exclusions under § 513.315 are excluded in accordance with the terms of...

  9. 5 CFR 210.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 210.102 Section 210.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS BASIC CONCEPTS AND DEFINITIONS (GENERAL) Applicability of Regulations; Definitions § 210.102 Definitions. (a) The definitions in paragraph...

  10. 31 CFR 210.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... and Federal Reserve Banks with respect to central accounting, financial reporting, and other Federal... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions. 210.2 Section 210.2... CLEARING HOUSE § 210.2 Definitions. For purposes of this part, the following definitions apply. Any term...

  11. 7 CFR 210.27 - Educational prohibitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Educational prohibitions. 210.27 Section 210.27 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NATIONAL SCHOOL LUNCH PROGRAM Additional Provisions § 210.27...

  12. 22 CFR 210.655 - Individual.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Individual. 210.655 Section 210.655 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 210.655 Individual. Individual means a natural person....

  13. 7 CFR 210.21 - Procurement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement. 210.21 Section 210.21 Agriculture... Responsibilities § 210.21 Procurement. (a) General. State agencies and school food authorities shall comply with... the applicable Office of Management and Budget Circulars, concerning the procurement of all goods...

  14. 7 CFR 210.14 - Resource management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Resource management. 210.14 Section 210.14 Agriculture... Participation § 210.14 Resource management. (a) Nonprofit school food service. School food authorities shall.... Expenditures of nonprofit school food service revenues shall be in accordance with the financial...

  15. 46 CFR 184.210 - Heating equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Heating equipment. 184.210 Section 184.210 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.210 Heating...

  16. 46 CFR 121.210 - Heating equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Heating equipment. 121.210 Section 121.210 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150... SYSTEMS AND EQUIPMENT Cooking and Heating § 121.210 Heating equipment. (a) Each heater must be...

  17. 22 CFR 210.640 - Employee.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employee. 210.640 Section 210.640 Foreign... (FINANCIAL ASSISTANCE) Definitions § 210.640 Employee. (a) Employee means the employee of a recipient directly engaged in the performance of work under the award, including— (1) All direct charge employees;...

  18. 22 CFR 210.670 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspension. 210.670 Section 210.670 Foreign... (FINANCIAL ASSISTANCE) Definitions § 210.670 Suspension. Suspension means an action taken by a Federal agency..., subpart 9.4) and the common rule, Government-wide Debarment and Suspension (Nonprocurement),...

  19. 16 CFR 1500.210 - Responsibility.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Responsibility. 1500.210 Section 1500.210 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL HAZARDOUS SUBSTANCES ACT REGULATIONS HAZARDOUS SUBSTANCES AND ARTICLES; ADMINISTRATION AND ENFORCEMENT REGULATIONS § 1500.210 Responsibility. The...

  20. 38 CFR 51.210 - Administration.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Administration. 51.210 Section 51.210 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) PER DIEM FOR NURSING HOME CARE OF VETERANS IN STATE HOMES Standards § 51.210 Administration. A facility must...

  1. 38 CFR 52.210 - Administration.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Administration. 52.210 Section 52.210 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) PER DIEM FOR ADULT DAY HEALTH CARE OF VETERANS IN STATE HOMES Standards § 52.210 Administration. An adult...

  2. 7 CFR 210.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 210.3 Section 210.3 Agriculture... CHILD NUTRITION PROGRAMS NATIONAL SCHOOL LUNCH PROGRAM General § 210.3 Administration. (a) FNS. FNS will act on behalf of the Department in the administration of the Program. Within FNS, the CND will...

  3. 32 CFR 210.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 210.4 Section 210.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ENFORCEMENT OF STATE TRAFFIC LAWS ON DOD INSTALLATIONS § 210.4 Responsibilities. (a) The Assistant Secretary...

  4. 32 CFR 210.3 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 210.3 Section 210.3 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ENFORCEMENT OF STATE TRAFFIC LAWS ON DOD INSTALLATIONS § 210.3 Policy. (a) It is the policy of the Department...

  5. 31 CFR 210.3 - Governing law.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Governing law. 210.3 Section 210.3... CLEARING HOUSE § 210.3 Governing law. (a) Federal law. The rights and obligations of the United States and..., are governed by this part, which has the force and effect of Federal law. (b) Incorporation...

  6. Aerosols: unexpected disequilibrium phenomena between airborne radio activities of lead-210 and its progenies bismuth-210 and polonium-210.

    Science.gov (United States)

    Wallner, Gabriele; Berner, Axel; Irlweck, Karl

    2002-12-01

    For the first time, concentrations of the long lived radon progenies (210)Pb, (210)Bi and (210)Po were measured in the mine atmosphere of the so called "healing gallery" in Badgastein, Austria, a region famous for its radioactive springs. These investigations were performed in order to study the radioactive equilibrium between the (210)Pb-(210)Bi and the (210)Pb-(210)Po pairs so as to gain more information about the aerosol-forming processes in the mine. The particle size distribution of the aerosols was determined under different ventilation conditions. Six-stage and eight-stage cascade impactors with working ranges from 0.15 to 5 micro m and from 0.063 to 8 micro m, respectively, were used to collect the mine aerosols. These samples were analysed in the laboratory and measured by liquid scintillation spectrometry. The most surprising results were found under full ventilation, when the total activity concentrations of (210)Pb, (210)Bi and (210)Po were 4.6, 2.0 and 16.5 mBq/m(3), respectively. In this case (210)Po/(210)Pb activity ratios ranged between 1.8+/-0.3 and 4.3+/-0.3. These unexpected results were confirmed by the eight-stage impactor samples. For the smallest particles, between 0.062 and 0.125 micro m, an even higher value of 7.5 was observed. As outside sources could be excluded, such (210)Po enrichments must occur during the aerosol-forming process itself inside the mine.

  7. Dicty_cDB: SLE210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE210 (Link to dictyBase) - - - Contig-U10780-1 SLE210P (Link to Original site) SLE...210F 675 SLE210Z 660 SLE210P 1315 - - Show SLE210 Library SL (Link to library) Clone ID SLE...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLE2-A/SLE210Q.Seq.d/ Representative seq. ID SLE...210P (Link to Original site) Representative DNA sequence >SLE210 (SLE210Q) /CSM/SL/SLE2-A/SLE...DRVLILPIDEQIKDLFAFKPYELQKYFKVGDHVKAIGGRYEGETGMVLRVDDLQ VVLLSDLTMSEIKVKPQDLQECTEVATGRLELGNYELHDLVQIGPHKVGVIIK

  8. 17 CFR 210.1-01 - Application of Regulation S-X (17 CFR part 210).

    Science.gov (United States)

    2010-04-01

    ..., SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Application of Regulation S-X... (17 CFR part 210). 210.1-01 Section 210.1-01 Commodity and Securities Exchanges SECURITIES...

  9. Polonium-210 and lead-210 in the terrestrial environment: a historical review.

    Science.gov (United States)

    Persson, Bertil R R; Holm, Elis

    2011-05-01

    The radionuclides (210)Po and (210)Pb widely present in the terrestrial environment are the final long-lived radionuclides in the decay of (238)U in the earth's crust. Their presence in the atmosphere is due to the decay of (222)Rn diffusing from the ground. The range of activity concentrations in ground level air for (210)Po is 0.03-0.3 Bq m(-3) and for (210)Pb 0.2-1.5 Bq m(-3). In drinking water from private wells the activity concentration of (210)Po is in the order of 7-48 mBq l(-1) and for (210)Pb around 11-40 mBq l(-1). From water works, however, the activity concentration for both (210)Po and (210)Pb is only in the order of 3 mBq l(-1). Mosses, lichens and peat have a high efficiency in capturing (210)Po and (210)Pb from atmospheric fallout and exhibit an inventory of both (210)Po and (210)Pb in the order of 0.5-5 kBq m(-2) in mosses and in lichens around 0.6 kBq m(-2). The activity concentrations in lichens lies around 250 Bq kg(-1), dry mass. Reindeer and caribou graze lichen which results in an activity concentration of (210)Po and (210)Pb of about 1-15 Bq kg(-1) in meat from these animals. The food chain lichen-reindeer or caribou, and Man constitutes a unique model for studying the uptake and retention of (210)Po and (210)Pb in humans. The effective annual dose due to (210)Po and (210)Pb in people with high consumption of reindeer/caribou meat is estimated to be around 260 and 132 μSv a(-1) respectively. In soils, (210)Po is adsorbed to clay and organic colloids and the activity concentration varies with soil type and also correlates with the amount of atmospheric precipitation. The average activity concentration levels of (210)Po in various soils are in the range of 20-240 Bq kg(-1). Plants become contaminated with radioactive nuclides both by absorption from the soil (supported Po) and by deposition of radioactive fallout on the plants directly (unsupported Po). In fresh leafy plants the level of (210)Po is particularly high as the result of the

  10. 31 CFR 537.210 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 537.210 Section 537.210 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... assist in the creation of information or informational materials; and, with respect to information or...

  11. 31 CFR 560.210 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 560.210 Section 560.210 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... services to market, produce or co-produce, create or assist in the creation of information and...

  12. 19 CFR 210.37 - Evidence.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Evidence. 210.37 Section 210.37 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE... retained with the record so as to be available for consideration by any reviewing authority....

  13. 19 CFR 210.38 - Record.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Record. 210.38 Section 210.38 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE... corrections as are warranted, after consideration of any objections that may be made. Such corrections...

  14. 40 CFR 1042.210 - Preliminary approval.

    Science.gov (United States)

    2010-07-01

    ... specific provisions that apply for deterioration factors. Decisions made under this section are considered... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Preliminary approval. 1042.210 Section 1042.210 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION...

  15. 40 CFR 86.210-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.210-94 Section 86.210-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  16. 31 CFR 210.8 - Financial institutions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Financial institutions. 210.8 Section... CLEARING HOUSE General § 210.8 Financial institutions. (a) Status as a Treasury depositary. The origination or receipt of an entry subject to this part does not render a financial institution a...

  17. 33 CFR 183.210 - Reference areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Reference areas. 183.210 Section... of More Than 2 Horsepower General § 183.210 Reference areas. (a) The forward reference area of a boat...) The aft reference area of a boat is the aft most two feet of the top surface of the hull or deck,...

  18. 22 CFR 210.650 - Grant.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Grant. 210.650 Section 210.650 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE... authorized by a law of the United States, rather than to acquire property or services for the...

  19. 42 CFR 93.210 - Good faith.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Good faith. 93.210 Section 93.210 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON...

  20. (210)Polonium and (210)lead content of marine birds from Southeastern Brazil.

    Science.gov (United States)

    Godoy, José Marcus; Siciliano, Salvatore; de Carvalho, Zenildo Lara; Tavares, Davi C; de Moura, Jaílson Fulgencio; Godoy, Maria Luiza D P

    2014-09-01

    In this study, we report the (210)Po and (210)Pb concentrations of bone, muscle and liver samples that were obtained from twelve different marine bird species stranded on beaches in the central-north region of Rio de Janeiro State. Both radionuclides were highly concentrated in the liver samples; however, the lowest mean (210)Po/(210)Pb activity ratio (1.3) was observed in bones compared with liver and muscle (16.8 and 13.8, respectively). Among the species that were studied, Fregata magnificens, with a diet based exclusively on fish, had the lowest (210)Pb and (210)Po concentrations and the lowest (210)Po/(210)Pb activity ratio. The (210)Po concentrations in Puffinus spp. liver samples followed a log-normal distribution, with a geometric mean of 300 Bq kg(-1)wet weight. Only two references pertaining to (210)Po in marine birds were found in a Web of Science search of the literature, and each study reported a different concentration value. The values determined in this experiment are consistent with those in one of the previous studies, which also included one of the species studied in this work. No values for (210)Pb in marine birds have been published previously. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Determination of {sup 210}Pb and {sup 210}Po in cigarette tobacco; Determinacao de {sup 210}Pb e {sup 210}Po em tabaco de cigarros nacionais

    Energy Technology Data Exchange (ETDEWEB)

    Peres, Ana Claudia

    1999-07-01

    Cigarette smoking is one of the important pathways that could contribute to enhance the radiation dose to man, due to the relatively large concentrations of {sup 210}Pb and {sup 210}Po found in tobacco leaves. In this work, concentrations of these two radionuclides were determined in eight of the most commercialized cigarette brands produced in Brazil. The samples analyzed were bought randomly in the market. The {sup 210}Pb was determined by counting the beta activity of the {sup 210}Bi in a gas flow proportional detector, after radiochemical separation and precipitation of the PbCr0{sub 4}. The {sup 210}Po was determined by alpha spectrometry, using a surface barrier detector, after radiochemical separation and spontaneous deposition of Po in copper disk. The results showed concentrations ranging from 11,9 to 30,2 mBq per gram of dry tobacco for {sup 210}Pb and from 10,9 to 27,4 mBq per gram of dry tobacco for {sup 210}Po. (author)

  2. Dicty_cDB: VSI210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSI210 (Link to dictyBase) - - - Contig-U16414-1 VSI210P (Link to Original site) VSI2...10F 590 VSI210Z 138 VSI210P 728 - - Show VSI210 Library VS (Link to library) Clone ID VSI2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI2-A/VSI210Q.Seq.d/ Representative seq. ID VSI2...10P (Link to Original site) Representative DNA sequence >VSI210 (VSI210Q) /CSM/VS/VSI2-A/VSI2...EXLSEDSYK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSI210 (VSI210Q) /CSM/VS/VSI2-A/VSI2

  3. Aspects on the analysis of 210Po

    DEFF Research Database (Denmark)

    Henricsson, F.; Ranebo, Y.; Holm, E.

    2011-01-01

    will be too low. Both these systematic errors give rise to a too high 210Po/210Pb ratio. The fraction of 210Pb which is plating out has been assessed in this study for different matrices and is about 50–90%. During the measurement by solid state Si-detectors, some Po is evaporated in the vacuum conditions......-ashing by the use of a double-tracer technique. We have found that the losses were about 30% when open glass beakers were used and about 17% when the samples were digested in microwave oven. When long-necked bottles (Kjeldahl flasks) were used, a loss of about 20% was registered. It has also been observed that 210...

  4. 29 CFR 1603.210 - Discovery.

    Science.gov (United States)

    2010-07-01

    ... STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF THE GOVERNMENT EMPLOYEE RIGHTS ACT OF 1991 Hearings § 1603.210 Discovery. (a) Unless otherwise ordered by...

  5. (210)Po and (210)Pb in medicinal plants in the region of Karnataka, Southern India.

    Science.gov (United States)

    Chandrashekara, K; Somashekarappa, H M

    2016-08-01

    The activity concentrations of naturally occurring radionuclides (210)Po and (210)Pb were estimated in some selected medicinal plants and soil samples of coastal Karnataka in India. The mean activity concentrations of (210)Po and (210)Pb varied in the range of 4.7-42.9 Bq kg(-1) (dry weight) and 36.1-124 Bq kg(-1) (dry weight) in the soil samples, and 3.3-63.7 Bq kg(-1) (dry weight) and 12.0-406 Bq kg(-1) (dry weight), in the medicinal plant samples, respectively. The plants, Ocimum sanctum L. and Plectranthus amboinicus (Lour.) Spreng had significantly higher activity concentrations of (210)Po and (210)Pb than other species sampled. In spite of disequilibrium between them, these two radionuclides were well correlated in both soil and medicinal plants.

  6. Dicty_cDB: VSG210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG210 (Link to dictyBase) - G02840 DDB0187726 Contig-U14854-1 VSG...210P (Link to Original site) VSG210F 396 VSG210Z 381 VSG210P 777 - - Show VSG210 Library VS (Link to library) Clone ID VSG...ontig-U14854-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG2-A/VSG...210Q.Seq.d/ Representative seq. ID VSG210P (Link to Original site) Representative DNA sequence >VSG210 (VSG210Q) /CSM/VS/VSG...2-A/VSG210Q.Seq.d/ AATTTTAGTTGGTTCCACATAACATAAACATGTCCGCCTTAGACTACGCCACTTTAATCT TACACGAC

  7. Levels and transfer of {sup 210}Po and {sup 210}Pb in Nordic terrestrial ecosystems

    Energy Technology Data Exchange (ETDEWEB)

    Brown, J.E., E-mail: justin.brown@nrpa.n [Norwegian Radiation Protection Authority, PO Box 55, N-1332, Osteras (Norway); Gjelsvik, R. [Norwegian Radiation Protection Authority, PO Box 55, N-1332, Osteras (Norway); Roos, P. [RISO-DTU P.O. Box 49 DK-4000 Roskilde (Denmark); Kalas, J.A. [Norwegian Institute for Nature Research (NINA), Tungasletta 2, 7485 Trondheim (Norway); Outola, I. [STUK, Laippatie 4/P.O. BOX 14, 00881 Helsinki (Finland); Holm, E. [Norwegian Radiation Protection Authority, PO Box 55, N-1332, Osteras (Norway)

    2011-05-15

    Recent developments regarding environmental impact assessment methodologies for radioactivity have precipitated the need for information on levels of naturally occurring radionuclides within and transfer to wild flora and fauna. The objectives of this study were therefore to determine activity concentrations of the main dose forming radionuclides {sup 210}Po and {sup 210}Pb in biota from terrestrial ecosystems thus providing insight into the behaviour of these radioisotopes. Samples of soil, plants and animals were collected at Dovrefjell, Central Norway and Olkiluoto, Finland. Soil profiles from Dovrefjell exhibited an approximately exponential fall in {sup 210}Pb activity concentrations from elevated levels in humus/surface soils to 'supported' levels at depth. Activity concentrations of {sup 210}Po in fauna (invertebrates, mammals, birds) ranged between 2 and 123 Bq kg{sup -1} d.w. and in plants and lichens between 20 and 138 Bq kg{sup -1} d.w. The results showed that soil humus is an important reservoir for {sup 210}Po and {sup 210}Pb and that fauna in close contact with this media may also exhibit elevated levels of {sup 210}Po. Concentration ratios appear to have limited applicability with regards to prediction of activity concentrations of {sup 210}Po in invertebrates and vertebrates. Biokinetic models may provide a tool to explore in a more mechanistic way the behaviour of {sup 210}Po in this system.

  8. Activity of 210Po and 210Pb in the riverine environs of coastal Kerala on the southwest coast of India

    Directory of Open Access Journals (Sweden)

    N. Venunathan

    2016-10-01

    Full Text Available The paper presents the systematic investigations on the activity concentrations of 210Po and 210Pb in the riverine environs of Bharathapuzha, Periyar and Kallada, the three major rivers of coastal Kerala. The radionuclides 210Po and 210Pb in sediment and water samples were separated using radiochemical methods and activity was counted using scintillation based alpha counting system. The mean value of 210Po activity in sediment samples was found to be 3.4 Bq kg−1, 40.0 Bq kg−1 and 22.5 Bq kg−1 in Bharathapuzha, Periyar and Kallada river respectively. The mean value of 210Pb activity was found to be 13.5 Bq kg−1, 88.7 Bq kg−1 and 60.8 Bq kg−1 in the sediment samples of Bharathapuzha, Periyar and Kallada river respectively. The activity ratio 210Po/210Pb shows that the radionuclides 210Po and 210Pb are not in equilibrium in the riverine environs and the accumulation of 210Pb in sediment is greater than that of 210Po. The disequilibrium between 210Po and 210Pb and the higher activity of 210Pb indicates the presence of unsupported 210Pb in the sediments. A significant correlation was observed between the concentrations of these radionuclides and organic matter content and clay minerals of the sediment samples. The low activity of 210Po and 210Pb was observed in the dissolved phase due to the removal of these particle reactive radionuclides from solution to particle. High Kd value for 210Po and 210Pb in water column indicates that there is a strong adsorption of these radionuclides on to the suspended particles in the aquatic environment, where suspended particulate matter acts as a carrier to transport and removal of 210Po and 210Pb from their site of production.

  9. Onderzoek naar de verbetering van de bepaling van 210Po en 210Pb in depositie

    NARCIS (Netherlands)

    Glastra P; LSO

    1998-01-01

    In 1995 is gebleken dat de chemische opbrengst van het als merker toegevoegde 208Po bij de bepaling van 210Po en 210Pb in depositiemonsters vaak minder is dan de vereiste 50%. De oorzaak van de lage chemische opbrengsten is onderzocht. Dit rapport beschrijft de uitvoering van het onderzoek en de

  10. Concentrations of polonium-210 and lead-210 in soil of the Shu river valley

    Directory of Open Access Journals (Sweden)

    Ilona Matveyeva

    2012-03-01

    Full Text Available Radioecological inspection of the Shu river valley is spent. Concentration of polonium-210 in soil makes no more than 33 Bk/kg and lead-210 - no more than 41 Bk/kg. By a method of mathematical modelling it is shown, activity investigated radionuclides in Shu river water during 50 years after pollution does not exceed maximum permissible level.

  11. Enrichment and vertical profiles of 210Po and 210Pb in monazite areas of coastal Karnataka.

    Science.gov (United States)

    Narayana, Y; Prakash, V

    2010-06-01

    A study on radiation level and radionuclide distribution in the environment of coastal Karnataka has revealed the presence of low-level monazite deposit in the Ullal beach area. The paper presents systematic studies on the distribution, enrichment and vertical profiles of (210)Po and (210)Pb, important daughter products of (238)U, in Ombattu Kere, Summer Sand and the Bhagavathi Temple region of the Ullal beach area of coastal Karnataka. Sand samples collected at different depths from these locations were analyzed for (210)Po and (210)Pb activities to understand the distribution, enrichment and vertical profiles of these radionuclides in monazite area. The activity of (210)Po in the Ullal region is found to vary from 1.7 to 43.2 Bq kg(-1) with a mean value of 11.2 Bq kg(-1) and that of (210)Pb varies from 1.0 to 66.7 Bq kg(-1) with a mean value of 19.1 Bq kg(-1). The mean (210)Po/(210)Pb ratio was observed to be 0.6. The absorbed gamma dose rate in the region varies in the range 39-460 nGy h(-1) with a mean value of 193 nGy h(-1).

  12. 210Pb and 210Po determination in environmental samples using liquid scintillation counting and alpha spectrometry

    Science.gov (United States)

    Pérez Sánchez, D.; Martin Sánchez, A.; Jurado Vargas, M.

    2003-01-01

    A simple radiochemical procedure has been developed to determine 210Pb and 210Po in environmental samples from the same matrix. Sediment samples are decomposed by leaching with mineral acids or by microwave digestion, while water samples are pre-concentrated. One part of the resulting solution, spiked with 209Po, is used for 210Po determination by spontaneous deposition onto nickel disks (α-spectrometry). The other part is assayed for 210Pb, separating the Pb either by anion-exchange (sediment samples), or by solvent extraction (water samples). The 210Pb source is finally prepared by precipitation as oxalate and the chemical recovery determined by gravimetry. The 210Pb activity concentration is determined by liquid scintillation. A standard sediment sample supplied by IAEA and spiked water samples were analysed to check the procedure. The 210Pb and 210Po measurements agreed well with the certifications, deviations being less than 10%. The mean recoveries for Pb and Po were (70±12)% and (77±8%) for sediments, and (70±10)% and (81±7)% for waters, respectively.

  13. Distribution of {sup 210}Pb and {sup 210}Po in boreal forest soil

    Energy Technology Data Exchange (ETDEWEB)

    Vaaramaa, Kaisa, E-mail: kaisa.vaaramaa@stuk.fi [Laboratory of Radiochemistry, Department of Chemistry, P.O. Box 55, FIN-00014 University of Helsinki (Finland); Aro, Lasse [Finnish Forest Research Institute (METLA), Parkano Research Unit, Kaironiementie 54, 39700 Parkano (Finland); Solatie, Dina [STUK-Radiation and Nuclear Safety Authority, Regional Laboratory in Northern Finland, Laehteentie 2, 96400 Rovaniemi (Finland); Lehto, Jukka [Laboratory of Radiochemistry, Department of Chemistry, P.O. Box 55, FIN-00014 University of Helsinki (Finland)

    2010-11-15

    Vertical distribution and activity contents of {sup 210}Pb and {sup 210}Po were investigated in forest soils of Scots pine-dominated (Pinus sylvestris L.) stands from seven different locations in Finland. The mean total inventory in the soil profile, up to 20 cm, of {sup 210}Pb was 4.0 kBq m{sup -2} (range 3.1-5.0 kBq m{sup -2}) and {sup 210}Po 5.5 kBq m{sup -2} (range 4.0-7.4 kBq m{sup -2}), the organic soil layer containing 45% of the total inventory of both nuclides. In both the organic and the mineral layers the {sup 210}Po/{sup 210}Pb ratio was close to unity indicating a radioactive equilibrium between them. In the litter layer there was, however, a clear excess of {sup 210}Po suggesting that polonium is recycled via root uptake from the root zone to the ground surface. The activity concentration (Bq kg{sup -1}) of {sup 210}Pb clearly correlated with organic matter and the Fe, Al and Mn concentrations in soil indicating that radioactive lead is associated both with humic substances and the oxides of iron, aluminium and manganese. Radioactive lead was also seen to follow the behavior of stable lead. No systematic correlation between polonium and soil properties was seen.

  14. Radioactive {sup 210}Po in magnesium supplements

    Energy Technology Data Exchange (ETDEWEB)

    Struminska-Parulska, Dagmara Ida [Gdansk Univ. (Poland). Environmental Chemistry and Radiochemistry Chair

    2016-08-01

    The aim of this pioneer study was to determine polonium {sup 210}Po in the most popular magnesium supplements in Poland and estimate the possible related dose assessment to the consumers. The analyzed magnesium pharmaceutics contained organic or inorganic magnesium compounds; some from natural sources. The objectives of this research were to investigate the naturally occurring {sup 210}Po activity concentrations in magnesium supplements, find the correlations between {sup 210}Po concentration in medicament and magnesium chemical form, and calculate the effective radiation dose connected to analyzed magnesium supplement consumption. The highest {sup 210}Po activity concentrations were determined in mineral tablets made from sedimentary rocks, namely dolomite - 3.84 ± 0.15 mBq g{sup -1} (sample Mg17). The highest annual radiation dose from {sup 210}Po taken with 1 tablet of magnesium supplement per day or with 400 mg of pure Mg daily would come from sample Mg17 (dolomite) - 1.35 ± 0.5 and 8.44 ± 0.33 μSv year{sup -1} respectively.

  15. Polonium-210 and lead-210 in the terrestrial environment: a historical review

    Energy Technology Data Exchange (ETDEWEB)

    Persson, Bertil R.R., E-mail: bertil_r.persson@med.lu.s [Dept. of Medical Radiation Physics, Lund University, Barngatan 2, SE-221 85 Lund (Sweden); Holm, Elis [Norwegian Radiation Protection Authority, Osteras (Norway)

    2011-05-15

    The radionuclides {sup 210}Po and {sup 210}Pb widely present in the terrestrial environment are the final long-lived radionuclides in the decay of {sup 238}U in the earth's crust. Their presence in the atmosphere is due to the decay of {sup 222}Rn diffusing from the ground. The range of activity concentrations in ground level air for {sup 210}Po is 0.03-0.3 Bq m{sup -3} and for {sup 210}Pb 0.2-1.5 Bq m{sup -3}. In drinking water from private wells the activity concentration of {sup 210}Po is in the order of 7-48 mBq l{sup -1} and for {sup 210}Pb around 11-40 mBq l{sup -1}. From water works, however, the activity concentration for both {sup 210}Po and {sup 210}Pb is only in the order of 3 mBq l{sup -1}. Mosses, lichens and peat have a high efficiency in capturing {sup 210}Po and {sup 210}Pb from atmospheric fallout and exhibit an inventory of both {sup 210}Po and {sup 210}Pb in the order of 0.5-5 kBq m{sup -2} in mosses and in lichens around 0.6 kBq m{sup -2}. The activity concentrations in lichens lies around 250 Bq kg{sup -1}, dry mass. Reindeer and caribou graze lichen which results in an activity concentration of {sup 210}Po and {sup 210}Pb of about 1-15 Bq kg{sup -1} in meat from these animals. The food chain lichen-reindeer or caribou, and Man constitutes a unique model for studying the uptake and retention of {sup 210}Po and {sup 210}Pb in humans. The effective annual dose due to {sup 210}Po and {sup 210}Pb in people with high consumption of reindeer/caribou meat is estimated to be around 260 and 132 {mu}Sv a{sup -1} respectively. In soils, {sup 210}Po is adsorbed to clay and organic colloids and the activity concentration varies with soil type and also correlates with the amount of atmospheric precipitation. The average activity concentration levels of {sup 210}Po in various soils are in the range of 20-240 Bq kg{sup -1}. Plants become contaminated with radioactive nuclides both by absorption from the soil (supported Po) and by deposition of radioactive

  16. Disequilibria between 210Po and 210Pb in surface waters of the southern South China Sea and their implications

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Activities of the naturally occurring radionuclides, 210Pb and 210Po, were measured in both dissolved (0.45 μm) phases from surface waters of the southern South China Sea. The average activity of particulate 210Pb, 0.23 Bq/m3 (n=23), accounted for about 12% of the total 210Pb, which corresponds with values of open oceans. Particulate 210Po, with an average activity of 0.43 Bq/m3, accounted for about 40% of the total 210Po, which was much higher than those of open and eutrophic oceans. The residence times of total 210Po and 210Pb in surface waters estimated from an irreversible steady-state model were 0.82 a and 1.16 a, respectively. The consistently high fractionation factor calculated either by scavenging rate constants (5.42) or Kd values (6.69) suggested that a significant fractionation occurred between 210Po and 210Pb during their removal from solution to particles and that the two radionuclides had different biogeochemical cycling pathways in the oligotrophic South China Sea. Furthermore, our results indicated that there exist different fractionation mechanisms between 210Po and 210Pb in different marine environments: in eutrophic ocean, plankton detritus and fecal pellets are the main carrier of 210Po and 210Pb, by which 210Po and 210Pb have been scavenged and removed; while in oligotrophic ocean, microbes could become the main carrier of 210Po and fractionate 210Po and 210Pb significantly as a result of scarce plankton detritus and fecal pellets. These results suggest the use of 210Po to trace marine biogeochemical processes relating to microbial activities and the cycling of sulfur group elements (S, Se, Te and Po).

  17. Behavior of 210Po and 210Pb in Shallow Water Region of Mersing Estuary, Johor, Malaysia

    Directory of Open Access Journals (Sweden)

    Noor Affizah Bujang Saili

    2014-06-01

    Full Text Available 210Po and 210Pb activities were determined in dissolved and particulate phases in order to understand the behavior of both natural radionuclides in shallow water regions such as Mersing Estuary. Strong statistical correlations between the distribution coefficient values of polonium and lead in dissolved phases with SPM proved that the natural nuclides of polonium and lead have a high affinity to suspended particle materials in the water column, where the SPM acts as a carrier to transport and remove natural isotopes of polonium and lead from their geochemical behavior. However a low statistical correlation (r=0.414 found between chlorophyll-a with an activity ratio of 210Po/210Pb and SPM implies that the enrichment of 210Po was not associated with the abundance of chlorophyll-a. But a strong correlation between soluble reactive phosphorus (SRP and 210Po in the dissolved phase proved that the contribution of phosphate element as catalysis increasing the activity levels of 210Po at coastal waters.

  18. Atmospheric fluxes and geochemistries of stable Pb, Pb-210, and Po-210 in Crystal Lake, Wisconsin

    Energy Technology Data Exchange (ETDEWEB)

    Talbot, R.W.

    1981-01-01

    In a lake system where atmospheric input greatly exceeds all other source inputs, the atmospheric supply, water column transport, and sediment accumulation should be coupled. This research examined the exchange of lead between these metal compartments. The approach was to use Pb-210 as a natural tracer to provide experimental evidence concerning the movement of lead between various compartments linking the geochemical regime of lead in an integrated lake system. This research was conducted in Crystal Lake, Wisconsin, an oligotrophic, non-calcareous, seepage lake. The atmosphere serves as the principal route for transport of material to the lake. Stable Pb concentrations in the water column are of the order of 200 mg kg/sup -1/. At least 85% of the atmospheric input of Pb and Pb-210 to Crystal Lake occurs via wet deposition. More than 805 of the Pb entering the lake appears to be derived from anthropogenic Pb has resulted in an 8-fold increase in sediment Pb concentrations from 19 ..mu..g g/sup -1/ to 145 ..mu..g g/sup -1/ over the past 150 years. The net removal of Pb-210 from the water column occurred primarily as short-term deposition events. Deposition of Pb-210 was enhanced by elevated biological activity during bloom periods. Accelerated deposition of Pb-210 was also observed during fall turnover. At least 90% of the standing crop of Po-210 in Crystal Lake is formed in-situ by decay of atmospherically suppled Pb-210.

  19. Seasonal variations of residence time and upper atmospheric contribution of aerosols studied with Pb-210, Bi-210, Po-210 and Be-7

    Science.gov (United States)

    Tokieda, Takayuki; Yamanaka, Kenji; Harada, Koh; Tsunogai, Shizuo

    1996-11-01

    All daily precipitation samples amounting to 196 in total were collected during the period from January 1990 to June 1991 at a station in Hakodate, Japan, and precisely analyzed for radon daughters, Pb-210, Bi-210 and Po-210. The samples collected after July 1990 were also determined for Be-7. The mean concentration and deposition rate of Pb-210 in 1990 were 0.20 Bq/1 as a mean and 288 Bq/m2/ yr, respectively, and they were a few times greater in winter due to the northwest winter monsoon. The total mean activity ratios with 95% confidence limits were 0.467±0.024 and 0.0624±0.0133 for Bi-210/Pb-210 and Po-210/Pb-210, respectively. The residence time of aerosols calculated from the Po-210/Pb-210 ratio was always longer than that calculated from the Bi-210/Pb-210 ratio. The difference is chiefly due to old aerosols derived from the upper atmosphere (probably the stratosphere), of which contribution for Pb-210 has been estimated to be 6% as a mean, or 12% in spring and 2% in early winter. Subtracting the upper atmospheric component, we have obtained the residence time of tropospheric aerosols carrying Pb-210 to be 4.8±0.3days for a whole year or 5.9±0.7days and 3.6±0.5days for the periods from February to April and from May to June, respectively. The deposition rate of Be-7 was correlated well with the upper atmospheric component of Pb-210. The larger deposition rate of Be-7 suggests that the study area is extremely effective for the removal of aerosols of stratospheric origin.

  20. Seasonal variations of residence time and upper atmospheric contribution of aerosols studied with Pb-210, Bi-210, Po-210 and Be-7

    Energy Technology Data Exchange (ETDEWEB)

    Tokieda, Takayuki; Yamanaka, Kenji; Harada, Koh; Tsunogai, Shizuo [Hokkaido Univ., Hakodate (Japan). Dept. of Chemistry

    1996-11-01

    All daily precipitation samples amounting to 196 in total were collected during the period from January 1990 to June 1991 at a station in Hakodate, Japan, and precisely analyzed for radon daughters, Pb-210, Bi-210 and Po-210. The samples collected after July 1990 were also determined for Be-7. The mean concentration and deposition rate of Pb-210 in 1990 were 0.20 Bq/l as a mean and 288 Bq/m{sup 2}/yr, respectively, and they were a few times greater in winter due to the northwest winter monsoon. The total mean activity ratios with 95% confidence limits were 0.467{+-}0.024 and 0.0624{+-}0.0133 for Bi-210/Pb-210 and Po-210/Pb-210, respectively. The residence time of aerosols calculated from the Po-210/Pb-210 ratio was always longer than that calculated from the Bi-210/Pb-210 ratio. The difference is chiefly due to old aerosols derived from the upper atmosphere (probably the stratosphere), of which contribution for Pb-210 has been estimated to be 6% as a mean, or 12% in spring and 2% in early winter. Subtracting the upper atmospheric component, we have obtained the residence time of tropospheric aerosols carrying Pb-210 to be 4.8{+-}0.3 days for a whole year or 5.9{+-}0.7 days and 3.6{+-}0.5 days for the periods from February to April and from May to June, respectively. The deposition rate of Be-7 was correlated well with the upper atmospheric component of Pb-210. The larger deposition rate of Be-7 suggests that the study area is extremely effective for the removal of aerosols of stratospheric origin. 36 refs, 7 figs, 3 tabs

  1. 7 CFR 1160.210 - Expenses.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE FLUID MILK PROMOTION PROGRAM Fluid Milk Promotion Order National Fluid Milk Processor Promotion Board § 1160.210 Expenses. (a) The Board is authorized to...

  2. 40 CFR 761.210 - Manifest discrepancies.

    Science.gov (United States)

    2010-07-01

    ... PROHIBITIONS PCB Waste Disposal Records and Reports § 761.210 Manifest discrepancies. (a) Manifest discrepancies are differences between the quantity or type of PCB waste designated on the manifest or shipping paper and the quantity or type of PCB waste actually delivered to and received by a designated facility...

  3. 27 CFR 9.210 - Lehigh Valley.

    Science.gov (United States)

    2010-04-01

    ... Section 9.210 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT...), Pennsylvania, 1979; (4) Carbon County, Pennsylvania, 1991; (5) Monroe County, Pennsylvania, 1980; (6... Valley viticultural area is located in portions of Lehigh, Northampton, Berks, Schuylkill, Carbon,...

  4. 5 CFR 551.210 - Computer employees.

    Science.gov (United States)

    2010-01-01

    ....210 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... the aforementioned duties, the performance of which requires the same level of skills. (c) Computer... customers. Similarly, a senior or lead computer programmer who manages the work of two or more other...

  5. Reference: 210 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 210 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15894610i Nelissen Hilde et al. 2005 May. Pro...c. Natl. Acad. Sci. U.S.A. 102(21):7754-9. The key enzyme for transcription of prot

  6. 7 CFR 1709.210 - Application process.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE ASSISTANCE TO HIGH ENERGY COST COMMUNITIES Bulk Fuel Revolving Fund Grant Program § 1709.210... proposal and required elements. Each grant application must include a narrative proposal describing the project and addressing the following elements. The form, contents, and order of the narrative...

  7. 48 CFR 210.001 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE ACQUISITION PLANNING MARKET RESEARCH 210.001 Policy. (a) In addition to the requirements of FAR 10.001(a), agencies shall— (i) Conduct market research appropriate to the circumstances before— (A... 109-163); and (ii) Use the results of market research to determine— (A) Whether consolidation...

  8. 5 CFR 430.210 - OPM responsibilities.

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.210 OPM responsibilities. (a) OPM shall review and approve an agency's performance appraisal system(s). (b) OPM may evaluate the operation and application of an agency's performance appraisal system(s)...

  9. (7)Be, (210)Pb, and (210)Po in the surface air from the Arctic to Antarctica.

    Science.gov (United States)

    Persson, Bertil R R; Holm, Elis

    2014-12-01

    In the present study we have investigated the activity concentrations of (210)Pb, (210)Po as well as (7)Be in surface air of the North and South Atlantic (1988-1989), the Arctic Ocean (1991), and along the coastline of Siberia (1994) during succeeding expeditions in the Swedish Polar Research program. During the cruises in the Arctic Ocean during 1991-07-28 to 1991-10-04 the average air concentrations of (7)Be was 0.6 ± 0.4 mBq/m(3), (210)Pb 40 ± 4 μBq/m(3) and (210)Po-38 ± 10 μBq/m(3). During the Swedish-Russian Tundra Ecology-94 expedition along the Siberian coastline the average air concentrations of (7)Be and (210)Pb measured during May-July were 11 ± 3, and 2.4 ± 0.4 mBq/m(3), and during July-September they were 7.2 ± 2 and 2.7 ± 1.1 mBq/m(3) respectively. The results from measurements of the activity concentration of (210)Pb in the air over the Arctic Ocean vary between 75 and 176 μBq/m(3). In the air close to land masses, however, the activity concentration of (210)Pb in the air increases to 269-2712 μBq/m(3). The activity concentration of (7)Be in the South Atlantic during the cruise down to Antarctica varied between 1.3 and 1.7 with an average of 1.5 ± 0.8 mBq/m(3). The activity concentration of (210)Pb in the South Atlantic down to Antarctica varied between 6 and 14 μBq/m(3). At the Equator the activity concentration recorded in November 1988 was 630 μBq/m(3) and in April 1989 it was 260 μBq/m(3). The average activity concentration of (210)Pb during the route Gothenburg-Montevideo in 1988 was 290 and on the return Montevideo-Gothenburg it was 230 μBq/m(3). The activity concentration of (210)Po in the South Atlantic down to Antarctica varied between 15 and 58 μBq/m(3). At the Equator the activity concentration in November 1988 was 170 and in April 1989 it was 70 μBq/m(3). The average activity concentration of (210)Po during the route Gothenburg-Montevideo in 1988 was 63 and on the return Montevideo

  10. Levels and transfer of 210Po and 210Pb in Nordic terrestrial ecosystems

    DEFF Research Database (Denmark)

    Brown, J.E.; Gjelsvik, R.; Roos, Per

    2011-01-01

    Recent developments regarding environmental impact assessment methodologies for radioactivity have precipitated the need for information on levels of naturally occurring radionuclides within and transfer to wild flora and fauna. The objectives of this study were therefore to determine activity...... of 210Po in invertebrates and vertebrates. Biokinetic models may provide a tool to explore in a more mechanistic way the behaviour of 210Po in this system....

  11. Distribution of 7Be, 210Pb and 210Po in Size Fractionated Aerosols From Northern Taiwan

    Science.gov (United States)

    Su, C.; Huh, C.

    2003-12-01

    The partition of 7Be, 210Pb and 210Po in size fractionated aerosols was studied using samples collected from Nankang (northern Taiwan) during July 2002-July 2003. A TSP air sampler coupled to a 6-stage cascade impactor was used to collect large-volume samples and separate the aerosols into six size classes with the cut-off points at 7.2 μ m, 3 μ m, 1.5 μ m, 0.95 μ m and 0.49 μ m. The total mass concentrations of the aerosol samples ranged from 23 to 99 μ g m-3, with a maximum (18-50 %) falling at the sixth stage (size of aerosol particles and the height of cloud are the major factors controlling the deposition velocity of 7Be and 210Pb. The time series of 210Po/210Pb was in phase with that of 7Be/210Pb and showed an increase during the spring and summer, probably reflecting stratospheric folding in the spring and more vigorous tropospheric mixing (e.g., due to typhoons) in the summer.

  12. Technologically enhanced 210Pb and 210Po in iron and steel industry.

    Science.gov (United States)

    Khater, Ashraf E M; Bakr, Wafaa F

    2011-05-01

    Iron and steel manufacture has been ranked as the largest industrial source of environmental contamination in the USA; the wastes generated in their production processes contain heavy elements that can be a source of contamination, and natural radionuclides that can produce an occupational and/or public radiological impact. In this work the potential occupational effective dose rate (μSv/y) due to inhalation in four integrated steel-making factories from Egypt has been evaluated, by assuming a well defined scenario and with basis in the (210)Pb and (210)Po activity concentrations determined in ore and wastes collected in the aforementioned factories. Activity concentrations, in Bq/kg, of (210)Pb and (210)Po, and leachable Pb and Fe were measured using gamma-ray spectrometry based on HPGe detector, alpha particle spectrometry based on PIPS detector, and inductively coupled plasma-mass spectrometry (ICP-MS). Levels of (210)Pb and (210)Po in the range of

  13. Hair and feathers as indicator of internal contamination of 210Po and 210Pb

    Energy Technology Data Exchange (ETDEWEB)

    Holm, E. (ed.); Gwynn, J.; Zaborska, A.; Gaefvert, T. (Norwegian Radiation Protection Authority (Norway)); Roos, P. (Technical Univ. of Denmark, Risoe National Lab. for Sustainable Energy, Roskilde (Denmark)); Henricsson, F. (Lund Univ., Lund (Sweden))

    2010-03-15

    The activities of the NKS-B HAIRPOL project is summarised in this report. The objective was to investigate if hair and feathers were suitable matrices for the estimation of the intake of 210Po. Human hair from people of different sex and age was analysed for 210Po showing concentrations between 0.4 to 11 Bq/kg dry weight. Samples from horses, mane, fur and tail showed concentration from 6 to 17 Bq/kg with no significant difference between the different sample types. Musk ox from Greenland showed much higher concentrations since the animal has to graze a large surface. In fur the concentration was 260 Bq/kg. A considerable fraction of the total 210Po in this animal is contained in the hair. Also different organs were analysed and the highest concentration was found in kidney, 2 700 Bq/kg. The 210Pb concentration in hair was estimated to about 20 Bq/kg. Three different seabirds from Svalbard were analysed. Feathers from all three seabird species show increasing activity concentrations of 210Po and 210Pb from the base to the tip of the feather, but it was difficult to relate feather concentrations to muscle concentrations due to a number of complicating factors. (author)

  14. Separation of 210Pb, 210Bi and 210Po by ion exchange and their Iiquid scintillation standardization; Separacion del 210Pb, 210Bi y 2I0Po mediante columna de cambio ionico y su calibracion por centelleo liquido

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, L.; Jimenez, A.; Grau, A.

    1996-07-01

    We applied the CIEMAT/NIST method and alpha/beta discrimination to ''210Pb samples in equilibrium with its daughters, by preparing homogeneous and gel samples. The stability of samples was tested in different available cocktails, HiSafe''TM II, HiSafe''TM III, Ultima-Gold''TM, Ultima-Gold''TM XR, Ultima-Gold''TM AB, Insta-Gel''R and e Insta-Gel''R lI. Also we analyzed the disequilibrium of the radioactive chain 210Pb+210Bi+210Po, achieving an excellent agreement between the results of the spectrum unfolding method and the experimental values. (Author) 13 refs.

  15. 42 CFR 403.210 - NAIC model standards.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false NAIC model standards. 403.210 Section 403.210 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS SPECIAL PROGRAMS AND PROJECTS Medicare Supplemental Policies General Provisions § 403.210...

  16. 42 CFR 59.210 - Inventions or discoveries.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Inventions or discoveries. 59.210 Section 59.210... PLANNING SERVICES Grants for Family Planning Service Training § 59.210 Inventions or discoveries. Any grant.... Appropriate measures shall be taken by the grantee and by the Secretary to assure that no contracts...

  17. 20 CFR 210.2 - Definition of service.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Definition of service. 210.2 Section 210.2... RAILROAD SERVICE § 210.2 Definition of service. Service means a period of time for which an employee... an employee for creditable military service as defined in part 212 of this chapter. Service...

  18. 12 CFR 741.210 - Central liquidity facility.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Central liquidity facility. 741.210 Section 741.210 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS... Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.210 Central...

  19. 24 CFR 266.210 - HUD-retained review functions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false HUD-retained review functions. 266.210 Section 266.210 Housing and Urban Development Regulations Relating to Housing and Urban... Program Requirements § 266.210 HUD-retained review functions. Certain functions are retained by...

  20. 5 CFR 630.210 - Uncommon tours of duty.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Uncommon tours of duty. 630.210 Section 630.210 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ABSENCE AND LEAVE Definitions and General Provisions for Annual and Sick Leave § 630.210 Uncommon tours of duty. (a...

  1. 30 CFR 75.210 - Manual installation of temporary support.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Manual installation of temporary support. 75.210 Section 75.210 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.210...

  2. A record of atmospheric Pb-210 deposition in The Netherlands

    NARCIS (Netherlands)

    Beks, J.P.; Eisma, D.; Van Der Plicht, J.

    1998-01-01

    The deposition flux of total atmospheric 210Pb has been measured at two sites in The Netherlands: Texel from 1992 to 1996 and Groningen from 1989 to 1994. With predominant westerly oceanic winds, the annual 210Pb deposition is relatively low as 222Rn, the source for atmospheric 210Pb, is mainly exha

  3. 17 CFR 210.9-03 - Balance sheets.

    Science.gov (United States)

    2010-04-01

    ... 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Bank Holding Companies § 210.9-03 Balance sheets... amount of total loans in each of the following categories: (1) Commercial, financial and agricultural (2.... See § 210.5-02.28. Common Stocks 20. Common stocks. See § 210.5-02.29. Other Stockholders' Equity...

  4. 19 CFR 210.49 - Implementation of Commission action.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Implementation of Commission action. 210.49 Section 210.49 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR... order or an arbitration agreement pursuant to § 210.21(b), (c) or (d), respectively, shall be served...

  5. 17 CFR 210.11-03 - Presentation of financial forecast.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Presentation of financial forecast. 210.11-03 Section 210.11-03 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Information § 210.11-03 Presentation of financial forecast. (a) A financial forecast may be filed in lieu...

  6. 42 CFR 457.210 - Deferral of claims for FFP.

    Science.gov (United States)

    2010-10-01

    ... reconsideration in accordance with 45 CFR part 16. ... 42 Public Health 4 2010-10-01 2010-10-01 false Deferral of claims for FFP. 457.210 Section 457.210...; Reduction of Federal Medical Payments § 457.210 Deferral of claims for FFP. (a) Requirements for...

  7. 7 CFR 210.16 - Food service management companies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Food service management companies. 210.16 Section 210... Authority Participation § 210.16 Food service management companies. (a) General. Any school food authority... management company to manage its food service operation in one or more of its schools. However, no school or...

  8. 9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...

  9. 29 CFR 2.10 - Scope and purpose.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Scope and purpose. 2.10 Section 2.10 Labor Office of the Secretary of Labor GENERAL REGULATIONS Audiovisual Coverage of Administrative Hearings § 2.10 Scope and purpose. This subpart defines the scope of audiovisual coverage of departmental administrative...

  10. 42 CFR 422.210 - Assurances to CMS.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Assurances to CMS. 422.210 Section 422.210 Public...) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Relationships With Providers § 422.210 Assurances to CMS. (a) Assurances to CMS. Each organization will provide assurance satisfactory to the Secretary that...

  11. 19 CFR 210.52 - Motions for temporary relief.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Motions for temporary relief. 210.52 Section 210... IMPORT TRADE ADJUDICATION AND ENFORCEMENT Temporary Relief § 210.52 Motions for temporary relief. Requests for temporary relief under section 337 (e) or (f) of the Tariff Act of 1930 shall be made through...

  12. Trace metals and {sup 210}Po ({sup 210}Pb) concentrations in mussels (Mytilus galloprovincialis) consumed at western Anatolia

    Energy Technology Data Exchange (ETDEWEB)

    Ugur, Aysun E-mail: aysun@bornova.ege.edu.tr; Yener, G.Guengoer; Bassari, Asiye

    2002-10-01

    The mussels (Mytilus galloprovincialis) have been evaluated for their bioavailability as biomonitors of trace and toxic elements in coastal water of western Anatolia. The levels of Fe, Cu, Zn, Pb, Br and Sr in the edible part of mussels were determined using X-ray fluorescence method during the period of September 1999-July 2000. Distribution of {sup 210}Po and {sup 210}Pb activities were measured by radiometric methods and their ratios were calculated. The activity concentrations of {sup 210}Po and {sup 210}Pb were found to vary between 52{+-}6-1344{+-}108 and 6{+-}2-167{+-}10 Bq kg{sup -1} dry wt, respectively. The highest values for {sup 210}Po and {sup 210}Pb were measured in Foca mussels and also observed the highest Fe, Zn and Br concentrations in the same species. {sup 210}Po/{sup 210}Pb activity ratio were derived as between 3.1 and 25.0.

  13. Atmospheric environment for ASTP (SA-210) launch

    Science.gov (United States)

    Johnson, D. L.

    1976-01-01

    A summary is presented of selected atmospheric conditions observed near ASTP/SA-210 launch time on July 15, 1975, at Kennedy Space Center, Florida. Values of ambient pressure, temperature, moisture, ground winds, visual observations (cloud), density, index of refraction, and wind/wind shear aloft are included. A final meteorological data tape for the ASTP launch, consisting of wind and thermodynamic parameters versus altitude, has been constructed.

  14. Distribution of {sup 210}Pb and {sup 210}Po concentrations in wild berries and mushrooms in boreal forest ecosystems

    Energy Technology Data Exchange (ETDEWEB)

    Vaaramaa, Kaisa, E-mail: Kaisa.Vaaramaa@Helsinki.fi [Laboratory of Radiochemistry, Department of Chemistry, P.O. Box 55, FI-00014 University of Helsinki (Finland); Solatie, Dina [STUK-Radiation and Nuclear Safety Authority, Regional Laboratory in Northern Finland, FI-96500 Rovaniemi (Finland); Aro, Lasse [Finnish Forest Research Institute (METLA), Parkano Research Unit, FI-39700 Parkano (Finland)

    2009-12-15

    The activity concentrations and distribution of {sup 210}Pb and {sup 210}Po in wild berries and edible mushrooms were investigated in Finnish forests. The main study areas were located in Scots pine (Pinus sylvestris L.) forests in southern and northern Finland. The activity concentrations of {sup 210}Pb and {sup 210}Po in blueberry (Vaccinium myrtillus L.) and lingonberry (Vaccinium vitis-idaea L.) samples decreased in the order: stems > leaves > berries (i.e. fruits). The activity ratios of {sup 210}Po/{sup 210}Pb in the wild berry samples were mainly higher than one, indicating elevated activity concentrations of polonium in the samples. In mushrooms the activity concentrations of {sup 210}Pb and especially {sup 210}Po were higher than in fruits of the wild berries. The highest activity concentration of {sup 210}Pb was detected in Cortinarius armillatus L. (16.2 Bq kg{sup -1} d.w.) and the lowest in Leccinum vulpinum L. (1.38 Bq kg{sup -1} d.w.). The {sup 210}Po activity concentrations of the whole fruiting bodies ranged from 7.14 Bq kg{sup -1} d.w. (Russula paludosa L.) to 1174 Bq kg{sup -1} d.w. (L. vulpinum L.). In general, the highest activity concentrations of {sup 210}Po were recorded in boletes. The caps of mushrooms of the Boletaceae family showed higher activity concentrations of {sup 210}Po compared to the stipes. In most of the mushrooms analyzed, the activity concentrations of {sup 210}Po were higher than those of {sup 210}Pb. {sup 210}Po and {sup 210}Pb dominate the radiation doses received via ingestion of wild berries and mushrooms in northern Finland, while in southern Finland the ingested dose is dominated by {sup 137}Cs from the Chernobyl fallout.

  15. Assessment of soil contamination by (210)Po and (210)Pb around heavy oil and natural gas fired power plants.

    Science.gov (United States)

    Al-Masri, M S; Haddad, Kh; Doubal, A W; Awad, I; Al-Khatib, Y

    2014-06-01

    Soil contamination by (210)Pb and (210)Po around heavy oil and natural gas power plants has been investigated; fly and bottom ash containing enhanced levels of (210)Pb and (210)Po were found to be the main source of surface soil contamination. The results showed that (210)Pb and (210)Po in fly-ash (economizer, superheater) is highly enriched with (210)Pb and (210)Po, while bottom-ash (boiler) is depleted. The highest (210)Pb and (210)Po activity concentrations were found to be in economizer ash, whereas the lowest activity concentration was in the recirculator ash. On the other hand, (210)Pb and (210)Po activity concentrations in soil samples were found to be higher inside the plant site area than those samples collected from surrounding areas. The highest levels were found in the vicinity of Mhardeh and Tishreen power plants; both plants are operated by heavy oil and natural fuels, while the lowest values were found to be in those samples collected from Nasrieh power plant, which is only operated by one type of fuel, viz. natural gas. In addition, the levels of surface soil contamination have decreased as the distance from the power plant site center increased.

  16. Atmospheric fluxes and geochemistries of stable PB, PB-210, and PO-210 in Crystal Lake, Wisconsin

    Energy Technology Data Exchange (ETDEWEB)

    Talbot, R.W.

    1981-01-01

    In a lake system where atmospheric input greatly exceeds all other source inputs, the atmospheric supply, water column transport, and sediment accumulation should be coupled. This research examined the exchange of lead between these metal compartments. The approach was to use Pb-210 as a natural tracer to provide experimental evidence concerning the movement of lead between various compartments linking the geochemical regime of lead in an integrated lake system. This research was conducted in Crystal Lake, Wisconsin, an oligotrophic, non-calcareous, seepage lake. The lake has a surface area of 31 ha and a maximum depth of 21m. Crystal Lake is located in a semi-remote, heavily forested area of north central Wisconsin. The atmosphere serves as the principal route for transport of material to the lake. Stable Pb concentrations in the water column are of the order of 200 ng kg/sup -1/. At least 85% of the atmospheric input of Pb and Pb-210 to Crystal Lake occurs via wet deposition. More than 80% of the Pb entering the lake appears to be derived from anthropogenic sources. This input of anthropogenic Pb has resulted in an 8-fold increase in sediment Pb concentrations from 19 ..mu..g g/sup -1/ to 145 ..mu..g g/sup -1/ over the past 150 years. The net removal of Pb-210 from the water column occurred primarily as short-term deposition events. Deposition of Pb-210 was enhanced by elevated biological activity during bloom periods. Accelerated deposition of Pb-210 was also observed during fall turnover. The rate of deposition during these events exceeded the annual mean rate of 1.81 dpm cm/sup -2/y/sup -1/ by 2 to 3-fold. Over the whole year the rate of Pb-210 deposition varied by as much as an order of magnitude. Deposition of Pb-210 was most rapid during the productive stratified period averaging 2.09 dpm cm/sup -2/y/sup -1/. At least 90% of the standing crop of Po-210 in Crystal Lake is formed in-situ by decay of atmospherically supplied Pb-210.

  17. Dissolved {sup 210}Po and {sup 210}Pb in Guarani aquifer groundwater, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Bonotto, D.M. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), Av. 24-A No. 1515, C.P. 178, CEP 13506-900 Rio Claro, Sao Paulo (Brazil)], E-mail: danielbonotto@yahoo.com.br; Caprioglio, L.; Bueno, T.O.; Lazarindo, J.R. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), Av. 24-A No. 1515, C.P. 178, CEP 13506-900 Rio Claro, Sao Paulo (Brazil)

    2009-03-15

    The huge Guarani aquifer located in the South American continent is a very important resource for the region, and its drinking water quality has been investigated according to international standards, inclusive radiological parameters. This paper describes {sup 210}Po and {sup 210}Pb activity concentration data in groundwater samples collected at the Brazilian portion of Guarani aquifer, that is characterized by a great variability of temperature (18-70 deg. C), pH (4.0-9.9), sodium content (0.3-322 mg/l), bicarbonate content (0.1-318 mg/l), etc. Non-expensive alpha counting following some radiochemical steps for extracting and depositing dissolved {sup 210}Po was used. The results of the measurements for samples collected in duplicate yielded a maximum {sup 210}Po activity concentration of 3.7 mBq/L and a maximum {sup 210}Pb activity concentration of 6.7 mBq/l, that are values greatly lower than the guidance level of 0.1 Bq/l established by the WHO for their presence in drinking water. The high sensitivity of the method allowed its applicability on the identification of complexes geochemical and hydrogeological processes occurring in Guarani aquifer as well on the evaluation of the drinking water quality in terms of dose calculations.

  18. 环境水中210Pb、210Po快速联测方法及应用%A combined method for the determination of 210pb and 210po in environmental water samples

    Institute of Scientific and Technical Information of China (English)

    覃连敬; 李美丽; 覃浩

    2016-01-01

    本文对210pb、210po快速联测方法作了深入研究,确定了适用于环境水样中210pb、210po联测的最优实验条件.在未经萃取分离情况下,以坑坏血酸+盐酸羟胺混合体系作还原剂,当盐酸浓度为0.5 mol·L-1,沉积时间为2h,沉积温度为90℃,溶液体积为50 mL时,210Bi、210po可同时自发沉积在铜片上.利用在同一衰变链上活度最终平衡的特点,通过测量210Bi计数计算得到水中210pb的活度,然后通过209 Po示踪α能谱法求得水中210po的活度.方法精密度优于10%,加标回收率在95.3%-107.6%,210pb、210po探测限分别达到1.2 mBq· L-1和0.15 mBq·L-1.利用该联测方法对粤北矿山地区环境水样进行了分析,结果表明,饮用水中210pb、210po活度浓度范围分别为(2.4-38.7) mBq·L-1和(1.0-4.1)mBq·L-1;河溪水中210pb、210Po活度浓度范围分别为(4.3-181.5) mBq·L-1和(0.7-23.3) mBq·L-1.%The optimum measurement conditions were investigated and it was found that 210Bi and 210Po were deposited on copper sheet simultaneously and spontaneously under the conditions of 0.5 mol·L-1 HCl at 90 ℃ for 2 hours,with ascorbic acid and hydroxylamine hydrochloride mixed system as reducing agents,in a total of 50 mL solution without extraction separation.By using 210Bi and 210po equilibrium in radioactive decay chain,the activity of 210Pb was measured based on β counting of 210Bi,and then the activity of 210Po was determined by alpha spectrometry with 209po as a yield-tracing isotope.The relative deviation of duplicate analysis was less than 10% with the recovery of standard addition between 95.3% and 107.6% for the two nuclides,and the detection limits were 1.2 mBq· L-1 and 0.15 mBq·L-1 for 210Pb and 210Po,respectively.The method was used for the measurement of 210Pb and 210Po in the environmental water samples from uranium mining area of northern Guangdong Province,China.The results showed that the activities of 210Pb and 210po in drinking

  19. Scavenging and fractionation of particle-reactive radioisotopes 7Be, 210Pb and 210Po in the atmosphere

    Science.gov (United States)

    Chen, Jinfang; Luo, Shangde; Huang, Yipu

    2016-09-01

    The scavenging and fractionation of 7Be, 210Pb, and 210Po in the atmosphere are investigated by measuring their activities in rainwater collected from 68 rain events during March 2004 to April 2006 at a coastal station of Xiamen, southeastern China. In addition to documenting the large temporal variations in activities, fluxes, and isotope ratios of 7Be, 210Pb and 210Po in rainwater and the role of rainfall intensity in radionuclide scavenging, our results show that an enhanced deposition of 7Be and 210Pb occurs in the spring than in other seasons and is attributed to the "funnel effect" due to the increased atmospheric vertical convective mixing in the spring. This latter hypothesis is further supported by the observed seasonal and inter-annual variations in 7Be/210Pb and 210Po/210Pb ratios showing that the weakening of vertical convective mixing or stratosphere-troposphere exchange (STE) at the study site is linked with the enhancement of summer monsoons. It appears that the rainfall intensity, in connection with the vertical (e.g., STE) and horizontal (summer monsoons) air transport, exerts an important control on the activities, fluxes, and isotope ratios of 7Be, 210Pb, and 210Po in the atmosphere. Application of the observational data to a theoretical model shows that there are significant fractionations among 7Be, 210Pb, and 210Po in the atmosphere, with the scavenging rate constant or reciprocal of the residence time of radionuclide in the atmosphere being 210Pb > 7Be > 210Po. A revised Poet et al. (1972)'s method is proposed for quantitative constraint on the scavenging behavior of radionuclide, aerosols, and aerosol-associated trace pollutants in the atmosphere.

  20. Comparative uptake of thorium-230, radium-226, lead-210 and polonium-210 by plants

    Energy Technology Data Exchange (ETDEWEB)

    D' Souza, T.J.; Mistry, K.B.

    1970-01-01

    The entry and translocation of /sup 230/thorium, /sup 226/radium, /sup 210/lead, and /sup 210/polonium were examined in nutrient culture experiments. Strontium-89 was included for comparison. Red kidney beans (Phaseolus vulgaris L.) were treated for a period of 15 days. Results indicate that accumulation of /sup 230/thorium, /sup 210/lead and /sup 210/polonium occurs predominantly in roots and only very small amounts of these nuclides are translocated to shoots. Over comparable periods, the accumulation of /sup 226/radium in roots is 2-3 times lower than that of the other nuclides of uranium series. However, the most significant difference between /sup 226/radium and other nuclides is in the extent of their upward transport which for radium is 50-200 times greater. The amount of radium translocated to shoots is comparable to that of strontium. The present evidence of rapid transfer of /sup 226/radium to shoots suggests that among the nuclides examined, /sup 226/radium is likely to make the major contribution to radioactivity in aerial tissues of plants grown under conditions where root absorption is the principal route of entry of the nuclides.

  1. 农业科学(210-240) 210农学

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    05100001 210·20农业基础学科洪水灾情评价的遗传程序设计方法=Genetic programming method for evaluation of flood disaster loss[刊,中],05100002 210·20灰色关联分析用于稻米品质综合评价的改进=Application of revised gray rela-tional analysis in comprehensive evaluation of rice quality[刊,中],05100003 210·20基于GIS的松嫩平原农业干旱敏感性分析=The study on the susceptibility of agricultural drought hazard in Songnen plain based on GIS[刊,中],05100004 210·20计算机辅助设计技术在大田棉花喷灌设计中的应用=Application of computer aided design(CAD)technique on sprinkling irrigation designing in the land for growing cotton[刊,中]……

  2. 210Po and 210Pb Activity Concentrations in Cigarettes Produced in Vietnam and Their Estimated Dose Contribution Due to Smoking

    Science.gov (United States)

    Tran, Thuy-Ngan N.; Le, Cong-Hao; Chau, Van-Tao

    Smoking cigarettes contributes significantly to the increase of radiation in human body because 210Po and 210Pb exist relatively high in tobacco leaves. Therefore, these two radioisotopes in eighteen of the most frequently sold cigarette brands produced in Vietnam were examined in this study. 210Po was determined by alpha spectroscopy using a passivated implanted planar silicon (PIPS) detector after a procedure including radiochemical separation and spontaneous deposition of polonium on a copper disc (the deposition efficiency of 210Po on a copper disc was approximately 94%). Sequentially, 210Pb was determined through the ingrowth of 210Po after storing the sample solutions for approximately six months. The activity concentrations of 210Po in cigarettes ranged from 13.8 to 82.6 mBq/cigarette (the mean value was 26.4 mBq/cigarette) and the activity concentrations of 210Pb in cigarettes ranged from 13.9 to 78.8 mBq/cigarette (the mean value was 25.8 mBq/cigarette). The annual committed effective dose for smokers who smoke one pack per day was also estimated to be 295.4 µSv/year (223.0 µSv/year and 72.4 µSv/year from 210Po and 210Pb, respectively). These indicated that smoking increased the risk of developing lung cancer was approximately 60 times greater for smokers than for non-smokers.

  3. Polonium ({sup 210}Po) and lead ({sup 210}Pb) in marine organisms and their transfer in marine food chains

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Fernando P., E-mail: carvalho@itn.p [Instituto Tecnologico e Nuclear, Departamento de Proteccao Radiologica e Seguranca Nuclear, E.N. 10, 2686-953 Sacavem (Portugal)

    2011-05-15

    The determination of {sup 210}Po and {sup 210}Pb was performed in marine organisms from the seashore to abyssal depths, encompassing a plethora of species from the microscopic plankton to the sperm whale. Concentrations of those radionuclides ranged from low values of about 5 x 10{sup -1} Bq kg{sup -1} (wet wt.) in jellyfish, to very high values of about of 3 x 10{sup 4} Bq kg{sup -1} (wet wt.) in the gut walls of sardines, with a common pattern of {sup 210}Po > {sup 210}Pb.These radionuclides are primarily absorbed from water and concentrated by phyto- and microzooplankton, and then are transferred to the next trophic level along marine food chains. Investigation in epipelagic, mesopelagic, bathypelagic and abyssobenthic organisms revealed that {sup 210}Po is transferred in the marine food webs with transfer factors ranging from 0.1 to 0.7, and numerically similar to those of the energy transfer in the marine food chains. As {sup 210}Po preferentially binds to amino acids and proteins, its transfer in food chains likely traces protein transfer and, thus, {sup 210}Po transfer factors are similar to ecotrophic coefficients. {sup 210}Pb is transferred less efficiently in marine food chains and this contributes to increased {sup 210}Po:{sup 210}Pb activity ratios in some trophic levels.

  4. Polonium (210Po) and lead (210Pb) in marine organisms and their transfer in marine food chains.

    Science.gov (United States)

    Carvalho, Fernando P

    2011-05-01

    The determination of (210)Po and (210)Pb was performed in marine organisms from the seashore to abyssal depths, encompassing a plethora of species from the microscopic plankton to the sperm whale. Concentrations of those radionuclides ranged from low values of about 5 × 10(-1) Bq kg(-1) (wet wt.) in jellyfish, to very high values of about of 3 × 10(4) Bq kg(-1) (wet wt.) in the gut walls of sardines, with a common pattern of (210)Po > (210)Pb.These radionuclides are primarily absorbed from water and concentrated by phyto- and microzooplankton, and then are transferred to the next trophic level along marine food chains. Investigation in epipelagic, mesopelagic, bathypelagic and abyssobenthic organisms revealed that (210)Po is transferred in the marine food webs with transfer factors ranging from 0.1 to 0.7, and numerically similar to those of the energy transfer in the marine food chains. As (210)Po preferentially binds to amino acids and proteins, its transfer in food chains likely traces protein transfer and, thus, (210)Po transfer factors are similar to ecotrophic coefficients. (210)Pb is transferred less efficiently in marine food chains and this contributes to increased (210)Po:(210)Pb activity ratios in some trophic levels. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. Association between radionuclides ((210)Po and (210)Pb) and antioxidant enzymes in oak (Quercus coccifera) and mastic tree (Pistacia lentiscus).

    Science.gov (United States)

    Uğur Görgün, A; Aslan, E; Kül, M; İlhan, S; Dimlioğlu, G; Bor, M; Özdemir, F

    2016-08-27

    The activity levels of naturally occurring radionuclides Polonium-210 and lead-210 in different subjects including plant species have direct or indirect impact on human beings. High levels of ionising radiation cause oxidative stress and the interaction between antioxidative defense and radionuclides is not well established in plant systems. In this study, we aimed to understand the impact of oxidative stress caused by (210)Po and (210)Pb in two Mediterranean plants; Quercus coccifera and Pistacia lentiscus. We analysed the constitutive and seasonal levels of (210)Po, (210)Pb, lipid peroxidation levels, superoxide dismutase (SOD) and ascorbate peroxidase (APX) activities in the field-collected samples. The highest activity concentrations of (210)Po and (210)Pb were detected in both plants in summer and Q. coccifera had higher levels than that of P. lentiscus. SOD and APX activity trends were different between oak and mastic; as compared to P. lentiscus, Q. coccifera efficiently used the two major components of antioxidative defense. Lipid peroxidation levels were low in both plants in all seasons except that of spring which were in good agreement with high antioxidant enzyme activities. In conclusion, we found that high (210)Po and (210)Pb activity concentrations in oak and mastic did not interfere with their growth and life cycles. The ability of both plants for survival and adaptation to Mediterranean environmental constraints provided an additional advantage for coping radionuclide induced oxidative stress as well.

  6. Determination of 210 Po in Water%水中210Po 的分析

    Institute of Scientific and Technical Information of China (English)

    王莉莉; 张晔; 陆月萍; 周彦; 曹钟港

    2013-01-01

      水中痕量210 Po 分析采用的是示踪剂的α能谱分析法。在待分析水样中加入208 Po 示踪剂,以氢氧化铁共沉淀的形式载带钋,在0.5 mol/L 盐酸体系中利用钋对银的高度选择性实现自沉积。利用α谱仪探测系统对样品源测量48 h ,根据钋同位素的对应谱分析210 Po 活度。本文讨论该法与我国现行国标、EML 及 IAEA 分析技术的差异性。%  The determination of 210 Po in water samples was carried out by using of 208 Po tracer with the aid of alpha spectrometry .Adding 208 Po tracer to water samples before preliminary preparation ,the 210 Po and were co-precipitated with iron hydroxide .The polonium were auto-deposited on silver disc by advantage of its high selectiveness in 0 .5 mol/L hydrochloric acid solution .The sample source was counted for 60 hours in al-pha spectrometry system .The determination of 210 Po activity was performed according to different spectra .In addition ,the article discusses the differences of the present analytical method and the national standards ,EML and IAEA methods . 208 Po

  7. Distribution of (226)Ra-(210)Pb-(210)Po in marine biota and surface sediments of the Red Sea, Sudan.

    Science.gov (United States)

    Sirelkhatim, D A; Sam, A K; Hassona, R K

    2008-12-01

    Activity concentration levels and ratios of (226)Ra, (210)Pb and (210)Po are presented in multicellular marine algae, molluscs, coral as well as in surface marine sediments collected from the shallower waters of the fringing reefs area extending towards north and south (Flamingo bay) of PortSudan harbour, Sudan. The analyses were performed adopting alpha-spectrometry, liquid scintillation and Cerenkov counting techniques. Surface sediments from this coastal region are poor in their radioactivity content in contrast to similar data reported from different coastal areas around the globe. There is surface enrichment of (210)Pb and (210)Po with respect to their progenitor (226)Ra as it is evident from the activity ratios of (210)Pb/(226)Ra (3.03+/-1.79) and (210)Po/(226)Ra (2.23+/-1.56). Among marine plants and animals investigated, the green algae species, Halimeda, and coral species, Favites, show substantial concentration of radium at 8.2Bq/kg and 21.9Bq/kg dry weight, respectively. Similarly, the highest concentration of (210)Po was met in Favites at 38.7Bq/kg followed by brown algae, Cystoseria sp., at 32.6Bq/kg. There is no variation seen among algal species for (210)Pb uptake, however, converse to radium and polonium, Favites (coral) was found to contain the minimum concentration of lead (3.88Bq/kg). In most species there is preferential accumulation of polonium over its parent radium as indicated by (210)Po:(226)Ra activity ratio with Cystoseria (brown algae) showing the highest value at 8.81. On the other hand, (210)Po:(210)Pb activity concentration ratio revealed that coral species Favites (9.97) and the brown algae Sargassum (1.85) have a greater tendency to accumulate (210)Po over (210)Pb, while in the rest of species; this ratio is less than unity.

  8. Radiolead (210)Pb and (210)Po/(210)Pb activity ratios in calcium supplements and the assessment of their possible dose to consumers.

    Science.gov (United States)

    Strumińska-Parulska, Dagmara I

    2016-08-23

    This paper presents the results of pioneer study of the most popular calcium supplements as a potential additional source of radiolead (210)Pb in human diet. The analyzed calcium pharmaceutics contained organic or inorganic calcium compounds; some came from natural sources as mussels' shells, fish extracts, or sedimentary rocks. The idea was to investigate the naturally occurring (210)Pb activity in different calcium supplements and calculate the annual effective radiation dose from radiolead (210)Pb decay in consumed calcium supplement. The results showed (210)Pb concentrations in natural origin calcium supplements (especially sedimentary rocks) were significantly higher. The highest (210)Pb activity concentrations were determined in mineral tablets made from dolomite - 2.97 ± 0.18 mBq g(-1), while the lowest was observed in organic calcium compounds - both calcium lactate - 0.08 ± 0.01 and 0.13 ± 0.01 mBq g(-1). The highest annual radiation dose from (210)Pb taken with 1 tablet of calcium supplement per day was calculated for soluble calcium lactate sample - 1.19 ± 0.03 µSv year(-1), while the highest annual radiation dose from (210)Pb taken daily with 1 g of pure Ca for dolomite - 5.57 ± 0.34 µSv year(-1).

  9. Compact Miniaturized Antenna for 210 MHz RFID

    Science.gov (United States)

    Lee, Richard Q.; Chun, Kue

    2008-01-01

    This paper describes the design and simulation of a miniaturized square-ring antenna. The miniaturized antenna, with overall dimensions of approximately one tenth of a wavelength (0.1 ), was designed to operate at around 210 MHz, and was intended for radio-frequency identification (RFID) application. One unique feature of the design is the use of a parasitic element to improve the performance and impedance matching of the antenna. The use of parasitic elements to enhance the gain and bandwidth of patch antennas has been demonstrated and reported in the literature, but such use has never been applied to miniaturized antennas. In this work, we will present simulation results and discuss design parameters and their impact on the antenna performance.

  10. Polonium-210 levels in different environmental samples.

    Science.gov (United States)

    Fonollosa, E; Peñalver, A; Aguilar, C; Borrull, F

    2015-12-01

    Polonium-210 is analysed in different samples which can be affected by the presence of a dicalcium phosphate plant (DCP). Particularly, it was determined in sludge samples from a drinking water treatment plant located downstream of the phosphate plant. From the obtained results, it was not possible to establish a correlation with the industrial activities carried out in the DCP plant since the measured activities were comparable to the reported in the literature for normal soils. This isotope was also monitored in different biota species (as mussels) taken also downstream of the DCP, and the potential risk of their ingestion by calculating the total effective doses was evaluated. As a result, it is important to highlight that the ingestion of these mussels does not constitute a risk for the population since the found doses were lower than the values published by UNSCEAR.

  11. Distribution and biokinetic analysis of {sup 210}Pb and {sup 210}Po in poultry due to ingestion of dicalcium phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Casacuberta, N., E-mail: Nuria.Casacuberta@uab.es [Departament de Fisica and Institut de Ciencia i Tecnologia Ambientals, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Traversa, F.L. [Departament d' Electronica, Escola Tecnica Superior d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Masque, P.; Garcia-Orellana, J. [Departament de Fisica and Institut de Ciencia i Tecnologia Ambientals, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Anguita, M.; Gasa, J. [Departament de Ciencia Animal i dels Aliments, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Garcia-Tenorio, R. [Universidad de Sevilla, Avda. Reina Mercedes s/n, 41012 Sevilla (Spain)

    2010-09-15

    Dicalcium phosphate (DCP) is used as a calcium supplement for food producing animals (i.e., cattle, poultry and pig). When DCP is produced via wet acid digestion of the phosphate rock and depending on the acid used in the industrial process, the final product can result in enhanced {sup 210}Pb and {sup 210}Po specific activities ({approx} 2000 Bq.kg{sup -1}). Both {sup 210}Pb and {sup 210}Po are of great interest because their contribution to the dose received by ingestion is potentially large. The aims of this work are to examine the accumulation of {sup 210}Pb and {sup 210}Po in chicken tissues during the first 42 days of life and to build a suitable single-compartment biokinetic model to understand the behavior of both radionuclides within the entire animal using the experimental results. Three commercial corn-soybean-based diets containing different amounts and sources of DCP were fed to broilers during a period of 42 days. The results show that diets containing enhanced concentrations of {sup 210}Pb and {sup 210}Po lead to larger specific accumulation in broiler tissues compared to the blank diet. Radionuclides do not accumulate homogeneously within the animal body: {sup 210}Pb follows the calcium pathways to some extent and accumulates largely in bones, while {sup 210}Po accumulates to a large extent in liver and kidneys. However, the total amount of radionuclide accumulation in tissues is small compared to the amounts excreted in feces. The single-compartment non-linear biokinetic model proposed here for {sup 210}Pb and {sup 210}Po in the whole animal takes into account the size evolution and is self-consistent in that no fitting parameterization of intake and excretions rates is required.

  12. Distribution and biokinetic analysis of 210Pb and 210Po in poultry due to ingestion of dicalcium phosphate.

    Science.gov (United States)

    Casacuberta, N; Traversa, F L; Masqué, P; Garcia-Orellana, J; Anguita, M; Gasa, J; Garcia-Tenorio, R

    2010-09-15

    Dicalcium phosphate (DCP) is used as a calcium supplement for food producing animals (i.e., cattle, poultry and pig). When DCP is produced via wet acid digestion of the phosphate rock and depending on the acid used in the industrial process, the final product can result in enhanced (210)Pb and (210)Po specific activities (approximately 2000 Bq.kg(-1)). Both (210)Pb and (210)Po are of great interest because their contribution to the dose received by ingestion is potentially large. The aims of this work are to examine the accumulation of (210)Pb and (210)Po in chicken tissues during the first 42 days of life and to build a suitable single-compartment biokinetic model to understand the behavior of both radionuclides within the entire animal using the experimental results. Three commercial corn-soybean-based diets containing different amounts and sources of DCP were fed to broilers during a period of 42 days. The results show that diets containing enhanced concentrations of (210)Pb and (210)Po lead to larger specific accumulation in broiler tissues compared to the blank diet. Radionuclides do not accumulate homogeneously within the animal body: (210)Pb follows the calcium pathways to some extent and accumulates largely in bones, while (210)Po accumulates to a large extent in liver and kidneys. However, the total amount of radionuclide accumulation in tissues is small compared to the amounts excreted in feces. The single-compartment non-linear biokinetic model proposed here for (210)Pb and (210)Po in the whole animal takes into account the size evolution and is self-consistent in that no fitting parameterization of intake and excretions rates is required.

  13. Distribution of Po-210 and Pb-210 in Arctic Char (Salvelinus alpinus) from an Arctic freshwater lake

    Energy Technology Data Exchange (ETDEWEB)

    Gwynn, J.P.; Rudolfsen, G. [Norwegian Radiation Protection Authority, The Fram Centre, Tromsoe (Norway)

    2014-07-01

    There is little information available with regard to the accumulation of Po-210 and Pb-210 by freshwater fish in natural freshwater systems despite the potential for relevant ingestion doses to man. This is maybe of particular pertinence for certain population groups where freshwater fish are an important dietary food item. Equally, it is important to understand the body distributions of these naturally occurring radionuclides to quantify the resulting doses to different tissues and organs of freshwater fish. With regard to the latter, it is important to consider not only the doses arising from bio-accumulated Po-210 and Pb-210 in various body compartments but additionally the internal dose from unabsorbed Po-210 and Pb-210 in the digestive tract. In this study, activity concentrations of Po-210 and Pb-210 were determined in muscle and various internal organs of Arctic Charr (Salvelinus alpinus) sampled from a lake in the Norwegian Arctic (69 deg. 4' N, 19 deg. 20' E). Observed activity concentrations of Po-210 and Pb-210 in different tissues will be discussed in relation to physiological parameters and ambient lake water activity concentrations. Results from this study will be compared to two similar studies conducted in freshwater systems where elevated activity concentrations of these radionuclides have been observed. Ingestion dose rates to man and effective absorbed dose rates to different tissues and organs of Arctic Charr from Po-210 and Pb-210 will be derived and compared to those from observed activity concentrations of the anthropogenic radionuclide Cs-137. (authors)

  14. Separation and electrodeposited of {sup 210} Po; Separacion y electrodeposito de {sup 210} Po

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Iturbe G, J.L

    1991-12-15

    Presently work it was determined the selective separation of the {sup 210} Po that is in an uraniferous mineral, by means of acid leaching of the mineral and the purification was carried out by means of partition chromatography whose stationary phase is 2-ethylhexyl phosphoric acid (D{sub 2}EHPA), it has been possible to isolate the {sup 210} Po of the rest of the radioactive elements that conform the family 4 N{sup +2}, the optimal elutriation conditions of this element were settled down of manner of not dragging other radioelements. Another of the achievements presented in this communication has been the electrodeposition of this element has more than enough stainless steel discs with a superior yield to 95%. (Author)

  15. Foliar retention, transport and leaching of polonium-210 and lead-210

    Energy Technology Data Exchange (ETDEWEB)

    Athalye, V.V.; Mistry, K.B.

    1972-01-01

    Polonium-210 and lead-210, the long-lived daughter radionuclides of gaseous radon-222, are deposited on plant surfaces under conditions of atmospheric washout. Foliar retention, transport and leaching of these radionuclides in Red Kidney beans were investigated in nutrient culture experiments. Under identical conditions, over 90 percent of foliar applied radiolead was retained by the plant while only about 30 percent of polonium was retained. Over a 48-hr period small quantities of polonium were translocated from the treated leaflet to other parts of the plant. By comparison, radiolead was totally immobilized at the site of retention. Leachability of root absorbed radiolead from bean leaves was 20-fold greater than that of polonium. The marked differences in the extent of foliar retention, translocation and leaching of polonium and radiolead could significantly affect the levels of these long-lived radionuclides attained in plants.

  16. Particulate Scavenging and Lateral Transport Processes in the Gaoping Submarine Canyon Deduced From Pb-210 and Po-210 Observations

    Science.gov (United States)

    Hung, G.; Wang, P.; Shen, Y.

    2009-05-01

    Pb-210 and Po-210 were measured on the suspended particulate matter(SPM) and filtered water samples collected in profile from five stations in the Gaoping Submarine Canyon (GPSC) during a cruise aboard R/V Ocean Researcher III in late November, 2006. These stations were selected along the axis of the GPSC, and denoted as CW1 through CW5 sequentially from the shallow part near the mouth of the Gaoping River to the deep-water region of the canyon. Except for CW4, the SPM profiles generally show a rapid increase to a maximum near bottom, the value of which is an order of magnitude higher than that observed above, suggesting a significant particulate resuspension or lateral input in the bottom layer. The SPM concentrations obtained at canyon head stations(CW1 to CW3) vary between 0.36 and 19.17 mg/kg. These values are generally higher than those obtained farther outward(CW4 and CW5), which range from 0.01 to 2.13 mg/kg, indicating a decrease away from the shore. The dissolved Pb-210 and Po-210 profiles observed from CW1 and CW2 are fairly uniform for the entire water column, with a mean of about 14 and 12 dpm/100kg, respectively. The other stations show a large variation in dissolved Pb-210 and Po-210 with a mean of about 23 and 14 dpm/100kg, respectively. At stations CW1, CW2 and CW3, the particulate Pb-210 and Po-210 profiles generally display a maximum around 28-38 and 27-48 dpm/100kg, respectively, in the bottom layer, suggesting significant particulate resuspension and scavenging. Variable Pb-210 and Po-210 activities in the particulates at CW4 and CW5 are observed in the surface layer. Both the dissolved and the total (dissolved + particulate) Po-210 to Pb-210 activity ratios vary between 0.1 and 1.7, mostly less than 1.0, with a mean of 0.7 and 0.8, indicating a variable deficiency of Po-210 relative to Pb- 210 in this study area. Total activities of Pb-210 are generally higher than those of Po-210. The Ra-226 profiles show much lower activities than those of

  17. 17 CFR 210.7-02 - General requirement.

    Science.gov (United States)

    2010-04-01

    ... statements filed for mutual life insurance companies and wholly owned stock insurance company subsidiaries of... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false General requirement. 210.7-02 Section 210.7-02 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION FORM AND CONTENT...

  18. 33 CFR 110.210 - San Diego Harbor, CA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false San Diego Harbor, CA. 110.210... ANCHORAGE REGULATIONS Anchorage Grounds § 110.210 San Diego Harbor, CA. (a) The anchorage grounds. (1... Commander, Naval Base, San Diego, CA. The administration of these anchorages is exercised by the...

  19. 19 CFR 210.74 - Modification of reporting requirements.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Modification of reporting requirements. 210.74 Section 210.74 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR... warrants, announce that a modification of reporting is under consideration and ask for comment, but it...

  20. 21 CFR 175.210 - Acrylate ester copolymer coating.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Acrylate ester copolymer coating. 175.210 Section... COATINGS Substances for Use as Components of Coatings § 175.210 Acrylate ester copolymer coating. Acrylate ester copolymer coating may safely be used as a food-contact surface of articles intended for...

  1. 24 CFR 598.210 - What certifications must governments make?

    Science.gov (United States)

    2010-04-01

    ... pervasive poverty, unemployment and general distress, as prescribed by § 598.110; (c) The nominated urban... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false What certifications must governments make? 598.210 Section 598.210 Housing and Urban Development Regulations Relating to Housing...

  2. 27 CFR 555.210 - Construction of type 4 magazines.

    Science.gov (United States)

    2010-04-01

    ... magazines. 555.210 Section 555.210 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO... Construction of type 4 magazines. A type 4 magazine is a building, igloo or “Army-type structure”, tunnel, dugout, box, trailer, or a semitrailer or other mobile magazine. (a) Outdoor magazines—(1)...

  3. 31 CFR 210.7 - Federal Reserve Banks.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Federal Reserve Banks. 210.7 Section... CLEARING HOUSE General § 210.7 Federal Reserve Banks. (a) Fiscal Agents. Each Federal Reserve Bank serves... under this part. As Fiscal Agent, each Federal Reserve Bank shall be responsible only to the...

  4. 19 CFR 210.4 - Written submissions; representations; sanctions.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Written submissions; representations; sanctions. 210.4 Section 210.4 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF... agreement; (3) A consent order agreement; or (4) An arbitration agreement. (iv) Monetary sanctions imposed...

  5. 22 CFR 1203.735-210 - Gambling, betting, and lotteries.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Gambling, betting, and lotteries. 1203.735-210... RESPONSIBILITIES AND CONDUCT Ethical and Other Conduct and Responsibilities of Employees § 1203.735-210 Gambling, betting, and lotteries. An employee shall not participate, while on Government-owned or leased property...

  6. 19 CFR 210.72 - Confidentiality of information.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Confidentiality of information. 210.72 Section 210.72 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN... Confidentiality of information. Confidential information (as defined in § 201.6(a) of this chapter) that is...

  7. 24 CFR 5.210 - Purpose, applicability, and Federal preemption.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Purpose, applicability, and Federal preemption. 5.210 Section 5.210 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development GENERAL HUD PROGRAM REQUIREMENTS; WAIVERS Disclosure and Verification of...

  8. 24 CFR 291.210 - Direct sales procedures.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Direct sales procedures. 291.210... Procedures § 291.210 Direct sales procedures. When HUD conducts the sales listed in § 291.90(c), it will sell... sales procedures provided in this section. (a) Direct sales of properties without insured mortgages...

  9. 46 CFR 197.210 - Designation of diving supervisor.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Designation of diving supervisor. 197.210 Section 197... HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations General § 197.210 Designation of diving supervisor. The name of the diving supervisor for each commercial diving operation shall be— (a)...

  10. 17 CFR 210.2-07 - Communication with audit committees.

    Science.gov (United States)

    2010-04-01

    ... the balance sheets and statements of income and cash flows to be included in disclosure documents... FORM AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES...-01 (c)(7). (b) General Instructions as to Financial Statements Source: Sections 210.3-01 through 210...

  11. 48 CFR 2152.210-70 - Investment income.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Investment income. 2152.210... CONTRACT CLAUSES Text of Provisions and Clauses 2152.210-70 Investment income. As prescribed in 2110.7004(a), insert the following clause: Investment Income (OCT 2005) (a) The Contractor must invest and reinvest...

  12. Development of instrumentation for {sup 210} Pb dating method

    Energy Technology Data Exchange (ETDEWEB)

    Reinikainen, P.; Rekikoski, I.; Virtanen, A.; Aeystoe, J. [Institute for Environmental Research, Jyvaeskylae Univ. (Finland); Merilaeinen, J.; Witick, A. [Department of Physics, Jyvaeskylae Univ. (Finland)

    1998-08-01

    The presentation reviews shortly the project started in 1993 developing alpha- and gamma-ray spectroscopy systems and routines for a study of environmental samples. Particular interest has been focused to the {sup 210}Pb dating for lake sediments. So far, about 40 sediment profiles from all around Finland have been analysed and dated using the {sup 210}Pb method

  13. 34 CFR 300.210 - Purchase of instructional materials.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Purchase of instructional materials. 300.210 Section... EDUCATION OF CHILDREN WITH DISABILITIES Local Educational Agency Eligibility § 300.210 Purchase of... the National Instructional Materials Access Center (NIMAC), when purchasing print...

  14. 50 CFR 600.210 - Terms of Council members.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MAGNUSON-STEVENS ACT PROVISIONS Council Membership § 600.210 Terms of Council members. Link to an amendment published at 75 FR 59151, Sept. 27, 2010. (a) Voting members (other... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Terms of Council members. 600.210...

  15. 42 CFR 50.210 - Review of regulation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Review of regulation. 50.210 Section 50.210 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL... regulation. The Secretary will request public comment on the operation of the provisions of this subpart not...

  16. 17 CFR 210.8-05 - Pro forma financial information.

    Science.gov (United States)

    2010-04-01

    ... balance sheet required by § 210.8-02 or § 210.8-03, a pro forma balance sheet giving effect to the combination as of the date of the most recent balance sheet. For a purchase, pro forma statements of income..., INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Article 8...

  17. 31 CFR 210.4 - Authorizations and revocations of authorizations.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Authorizations and revocations of authorizations. 210.4 Section 210.4 Money and Finance: Treasury Regulations Relating to Money and Finance... corporate action, or the appointment of a receiver, conservator, or liquidator for the RDFI. In any such...

  18. 47 CFR 10.210 - CMAS participation election procedures.

    Science.gov (United States)

    2010-10-01

    ... technology for the “C” interface, the CMS provider Gateway, the CMS provider infrastructure, and mobile... Section 10.210 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL MOBILE ALERT SYSTEM Election to Participate in Commercial Mobile Alert System § 10.210 CMAS participation election...

  19. Biomass Burning and Polonium-210 in the Atmosphere: a Review

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Fernando P. [Instituto Superior Tecnico/Campus Tecnologico e Nuclear/(IST/CTN), Universidade de Lisboa, Estrada Nacional 10 - ao km 139,7 - 2695-066 Bobadela LRS (Portugal)

    2014-07-01

    Naturally-occurring radionuclides, such as those of uranium series, are part of the lithosphere and hydrosphere and plants do accumulate them up to a certain extent being the activity concentrations in plants generally low, less than 10 Bq/kg (dry weight). Forest and vegetation fires, as well as biomass burning for energy production, release large amounts of carbon, particulate materials, and gaseous compounds into the atmosphere including the naturally-occurring radionuclides present in plants. Near forest fires, and at local and regional scales, surface aerosol sampling followed by radionuclide analysis showed enhanced radionuclide concentrations, especially those of {sup 210}Po. In surface air with smoke from wild fires {sup 210}Po concentration attained 70 mBq/m{sup 3}, more than 2000 times above {sup 210}Po background in surface air, and aerosols displayed {sup 210}Po/{sup 210}Pb concentration ratios up to 12, i.e., about 20 times higher than the average concentration ratio in surface air. Taking into account the amount of plant biomass burned every year, the total activity of {sup 210}Po released into the atmosphere from this source is able to disrupt the usual {sup 210}Po/{sup 210}Pb concentration ratios in atmosphere and atmospheric depositions. A review of atmospheric polonium sources is presented. (authors)

  20. Research advances of microRNA-210%微小RNA-210研究进展

    Institute of Scientific and Technical Information of China (English)

    张露; 戴琼艳; 赵琳; 段满林

    2014-01-01

    背景 微小RNA(micmRNA,miRNA)是体内重要的基因水平调节物质,它能调控约1/3的人类蛋白编码基因表达.体内组织细胞缺氧后,miRNA水平发生变化,其中变化最显著的是微小RNA-210(microRNA-210,miR-210).目的 由于miR-210易受低氧诱导,综述miR-210在低氧下的生物化学功能,并探讨其潜在的临床应用.内容 概述miR-210在线粒体代谢、血管生成、DNA修复和细胞存活等方面的作用.趋向 为miR-210相关疾病的诊疗提供参考.%Background MicroRNA(miRNA) is an important regulatory factor that can regulate approximately 30% human protein-coding genes.The level of miRNA will be changed after the tissue under hypoxia,and the most significant change is of microRNA-210 (miR-210).Objective This review discusses the emerging biochemical functions of this miRNA and explores its potential clinical applications.Content Outline the role of miR-210 in mitochondrial respiration,arrest of DNA repair,vascularbiology and angiogenesis.Trend Provide references for the diagnosis and therapy of miR-210-related disorders.

  1. Enrichment and vertical profiles of {sup 210}Po and {sup 210}Pb in monazite areas of coastal Karnataka

    Energy Technology Data Exchange (ETDEWEB)

    Narayana, Y. [Department of Studies in Physics, Mangalore University, Mangalagangothri 574199 (India)], E-mail: narayanay@yahoo.com; Prakash, V. [Department of Studies in Physics, Mangalore University, Mangalagangothri 574199 (India)

    2010-06-15

    A study on radiation level and radionuclide distribution in the environment of coastal Karnataka has revealed the presence of low-level monazite deposit in the Ullal beach area. The paper presents systematic studies on the distribution, enrichment and vertical profiles of {sup 210}Po and {sup 210}Pb, important daughter products of {sup 238}U, in Ombattu Kere, Summer Sand and the Bhagavathi Temple region of the Ullal beach area of coastal Karnataka. Sand samples collected at different depths from these locations were analyzed for {sup 210}Po and {sup 210}Pb activities to understand the distribution, enrichment and vertical profiles of these radionuclides in monazite area. The activity of {sup 210}Po in the Ullal region is found to vary from 1.7 to 43.2 Bq kg{sup -1} with a mean value of 11.2 Bq kg{sup -1} and that of {sup 210}Pb varies from 1.0 to 66.7 Bq kg{sup -1} with a mean value of 19.1 Bq kg{sup -1}. The mean {sup 210}Po/{sup 210}Pb ratio was observed to be 0.6. The absorbed gamma dose rate in the region varies in the range 39-460 nGy h{sup -1} with a mean value of 193 nGy h{sup -1}.

  2. Neonatal asphyxia: A study of 210 cases

    Directory of Open Access Journals (Sweden)

    Hülya Üzel

    2012-06-01

    Full Text Available Objectives: Perinatal asphyxia remains an importantcause of neonatal morbidity and mortality. The aim of thisstudy was to investigate antenatal, natal, and postnatalrisk factors of neonatal asphyxia, relationship with knownrisk factors and stage of Sarnat and Sarnat scores, theeffect of risk factors on hospital discharge and survival forneonates with perinatal asphyxia.Materials and methods: In this study, we retrospectivelyanalyzed the hospital records of 210 patients diagnosedas perinatal asphyxia. The patients’ demographic characteristics,antepartum, intrapartum, and postpartum riskfactors and Sarnat and Sarnat clinical staging criteria ofnewborns were analyzed.Results: The risk factors for asphyxia were detectedantepartum period in 67.7% of newborns, intrapartum in91% and potpartum in of 29.5% of neonates. When caseswere examined according to the studied years, perinatalasphyxia ratio was the most frequent in 2007 as 28.1%.With a decline over the years, frequency dropped to %21in 2010. The number of patients with stage 3 and mortalityrate were significantly decreased over the years (p<0.05.Conclusions: Less preventable intrapartum causes ofbirth asphyxia are seen more frequently. Early detectionof risk factors together with appropriate prenatal, nataland postnatal care provision, reduced emergency caesareansections and will decrease considerably decreasefrequency of perinatal asphyxia. We think that followingup neonates who needed intensive care in neonatal unitssufficiently equipped will decrease complications due toasphyxia. J Clin Exp Invest 2012; 3(2: 194-198

  3. Recoil-deposited Po-210 in radon dwellings

    Energy Technology Data Exchange (ETDEWEB)

    Samuelsson, C.

    1990-12-31

    Short-lived decay products of Rn-222 plate out on all surfaces in a house containing radon gas. Following the subsequent alpha decays of the mother nuclei, the daughter products Pb-214 and Pb-210 are superficially and permanently absorbed. Due to its long half-life (22 y) the activity of absorbed Pb-210 accumulates in the surface. The activity of Pb-210, or its decay products, can thus reflect the past randon daughter and plate-out history of a house over several decades. Our results and experience from measurements of Po-210 and Rn-222 in 22 dwellings will be presented. In these studies the Po-210 surface activity of one plane glass sheet per dwelling (window panes were not used) has been determined and compared with the period of exposure times the mean radon concentration measured over a two-month period. Considering the large uncertainty in the integrated radon exposure estimate the surface {sup 210}Po correlates well (r=0.73) with the accumulated radon exposure. The {sup 210}Po activity of the glass samples has been measured non-destructively using an open-flow pulse ionization chamber and this detector has also been successfully applied in field exercises.

  4. Recoil-deposited Po-210 in radon dwellings

    Energy Technology Data Exchange (ETDEWEB)

    Samuelsson, C.

    1990-01-01

    Short-lived decay products of Rn-222 plate out on all surfaces in a house containing radon gas. Following the subsequent alpha decays of the mother nuclei, the daughter products Pb-214 and Pb-210 are superficially and permanently absorbed. Due to its long half-life (22 y) the activity of absorbed Pb-210 accumulates in the surface. The activity of Pb-210, or its decay products, can thus reflect the past randon daughter and plate-out history of a house over several decades. Our results and experience from measurements of Po-210 and Rn-222 in 22 dwellings will be presented. In these studies the Po-210 surface activity of one plane glass sheet per dwelling (window panes were not used) has been determined and compared with the period of exposure times the mean radon concentration measured over a two-month period. Considering the large uncertainty in the integrated radon exposure estimate the surface {sup 210}Po correlates well (r=0.73) with the accumulated radon exposure. The {sup 210}Po activity of the glass samples has been measured non-destructively using an open-flow pulse ionization chamber and this detector has also been successfully applied in field exercises.

  5. 234Th, 210Pb, 210Po and stable Pb in the central equatorial Pacific: Tracers for particle cycling

    Science.gov (United States)

    Murray, James W.; Paul, Barbara; Dunne, John P.; Chapin, Thomas

    2005-11-01

    Samples were collected during the 1992 US JGOFS EqPac Survey I and II cruises from 12°N to 12°S at 140°W in the central equatorial Pacific for water column profiles of dissolved, particulate and total 234Th, 210Pb and 210Po and total acid soluble stable Pb and sediment trap fluxes of 234Th, 210Pb and 210Po. Survey I occurred in February/March with moderate El Nino conditions while Survey II was conducted in September/October when there was a well developed cold-tongue. 234Th, 210Pb and 210Po are all particle reactive yet they partition differently between dissolved and particulate phases. Fractionation factors (the ratios of the distribution coefficients) show that the selectivity for suspended and sediment trap particles follows Th>Po>Pb. Scavenging residence times ( τ) for 234Th, 210Pb and 210Po ranged from 25 to 100 d, 3 to 8 years and 100 to 500 d, respectively. These particle reactive tracers have very different distributions in the water column, which reflect differences in their sources and sinks. The deficiency of 234Th relative to 238U was fairly uniformly distributed meridionally, though deficiencies were higher during Survey II when there was higher new production. Excess 210Pb relative to 226Ra was very asymmetrical with much higher excess values north of the equator. The distributions were similar for Surveys I and II. The deficiency of 210Po relative to 210Pb had a symmetrical distribution about the equator for both Survey I and II but the deficiencies were larger during Survey I when upwelling was smaller. Stable Pb was generally higher at the surface than at 250 m and there was no meridional trend from 12°N to 12°S. A mass balance for 210Pb was used to determine the atmospheric input of 210Pb. The average values for Surveys I and II were 0.12 and 0.32 dpm cm -2 year -1, respectively. There was no general increase in atmospheric input of 210Pb north of the equator but there was a strong maximum at 2-3°N during Survey I coincident with the

  6. Natural variation in 210Po and 210Pb activity concentrations in the urine of Finnish population groups.

    Science.gov (United States)

    Muikku, Maarit; Heikkinen, Tarja; Solatie, Dina; Vesterbacka, Pia

    2011-11-01

    A study to determine activity concentrations of (210)Pb and (210)Po in the urine of certain Finnish population groups was conducted, to investigate the variation in natural background level of urinary excretion. The study participants were divided into three groups mainly based on their diet. The first group comprised recreational fishermen and the second group represented people consuming more reindeer meat than an average Finn, while people using drinking water with very high activity concentrations of (210)Po were selected for the third group. The fourth group was a control group. The mean urinary excretion of (210)Po in groups 1 and 2 was 73 and 100 mBq d(-1), respectively. These values were higher than the value of the control group (20 mBq d(-1)) and the mean values reported in the literature. The mean daily urinary excretion of (210)Pb in groups 1 and 2, 70 and 52 mBq d(-1), was also slightly higher than that in the control group (32 mBq d(-1)). In contrast, the excretion rates of both (210)Po and (210)Pb for the members of group 3 were one to two orders of magnitude higher than those reported in the literature. This was clearly due to the elevated levels of natural radionuclides in their drinking water. The present study demonstrates the importance of possessing good knowledge of the background levels, in order to allow the determination of the additional exposure due, for example, to the malevolent use of radiation.

  7. Methodology for {sup 210}Po extraction from underground waters; Metodologia para a extracao de Po-210 em aguas subterraneas

    Energy Technology Data Exchange (ETDEWEB)

    Conceicao, Fabiano Tomazini da; Bonotto, Daniel Marcos [UNESP, Rio Claro, SP (Brazil). Inst. de Geociencias e Ciencias Exatas. Dept. de Petrologia e Metalogenia

    1998-07-01

    This work describes the first results obtained by the implementation of the methodology of {sup 210}Po extraction from underground waters. This methodology was first tested in the analysis of uranite sample from the Pocos de Caldas plateau (MG-Brazil) which constitutes a important natural source of {sup 210}Po. For the uranine sample a counting rate of 1.67 cpm for {sup 210}Po was obtained and for underground water 0.3 cpm was obtained which demonstrates that the used methodology is efficient for water analysis.

  8. Determination of Polonium-210 in Mussels from the Adria Sea

    Science.gov (United States)

    Bylyku, Elida; Bode, Kozeta; Fisnka, Kujtim; Cfarku, Florinda

    2010-01-01

    The important role played by alpha radioactive nuclides in the marine radiation environment is already evident. The dominant contribution made by natural fall-out nuclide Polonium-210 to the alpha radioactivity of most marine organisms is very important. The common mussel Mytilus galloprovincialis is selected as unique bio monitor species to be analyzed. Samples are collected at the Adria Sea along the Albanian coast. A radiochemical procedure followed by alpha spectrometry measurement of 210Po is performed. The standard solution of 209Po is used as a yield tracer. Thin sources for alpha spectrometry measurements are prepared by spontaneous deposition of polonium on to silver disks from weakly acid solutions. The value of specific activity of 210Po vary between 200 to 400 Bq/kg dry and are in good agreement with the results found for 210Po in mussels from other countries in the Adria Sea.

  9. Polonium 210Po in the phytobenthos from Puck Bay.

    Science.gov (United States)

    Skwarzec, B; Ulatowski, J; Strumińska, D I; Falandysz, J

    2003-04-01

    The aim of the work was to determine the 210Po content in phytobenthos species (seaweeds and angiosperms) from Puck Bay (southern Baltic). Alpha spectrometry was used to measure and calculate the activities and concentrations of polonium 210Po in the phytobenthos. The activity of 210Po in Puck Bay waters was determined to estimate the bioconcentration factors (BCF) of these plants. The 210Po concentration in water was estimated at 0.25 mBq dm(-3). The lowest polonium concentration in the phytobenthos was found in Cladophora rupestris (0.12 Bq kg(-1) wet wt.), the highest in Chara crinita (1.12 Bq kg(-1) wet wt.). Polonium is accumulated in these phytobenthos species; the bioconcentration factors (BCF) ranged from 450 to 4400.

  10. Biogeochemical factors affecting the presence of 210Po in groundwater

    Science.gov (United States)

    Seiler, R.L.; Stillings, L.L.; Cutler, N.; Salonen, L.; Outola, I.

    2011-01-01

    The discovery of natural 210Po enrichment at levels exceeding 500 mBq/L in numerous domestic wells in northern Nevada, USA, led to a geochemical investigation of the processes responsible for its mobilization. 210Po activities in 63 domestic and public-supply wells ranged from below 1 mBq/L to 6590 ± 590 mBq/L, among the highest reported levels in the USA. There is little spatial or depth variability in 210Pb activity in study-area sediments and mobilization of a few percent of the 210Po in the sediments would account for all of the 210Po in water. Stable-isotope measurements indicate SO4 reduction has occurred in all 210Po contaminated wells. Sulfide species are not accumulating in the groundwater in much of Lahontan Valley, probably because of S cycling involving microbial SO4 reduction, abiotic oxidation of H2S to S0 by Mn(IV), followed by microbial disproportionation of S0 to H2S and SO4. The high pH, Ca depletion, MnCO3 saturation, and presence of S0 in Lahontan Valley groundwater may be consequences of the anaerobic S cycling. Consistent with data from naturally-enriched wells in Florida, 210Po activities begin to decrease when aqueous sulfide species begin to accumulate. This may be due to formation and precipitation of PoS, however, Eh–pH diagrams suggest PoS would not be stable in study-area groundwater. An alternative explanation for the study area is that H2S accumulation begins when anaerobic S cycling stops because Mn oxides are depleted and their reduction is no longer releasing 210Po. Common features of 210Po-enriched groundwater were identified by comparing the radiological and geochemical data from Nevada with data from naturally-enriched wells in Finland, and Florida and Maryland in the USA. Values of pH ranged from 9 in Nevada wells, indicating that pH is not critical in determining whether 210Po is present. Where U is present in the sediments, the data suggest 210Po levels may be elevated in aquifers with (1) SO4-reducing waters with low H2S

  11. RAPID DETERMINATION OF {sup 210} PO IN WATER SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, S.

    2013-05-22

    A new rapid method for the determination of {sup 210}Po in water samples has been developed at the Savannah River National Laboratory (SRNL) that can be used for emergency response or routine water analyses. If a radiological dispersive device (RDD) event or a radiological attack associated with drinking water supplies occurs, there will be an urgent need for rapid analyses of water samples, including drinking water, ground water and other water effluents. Current analytical methods for the assay of {sup 210}Po in water samples have typically involved spontaneous auto-deposition of {sup 210}Po onto silver or other metal disks followed by counting by alpha spectrometry. The auto-deposition times range from 90 minutes to 24 hours or more, at times with yields that may be less than desirable. If sample interferences are present, decreased yields and degraded alpha spectrums can occur due to unpredictable thickening in the deposited layer. Separation methods have focused on the use of Sr Resin, often in combination with 210Pb analysis. A new rapid method for {sup 210}Po in water samples has been developed at the Savannah River National Laboratory (SRNL) that utilizes a rapid calcium phosphate co-precipitation method, separation using DGA Resin (N,N,N,N-tetraoctyldiglycolamide extractant-coated resin, Eichrom Technologies or Triskem-International), followed by rapid microprecipitation of {sup 210}Po using bismuth phosphate for counting by alpha spectrometry. This new method can be performed quickly with excellent removal of interferences, high chemical yields and very good alpha peak resolution, eliminating any potential problems with the alpha source preparation for emergency or routine samples. A rapid sequential separation method to separate {sup 210} Po and actinide isotopes was also developed. This new approach, rapid separation with DGA Resin plus microprecipitation for alpha source preparation, is a significant advance in radiochemistry for the rapid

  12. X-rays from HH210 in the Orion nebula

    CERN Document Server

    Grosso, N; Getman, K V; Kästner, J H; Bally, J; McCaughrean, M J; Grosso, Nicolas; Feigelson, Eric D.; Getman, Konstantin V.; Kastner, Joel H.; Bally, John; Caughrean, Mark J. Mc

    2006-01-01

    We report the detection during the Chandra Orion Ultradeep Project (COUP) of two soft, constant, and faint X-ray sources associated with the Herbig-Haro object HH210. HH210 is located at the tip of the NNE finger of the emission line system bursting out of the BN-KL complex, northwest of the Trapezium cluster in the OMC-1 molecular cloud. Using a recent Halpha image obtained with the ACS imager on board HST, and taking into account the known proper motions of HH210 emission knots, we show that the position of the brightest X-ray source, COUP703, coincides with the emission knot 154-040a of HH210, which is the emission knot of HH210 having the highest tangential velocity (425 km/s). The second X-ray source, COUP704, is located on the complicated emission tail of HH210 close to an emission line filament and has no obvious optical/infrared counterpart. Spectral fitting indicates for both sources a plasma temperature of ~0.8 MK and absorption-corrected X-ray luminosities of about 1E30 erg/s (0.5-2.0 keV). These X...

  13. Pb-210 and Po-210 atmospheric releases via fly ash from oil shale-fired power plants.

    Science.gov (United States)

    Vaasma, Taavi; Loosaar, Jüri; Gyakwaa, Francis; Kiisk, Madis; Özden, Banu; Tkaczyk, Alan H

    2017-03-01

    During high temperature processes in the furnace volatile and semi-volatile elements and radionuclides are partially emitted to the environment, depending on their chemical form in the original fuel, the technological set-up of the combustion system, and the prevailing combustion conditions. Two of the world's largest oil shale-fired power plants (PPs) have been operational in Estonia from the 1960s, during which time creation of significant environmental emissions and waste containing naturally occurring radionuclides has occurred. Pb-210 and (210)Po are considered natural radionuclides with the highest emission rates from PPs and possess elevated potential radiation exposure risks to humans and the environment. These radionuclides have the highest activity concentration values in fine ash fractions, especially in fractions remaining below 2.5 μm. To determine the activity concentrations of (210)Pb and (210)Po in the PPs' outlet, sampling was conducted from boilers operating on pulverized fuel (PF) technology with novel integrated desulphurization (NID) system and bag filters as well as with electrostatic precipitators (ESPs). The (210)Pb and (210)Po activity concentrations remained around 300 Bq kg(-1) for the NID system compared to 60-80 Bq kg(-1) in the ESP system. The dominant ash fraction in both systems was PM2.5, constituting over 50% of the fly ash mass collected from the outlet. The authors estimate that the total atmospherically emitted activity for the modernized PPs remains dominantly below 1% of the activity that is inserted via fuel. The implementation of higher efficiency purifications systems has significantly reduced the negative effect of these PPs. Based on annually emitted fly ash and boilers' working hours, the (210)Pb and (210)Po activity released relative to energy production were up to 68.3 kBq GWhel(-1) for (210)Pb and 64.6 kBq GWhel(-1) for (210)Po. These values are 1 to 2 orders of magnitude lower compared to the situation in the 1980s

  14. Polonium 210, an important natural reference for radiological protection; Le polonium 210, un repere naturel important en radioprotection

    Energy Technology Data Exchange (ETDEWEB)

    Pradel, J.; Zettwoog, P.; Dellero, N.; Beutier, D. [Cogema, 78 - Velizy Villacoublay (France)

    2001-12-01

    Natural polonium 210 which has a relatively short decay period (138 days) and is uranium decay series daughter should retain more radiological attention because it induces chronic doses higher than that of traces of caesium 137 and plutonium isotopes (238, 239, 240) in the environment. In the earth's crust, uranium is present together with radium, radon and its daughter products, at a concentration of about 40,000 Bq t{sup -1}. As a consequence of radon 222 exhalation from soils within a metric layer and of lead 210 (radon daughter) fall-down, there is an enrichment of polonium 210 radioactivity in top layer soil relatively to radium concentration, within a factor varying from 2.7 to 8.8 according to environmental measurements. Human exposure to polonium 210 by ingestion is not negligible. The induced exposure by ingestion of natural polonium 210 is 30 to 70 limes higher than that of caesium from Chernobyl fall-down at Helsinki in 1986. Moreover, the latter decreases in relation with the 30 years' decay period while that from radon daughters remains. Comparison with plutonium shows a 500 to 2,000 times stronger health effect by ingestion for the same number of deposited becquerels on soil. 'Hot spots' may occur in the environment: polonium 210 is particularly concentrated by marine fauna, as shown by several measurement programs over the ares of north-east Atlantic. (author)

  15. Ra-228, Ra-226, Pb-210 and Po-210 variations in the water columns and the surface water plankton in the Luzon Strait and northern South China Sea

    Science.gov (United States)

    Chung, Y.; Lin, C.; Wang, P.; Su, Y.

    2006-12-01

    Profiles of Ra-228, Ra-226, Pb-210 and Po-210 were measured in the Luzon Strait (LS) and northern South China Sea (SCS) areas to delineate the exchanges between the western Philippine Sea (WPS) and the northern SCS waters across the LS. Plankton samples were also collected for Po-210 and Pb-210 measurements to assess the balance between the Po-210 excess over Pb-210 in the plankton and the deficit in the surface water. Profiles of Ra-228 and Ra-226 seem to indicate the out flow of the SCS water below the salinity minimum and above around 1500m depth, below which the WPS water flows into the SCS through the LS above a sill depth of about 2600m. This is consistent with previous studies conducted in the area. All the Pb-210 profiles show a strong subsurface maximum with higher activity in the LS area. This maximum is in large excess over its parent, Ra-226 due to atmospheric input. Po-210 profiles generally follow the associated Pb-210 profiles but with lower activities, showing Po-210 deficiency. Po-210 is strongly enriched over Pb-210 in the plankton samples with an activity ratio generally over 10 and up to 40. Both nuclides in the plankton are higher in the LS area, a trend similar to the surface water. The Po-210 excess in the plankton can account for at least 70 percent of the surface water deficit, part of which may be removed by sinking particles.

  16. Po-210 and other radionuclides in terrestrial and freshwater environments

    Energy Technology Data Exchange (ETDEWEB)

    Gjelsvik, Runhild; Brown, Justin (eds.) (Norwegian Radiation Protection Authority (Norway)); Holm, Elis (Univ. of Lund (Sweden)); Roos, Per (Risoe DTU (Denmark)); Saxen, Ritva; Outola, Iisa (STUK - Radiation and Nuclear Safety Authority (Finland))

    2009-01-15

    This report provides new information on Po-210 (and where appropriate its grandparent Pb-210) behaviour in environmental systems including humans. This has primarily been achieved through measurements of Po-210 in aquatic and terrestrial environments that has led to the derivation of information on the levels of this radioisotope in plants, animals and the biotic components of their habitat (i.e. water, soil) providing basic information on transfer where practicable. For freshwater environments, Po-210 concentration ratios derived for freshwater benthic fish and bivalve mollusc were substantially different to values collated from earlier review work. For terrestrial environments, activity concentrations of Po-210 in small mammals (although of a preliminary nature because no correction was made for ingrowth from Pb-210) were considerably higher than values derived from earlier data compilations. It was envisaged that data on levels of naturally occurring radionuclides would render underpinning data sets more comprehensive and would thus allow more robust background dose calculations to be performed subsequently. By way of example, unweighted background dose-rates arising from internal distributions of Po-210 were calculated for small mammals in the terrestrial study. The biokinetics of polonium in humans has been studied following chronic and acute oral intakes of selected Po radioisotopes. This work has provided information on gastrointestinal absorption factors and biological retention times thus improving the database upon which committed effective doses to humans are derived. The information generated in the report, in its entirety, should be of direct relevance for both human and non-human impact assessments. (au)

  17. Incorporation of 210Pb and 210Po to Poultry through the Addition of Dicalcium Phosphate (DCP) to the Diet

    Science.gov (United States)

    Casacuberta, N.; Masqué, P.; Garcia-Orellana, J.; Gasa, J.; Anguita, M.

    2008-08-01

    Due to the replacement of calcium by uranium in the phosphorite, sedimentary phosphate rock contains high concentrations of 238U (i.e. from 1500 Bqṡkg-1 in Morocco to 4000 Bqṡkg-1 in Tanzania ores). Dicalcium Phosphate (DCP) is produced by the wet acid digestion of the phosphorite, and is used as a source of calcium and phosphorus for livestock feed supplement. If the phosphorite acid digestion is made with hydrochloric acid, DCP may present specific activities of about 103 Bqṡkg-1 of 238U and some of its decay chain daughters. In particular, due to its radiological implications, the presence of 210Pb and 210Po in DCP is of special relevance. The aim of this work was to investigate the potential incorporation of these radionuclides to poultry through its diet. Three different diets were therefore prepared with different contents of both DCP and 210Pb and 210Po. Diet A was used as a blank, and had a 2.5% in weight of monocalcium phosphate (MCP); diet B, with a 5% in weight of DCP; and diet C, with a 2.5% of DCP. Concentrations of 210Pb were 0.93, 101.4 and 51.2 Bqṡkg-1; whereas concentrations of 210Po were 0.92, 74 and 36 Bqṡkg-1 of food for diets A, B and C, respectively. Accumulation of 210Pb and 210Po was analysed at several times during poultry growth in samples of bone, liver, kidney, muscle, excrements as well as entire animals, with a total of 30 broilers fed with the 3 different diets. Results showed clear enhancements in the accumulation of both 210Pb and 210Po in chicken for diets B and C, and in particular in liver and bone. However, total accumulation of radionuclides in chicken, and especially in edible parts, is low compared to its expulsion through excrements. These results are interpreted in terms of the potential dose through consumption of chicken.

  18. Natural levels of {sup 210}Po in human urine

    Energy Technology Data Exchange (ETDEWEB)

    Diaz-Frances, I.; Manjon, G.; Mantero, J.; Diaz, J. [Departament of Applied Phisic II, University of Seville, P.O. Box 41012 Seville (Spain); Garcia-Tenorio, R. [Departament of Applied Phisic II, University of Seville, P.O. Box 41012 Seville (Spain); National Accelerator Centre, P.O. Box 41092 Seville (Spain)

    2014-07-01

    Since the secret agent Alexander Litvinenko was murdered in 2006 by a {sup 210}Po lethal dose, presumably ingested, there is renovated interest on the toxicity of this radionuclide in humans. {sup 210}Po is a radioactive isotope naturally found in nature, mainly incorporated by humans via food and water ingestion, as well as inhaled through its progenitor, the {sup 222}Rn. The total amount of natural {sup 210}Po in the human body can vary from person to person depending on their lifestyle: dietary habits, drinking water source, place of residence (associated with exposure to {sup 222}Rn), etc- and therefore in the concentrations of this element to be found in urine. To analyze the influence of dietary habits on the amount of {sup 210}Po excreted in urine, two volunteers in Seville had a well-defined and time-varying diet for a month, following a daily collection of their urine and determination of the concentrations therein of this radionuclide. The results obtained and the conclusions derived from them form the core of this communication. {sup 210}Po determinations were performed daily in 200 ml aliquots of urine using the technique of high resolution alpha spectrometry. This has involved the application of a single radiochemical method for the concentration and isolation {sup 210}Po, followed by its auto-deposition on copper planchets for proper measure. Daily {sup 210}Po activity concentrations in voluntary urine analyzed during the month of study show high variability with a difference of up to an order of magnitude between maximum and minimum values obtained, and a clear dependence on the diet type followed in the various stages of the experiment. The lowest concentrations obtained are associated with a diet rich in carbohydrates and proteins 'terrestrial' (pork, beef,...), while the highest concentrations were obtained in the final phase of the experiment when the diet was enriched with presence of marine products in fair correspondence with the

  19. The Radiological Impact of 210Pb and 210Po Released from the Iron- and Steel-Making Plant ILVA in Taranto (Italy on the Environment and the Public

    Directory of Open Access Journals (Sweden)

    Guogang Jia

    2013-01-01

    Full Text Available Lead-210 and 210Po are naturally occurring radionuclides. Due to volatile characteristic of lead and polonium, environmental pollution of 210Pb and 210Po released from the coal power plant, steel-making industry and refractory material industry has been an exposure problem for the members of public. In this paper studies on the activity concentrations of 210Po and 210Pb in the raw materials, dust particles, surficial soils and atmospheric particulate samples collected in the area of the Iron- and Steel-Making Plant ILVA Taranto (Italy were made. These data have been used to evaluate the source-term, distributions, inventories, mass balance, biological availability, ecological migration processes and public exposure risk of 210Pb and 210Po in the concerned environment.

  20. MicroRNA-210: A unique and pleiotropic hypoxamir

    Science.gov (United States)

    Chan, Stephen Y.; Loscalzo, Joseph

    2010-01-01

    Inadequate oxygen availability or hypoxia induces a complex and still incompletely understood set of adaptations that influence cellular survival and function. Many of these adaptations are directly controlled by a master transcription factor, hypoxia inducible factor-alpha (HIF-α). In response to hypoxia, HIF-α levels increase and directly induce the transcription of >100 genes, influencing functions ranging from metabolism, survival, proliferation, migration, to angiogenesis, among others. Recently, it has been demonstrated that a specific set of microRNA molecules are upregulated by hypoxia, which we denote here as “hypoxamirs.” In particular, the HIF-responsive hypoxamir microRNA-210 (miR-210) is a unique microRNA that is evolutionarily conserved and ubiquitously expressed in hypoxic cell and tissue types. A number of direct targets of miR-210 have been identified by in silico, transcriptional and biochemical methods, a subset of which have been extensively validated. As a result, miR-210 has been mechanistically linked to the control of a wide range of cellular responses known to influence normal developmental physiology as well as a number of hypoxia-dependent disease states, including tissue ischemia, inflammation and tumorigenesis. Thus, reflecting the pleiotropic actions of HIF-α, miR-210 appears to function as a “master microRNA” relevant for the control of diverse functions in the hypoxic state. PMID:20237418

  1. Polonium-210 poisoning in London: hypochondriasis and public health.

    Science.gov (United States)

    Morgan, Oliver W; Page, Lisa; Forrester, Sarah; Maguire, Helen

    2008-01-01

    In November 2006, a Russian dissident died from radioactive Polonium-210 (210Po) poisoning in London. Providing reassuring messages during a public health incident may be ineffective for individuals with high health anxiety (hypochondriasis). Members of the public who called a 24-hour telephone helpline were offered a follow-up call by a health protection specialist for reassurance. A psychiatrist attempted to contact those callers who were unable to be reassured by the health protection specialist. Of 872 individuals contacted for reassurance, seven (0.6%) could not be reassured. The psychiatrist contacted four of these individuals. Three had a history of health-related anxiety and two attributed somatic symptoms to 210Po exposure. For individuals with hypochondriasis, reassurance during major public health incidents may be ineffective. Having a psychiatrist available was helpful in managing individuals with excessive health anxiety.

  2. An emergency bioassay method for (210)Po in urine.

    Science.gov (United States)

    Guérin, Nicolas; Dai, Xiongxin

    2015-09-01

    A rapid method was developed to efficiently measure (210)Po in urine samples in an emergency situation. Polonium-210 in small urine samples (10 mL) was spontaneously deposited on a stainless steel disc in 1 M HCl at room temperature for 4 h in a polyethylene bottle. The metallic disc was then counted for 4 h by alpha spectrometry. The developed method allowed the preparation of large sample batch in a short time. The method meets the requirements for an emergency bioassay procedure.

  3. Solid partitioning and solid-liquid distribution of {sup 210}Po and {sup 210}Pb in marine anoxic sediments: roads of Cherbourg at the northwestern France

    Energy Technology Data Exchange (ETDEWEB)

    Connan, O. [Laboratoire de Radioecologie de Cherbourg-Octeville, Institut de Radioprotection et de Surete nucleaire (IRSN), Service d' Etudes et du Comportement des Radionucleides dans l' Environnement (SECRE), rue Max Pol Fouchet, 50130 Cherbourg-Octeville (France)], E-mail: olivier.connan@irsn.fr; Boust, D. [Laboratoire de Radioecologie de Cherbourg-Octeville, Institut de Radioprotection et de Surete nucleaire (IRSN), Service d' Etudes et du Comportement des Radionucleides dans l' Environnement (SECRE), rue Max Pol Fouchet, 50130 Cherbourg-Octeville (France); Billon, G. [Laboratoire de Chimie Analytique et Marine, Universite des sciences et technologies de Lille, 59655 Villeneuve d' Ascq Cedex (France); Solier, L.; Rozet, M.; Bouderbala, S. [Laboratoire de Radioecologie de Cherbourg-Octeville, Institut de Radioprotection et de Surete nucleaire (IRSN), Service d' Etudes et du Comportement des Radionucleides dans l' Environnement (SECRE), rue Max Pol Fouchet, 50130 Cherbourg-Octeville (France)

    2009-10-15

    A sequential extraction protocol has been used to determine the solid-phase partition of {sup 210}Po and {sup 210}Pb in anoxic marine sediment from the roads of Cherbourg (France) in the central English Channel. Measurements were also obtained in pore waters, in which {sup 210}Po activities range between 1 and 20 mBq L{sup -1} and {sup 210}Pb activities between 2.4 and 3.8 mBq L{sup -1}, with highest activities in the topmost layer. These activities are higher than in seawater, suggesting that sediment act as a source of both {sup 210}Po and {sup 210}Pb for overlying water. The {sup 210}Po profile in the pore waters is apparently correlated with those obtained for Fe, Mn and SO{sub 4}{sup 2-}, suggesting an influence of early diagenetic processes on the {sup 210}Po solid-liquid distribution. In the sediment, {sup 210}Po is predominantly bound to organic matter or chromium reducible sulphides, and residuals (clay minerals and refractory oxides). Our results indicate that {sup 210}Po is not significantly bound to AVS, i.e. acid volatile sulphides: bioturbation could play a role by the early redistribution of {sup 210}Po bound to acid volatile sulphides in the sediment. {sup 210}Po, {sup 210}Pb and Pb exhibit differences in terms of distribution, probably due to a different mode of penetration in the sediment. This work provides information on solid and liquid distribution of {sup 210}Po and {sup 210}Pb in marine sediment. These data are very scarce in the litterature.

  4. Radionuclides ((210)Po and (210)Pb) and Some Heavy Metals in Fish and Sediments in Lake Bafa, Turkey, and the Contribution of (210)Po to the Radiation Dose.

    Science.gov (United States)

    Manav, Ramazan; Uğur Görgün, Aysun; Filizok, Işık

    2016-11-09

    The pollution level of Lake Bafa was investigated by collecting fish samples {Dicentrarchus labrax (sea bass), Liza ramada (mullet) and Anguilla anguilla (eel)}, surface sediment, and core samples. In all these samples, (210)Po and (210)Pb concentrations were estimated, and total annual dose rates were obtained for each species. Some heavy metal (Cr, Ni, Pb, Cd, Mn, Fe, and Zn) concentration levels were obtained for the fish and a core sample. The sediment mass accumulation rate was found to be 3.27 g·m(-2)·day(-1) (0.119 g·cm(-2)·y(-1)) from a core sample. The heavy metal concentrations in the vertical profile of samples from the core were also observed. The measured concentration of Zn, Pb, Cd, and Cr were between the ERL (effects range low) and ERM (effects range median) limits, while Ni concentrations were higher than the ERM limit. The observed concentrations of Cd, Pb, and Zn in fish samples did not exceed the limits in accordance with Turkish Food Regulations. Further, the maximum effective dose equivalent of (210)Po in the area was found to be 1.169 µSv·y(-1).

  5. Radionuclides (210Po and 210Pb) and Some Heavy Metals in Fish and Sediments in Lake Bafa, Turkey, and the Contribution of 210Po to the Radiation Dose

    Science.gov (United States)

    Manav, Ramazan; Uğur Görgün, Aysun; Filizok, Işık

    2016-01-01

    The pollution level of Lake Bafa was investigated by collecting fish samples {Dicentrarchus labrax (sea bass), Liza ramada (mullet) and Anguilla anguilla (eel)}, surface sediment, and core samples. In all these samples, 210Po and 210Pb concentrations were estimated, and total annual dose rates were obtained for each species. Some heavy metal (Cr, Ni, Pb, Cd, Mn, Fe, and Zn) concentration levels were obtained for the fish and a core sample. The sediment mass accumulation rate was found to be 3.27 g·m−2·day−1 (0.119 g·cm−2·y−1) from a core sample. The heavy metal concentrations in the vertical profile of samples from the core were also observed. The measured concentration of Zn, Pb, Cd, and Cr were between the ERL (effects range low) and ERM (effects range median) limits, while Ni concentrations were higher than the ERM limit. The observed concentrations of Cd, Pb, and Zn in fish samples did not exceed the limits in accordance with Turkish Food Regulations. Further, the maximum effective dose equivalent of 210Po in the area was found to be 1.169 µSv·y−1. PMID:27834886

  6. Radionuclides (210Po and 210Pb and Some Heavy Metals in Fish and Sediments in Lake Bafa, Turkey, and the Contribution of 210Po to the Radiation Dose

    Directory of Open Access Journals (Sweden)

    Ramazan Manav

    2016-11-01

    Full Text Available The pollution level of Lake Bafa was investigated by collecting fish samples {Dicentrarchus labrax (sea bass, Liza ramada (mullet and Anguilla anguilla (eel}, surface sediment, and core samples. In all these samples, 210Po and 210Pb concentrations were estimated, and total annual dose rates were obtained for each species. Some heavy metal (Cr, Ni, Pb, Cd, Mn, Fe, and Zn concentration levels were obtained for the fish and a core sample. The sediment mass accumulation rate was found to be 3.27 g·m−2·day−1 (0.119 g·cm−2·y−1 from a core sample. The heavy metal concentrations in the vertical profile of samples from the core were also observed. The measured concentration of Zn, Pb, Cd, and Cr were between the ERL (effects range low and ERM (effects range median limits, while Ni concentrations were higher than the ERM limit. The observed concentrations of Cd, Pb, and Zn in fish samples did not exceed the limits in accordance with Turkish Food Regulations. Further, the maximum effective dose equivalent of 210Po in the area was found to be 1.169 µSv·y−1.

  7. Intact feto-placental growth in microRNA-210 deficient mice.

    Science.gov (United States)

    Krawczynski, Kamil; Mishima, Takuya; Huang, Xin; Sadovsky, Yoel

    2016-11-01

    MicroRNA-210 (miR-210) has been implicated in homeostatic adaptation during hypoxia. We hypothesized that miR-210 deficiency impacts feto-placental growth. As expected, mir-210 knockout (ko) mice exhibited markedly reduced placental miR-210 expression, compared to wild-type (wt) mice. Mating of mir-210 heterozygotes resulted in near Mendelian progeny distribution, with insignificant differences between wt and ko animals with regard to embryo or placental weight and gross morphology. Intriguingly, exposure of mice to non-severe hypoxia (O2 = 12%) between E11.5-E17.5 reduced placental miR-210 expression, with slight expression changes of some miR-210 target mRNAs. Thus, miR-210 is likely dispensable for feto-placental growth in normoxia or non-severe hypoxia. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Seasonal and spatial variations of 210Po and 210Pb activity concentrations in Mytilus galloprovincialis from Croatian coast of the Adriatic Sea.

    Science.gov (United States)

    Rožmarić, Martina; Rogić, Matea; Benedik, Ljudmila; Štrok, Marko; Barišić, Delko

    2013-11-01

    Results of 2 years monitoring of (210)Po and (210)Pb activity concentrations in soft tissue of the species Mytilus galloprovincialis from Croatian part of the Adriatic coast are presented. The samples were collected at thirteen coastal stations (some of which are also a part of the Mediterranean Mussel Watch Project) in spring and autumn of 2010 and 2011. The collected mussels were ranging between 4 cm and 6 cm in shell length. After sample pre-treatment lead and polonium were radiochemically separated on Sr resin. (210)Po was determined by alpha-particle spectrometry and (210)Pb was determined, via (210)Bi, by a low-level gas proportional counter. The results of (210)Po activity concentrations were found to vary between (104±11) and (1421±81) Bq kg(-1) dry weight while (210)Pb activity concentrations were much lower and in range (8.2±5.3)-(94.1±29.8) Bq kg(-1) dry weight. Higher (210)Po and (210)Pb activity concentrations were determined in spring period. The inter-site differences seen in their activity concentrations can be due to natural background levels of sites. The (210)Po/(210)Pb activity concentration ratios in all cases exceeded unity for all mussel samples and ranged between 4.0 and 47.9.

  9. Geochronology of the Rio Formoso estuarine by {sup 210}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Arruda, Gilberto N.; Lyra, Denilson T.; Melo, Julyanne T.B.; Farias, Emerson E.G.; Franca, Elvis J.; Santos, Thiago O., E-mail: gnarruda@cnen.gov.br, E-mail: denilsonengseg@gmail.com, E-mail: julyanne.melo@ufpe.br, E-mail: emersonemiliano@yahoo.com.br, E-mail: ejfranca@cnen.gov.br [Centro Regional de Ciencias Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, Joao A., E-mail: adauto@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

    2015-07-01

    Uranium series disequilibrium is useful for dating methods, in which profile sediments can be considered as historical records of anthropogenic events regarding the distribution and impacts of chemical substances on the environment. In this study, 2 deep sediment profiles (about 1 m) were collected, layered at each 3 cm, oven-dried and homogenized. The radiochemical separation of {sup 210}Pb consisted of using hydrobromic acid and an ion exchange resin (DOWEX) for precipitating {sup 210}Pb in the form of lead chromate. After 10 days, the radioactivity was therefore measured by means of the low level gas flow proportional counter, model S5-XLB, from Canberra. Sedimentation rate were obtained by CIC (Constant Initial Concentration) model assumes a constant sedimentation rate throughout the period over which unsupported {sup 210}Pb is measurable. Some sediment profiles were not dated since the percentage of sand was quite high in top layers or a high percentage of organic matter and water in excess were observed in the all sediment samples. {sup 210}Pb geochronology was successfully applied to age nine sediment profiles, in which higher sedimentation rates were observed in the middle portion of the estuarine probably related to shrimp farming impacts. By using geochronology, the detection of human impacts on chemical element distribution could be enhanced in the case of environmental monitoring studies in the Rio Formoso estuarine. (author)

  10. 17 CFR 210.5-03 - Income statements.

    Science.gov (United States)

    2010-04-01

    ..., PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF... discounts, returns and allowances), (b) operating revenues of public utilities or others; (c) income from... parties shall be disclosed as required under § 210.4-08(k). A public utility company using a...

  11. 12 CFR 210.25 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ... incorporated herein, shall not apply. (c) Operating Circulars. Each Federal Reserve Bank shall issue an... organization; (3) A foreign central bank; and (4) A department, agency, instrumentality, independent... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Authority, purpose, and scope. 210.25...

  12. 9 CFR 93.210 - Poultry quarantine facilities.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Poultry quarantine facilities. 93.210... AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS;...

  13. 33 CFR 104.210 - Company Security Officer (CSO).

    Science.gov (United States)

    2010-07-01

    ... inspections under 46 CFR part 2; (7) Ensure the timely or prompt correction of problems identified by audits... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Company Security Officer (CSO... MARITIME SECURITY MARITIME SECURITY: VESSELS Vessel Security Requirements § 104.210 Company...

  14. 17 CFR 210.11-01 - Presentation requirements.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Presentation requirements. 210....11-01 Presentation requirements. (a) Pro forma financial information shall be furnished when any of... was a part of another entity and such presentation is necessary to reflect operations and...

  15. Bioaccumulation of polonium 210Po in marine birds.

    Science.gov (United States)

    Skwarzec, B; Fabisiak, J

    2007-01-01

    The aim of this work was to determine the 210Po content in marine birds which permanently or temporally live in the Polish part of the Baltic Sea. We chose 11 species of sea birds: three species permanently residing at southern Baltic Sea, four species of wintering birds and three species of migrating birds. The results show that the polonium is non-uniformly distributed in the marine birds. The highest activities of 210Po were observed in feathers, muscles and liver and the lowest in skin and skeleton. Species of birds that eat crustaceans, molluscs, fish and plants (long-tailed duck Clangula hyemalis, white-winged scoter Melanitta fusca) accumulated more polonium than species that eat mainly fish (great cormorant Phalacrocorax carbo, common guillemot Uria aalge) or plants (tufted duck Aythya fuligula). Moreover, about 63% of the 210Po that was located in feathers of razorbil (Alca torda) and long-tailed duck (C. hyemalis) was apparently adsorbed, suggesting an external source such as the air. It means that the adsorption of 210Po on the feather surface may be an important transfer from air to water.

  16. Polonium 210Po in cigarettes produced in Poland.

    Science.gov (United States)

    Skwarzec, B; Strumińska, D I; Borylo, A; Ulatowski, J

    2001-01-01

    This paper discusses the results of 210Po determinations in the fourteen most frequently smoked brands of cigarettes, which constitute over 80% of total cigarette consumption in Poland. The 210Po activity in the cigarette samples analysed (tobacco, ash, filter before and after smoking) were measured using alpha spectrometry (Canberra-Packard). The data indicates that there is considerable variation in the polonium content of these brands. The highest 210Po content per sample was found in the cheap "Popularne" brand (24.12 mBq), the lowest in "Caro" (4.23 mBq). There was also a large difference between the polonium remaining in the ash in comparison with its total content in the tobacco in all the brands (from 4.3% for "Golden American" to 71.0% for "Sobieski King-Size"). The analysis has demonstrated that filters absorbed only a small amount of the polonium contained in the tobacco. "Caro" cigarettes have the most efficient filter, retaining 25.1% of the polonium contained in the tobacco, but most filters absorbed only 0.1-7.2% of polonium. The daily inhalation of 210Po by Polish smokers who get through one pack per day ranges from 20 to 215 mBq, but people smoking two or more packs of "Popularne" brand will inhale over 430 mBq of polonium per day.

  17. The polonium-210 poisoning of Mr Alexander Litvinenko.

    Science.gov (United States)

    Harrison, John; Fell, Tim; Leggett, Rich; Lloyd, David; Puncher, Matthew; Youngman, Mike

    2017-03-20

    Mr Litvinenko died on 23 November 2006 after having been poisoned with polonium-210 on 1 November. Measurements of the polonium-210 content of post-mortem tissue samples and samples of urine and blood showed the presence of large amounts of (210)Po. Autoradiography of hair samples showed two regions of (210)Po activity, providing evidence of an earlier poisoning attempt during October 2006, resulting in absorption to blood of about one-hundredth of that estimated for 1 November. Intake by ingestion on 1 November was estimated to be around 4 GBq, assuming 10% absorption to blood, and the resulting organ doses reached estimated values that were generally in a range from about 20 Gy to over 100 Gy. Comparison with estimates of protracted alpha particle doses required to cause irreversible organ damage supported the conclusion that death was the inevitable consequence of multiple organ failure, with destruction of the haemopoietic bone marrow, as well as damage to kidneys and liver, being important contributors. If the earlier poisoning during October 2006 had not been followed by a second major intake on 1 November, it is possible that the earlier intake of around 40 MBq, with absorption of 4 MBq to blood, might have caused irreversible kidney damage over a prolonged period of months or years, with doses of approaching 3 Gy.

  18. 5 CFR 842.210 - Military reserve technicians.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Military reserve technicians. 842.210... reserve technicians. (a) A military reserve technician as defined in 5 U.S.C. 8401(30) who is separated from civilian service because of ceasing to qualify as a member of a military reserve component...

  19. Pb-210 in beans grown in normal background environments

    Energy Technology Data Exchange (ETDEWEB)

    Mingote, Raquel M.; Nogueira, Regina A., E-mail: mingote@cnen.gov.br, E-mail: rnogueira@cnen.gov.br [Centro Regional de Ciencias Nucleares do Centro-Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil)

    2013-07-01

    A survey was carried out on the activity concentration of {sup 210}Pb in common beans (Phaseolus vulgaris L.) grown in normal background environments in Brazil. The Carioca beans and the black type were analyzed, which contribute with 90% of the Brazilian market share of the common beans. To this study 18 bean samples sowing in the Middle-Western and Southern regions of Brazil during the years 2010-2011 were analyzed. The proportion per bean type was similar to the national production: most of the Carioca beans (n=13; 72%) and black beans (n=5; 28%). Other 17 values of {sup 210}Pb activity concentration in beans grown in Southeastern region available in the GEORAD, a dataset of radioactivity in Brazil, were added to the statistic analysis of the data. Considering the information contained in censored observations (60%), representative value of {sup 210}Pb activity concentration in beans was estimated by using robust ROS, a censored data analysis method. The value 0.047 Bq kg{sup -1} fresh wt. obtained here is according to {sup 210}Pb activity concentration in grains reported by UNSCEAR 0.05 Bq kg{sup -1}. (author)

  20. 28 CFR 2.10 - Date service of sentence commences.

    Science.gov (United States)

    2010-07-01

    ... Section 2.10 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2... civil contempt is lifted. (c) Service of the sentence of a committed youth offender or person committed...

  1. 40 CFR 1065.210 - Work input and output sensors.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Work input and output sensors. 1065... Ambient Conditions § 1065.210 Work input and output sensors. (a) Application. Use instruments as specified... sensors, transducers, and meters that meet the specifications in Table 1 of § 1065.205. Note that your...

  2. 48 CFR 1852.210-70 - Brand name or equal.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Brand name or equal. 1852... 1852.210-70 Brand name or equal. As prescribed in 1810.011-70(a), insert the following provision: Brand Name or Equal (DEC 1988) (a) As used in this provision, “brand name” means identification of...

  3. Bioaccumulation of polonium {sup 210}Po in marine birds

    Energy Technology Data Exchange (ETDEWEB)

    Skwarzec, B. [University of Gdansk, Faculty of Chemistry, Chair of Analytical Chemistry, ul. Sobieskiego 18/19, 80-952 Gdansk (Poland)]. E-mail: bosk@chemik.chem.univ.gda.pl; Fabisiak, J. [Naval Academy, Smidowicza 61, 81-103 Gdynia (Poland)

    2007-07-01

    The aim of this work was to determine the {sup 210}Po content in marine birds which permanently or temporally live in the Polish part of the Baltic Sea. We chose 11 species of sea birds: three species permanently residing at southern Baltic Sea, four species of wintering birds and three species of migrating birds. The results show that the polonium is non-uniformly distributed in the marine birds. The highest activities of {sup 210}Po were observed in feathers, muscles and liver and the lowest in skin and skeleton. Species of birds that eat crustaceans, molluscs, fish and plants (long-tailed duck Clangula hyemalis, white-winged scoter Melanitta fusca) accumulated more polonium than species that eat mainly fish (great cormorant Phalacrocorax carbo, common guillemot Uria aalge) or plants (tufted duck Aythya fuligula). Moreover, about 63% of the {sup 210}Po that was located in feathers of razorbil (Alca torda) and long-tailed duck (C. hyemalis) was apparently adsorbed, suggesting an external source such as the air. It means that the adsorption of {sup 210}Po on the feather surface may be an important transfer from air to water.

  4. 17 CFR 210.7-03 - Balance sheets.

    Science.gov (United States)

    2010-04-01

    ...) retained earnings (i) appropriated and (ii) unappropriated. (See § 210.4-08(e).) Additional paid-in capital..., savings accounts, time deposits and other cash accounts and cash equivalents earning interest. State in a... contracts without life contingencies, policyholders' dividend accumulations, undistributed earnings on...

  5. 17 CFR 210.6-07 - Statements of operations.

    Science.gov (United States)

    2010-04-01

    ... CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Registered Investment Companies § 210.6-07...

  6. 17 CFR 210.6-04 - Balance sheets.

    Science.gov (United States)

    2010-04-01

    ... AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Registered Investment Companies § 210.6-04 Balance...

  7. 17 CFR 210.6-02 - Definition of certain terms.

    Science.gov (United States)

    2010-04-01

    ... AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Registered Investment Companies § 210...

  8. 17 CFR 210.6-05 - Statements of net assets.

    Science.gov (United States)

    2010-04-01

    ... CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Registered Investment Companies § 210.6-05...

  9. Radioecological modelling of Polonium-210 and Caesium-137 in lichen-reindeer-man and top predators.

    Science.gov (United States)

    Persson, Bertil R R; Gjelsvik, Runhild; Holm, Elis

    2017-09-01

    This work deals with analysis and modelling of the radionuclides (210)Pb and(210)Po in the food-chain lichen-reindeer-man in addition to (210)Po and (137)Cs in top predators. By using the methods of Partial Least Square Regression (PLSR) the atmospheric deposition of (210)Pb and (210)Po is predicted at the sample locations. Dynamic modelling of the activity concentration with differential equations is fitted to the sample data. Reindeer lichen consumption, gastrointestinal absorption, organ distribution and elimination is derived from information in the literature. Dynamic modelling of transfer of (210)Pb and (210)Po to reindeer meat, liver and bone from lichen consumption, fitted well with data from Sweden and Finland from 1966 to 1971. The activity concentration of (210)Pb in the skeleton in man is modelled by using the results of studying the kinetics of lead in skeleton and blood in lead-workers after end of occupational exposure. The result of modelling (210)Pb and (210)Po activity in skeleton matched well with concentrations of (210)Pb and (210)Po in teeth from reindeer-breeders and autopsy bone samples in Finland. The results of (210)Po and (137)Cs in different tissues of wolf, wolverine and lynx previously published, are analysed with multivariate data processing methods such as Principal Component Analysis PCA, and modelled with the method of Projection to Latent Structures, PLS, or Partial Least Square Regression PLSR. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. 210Po, 210Pb, 40K and 137Cs in edible wild berries and mushrooms and ingestion doses to man from high consumption rates of these wild foods.

    Science.gov (United States)

    Gwynn, Justin P; Nalbandyan, Anna; Rudolfsen, Geir

    2013-02-01

    This paper discusses activity concentrations of (210)Po, (210)Pb, (40)K and (137)Cs in edible wild berries and mushrooms collected from Øvre Dividalen national park, Northern Norway and derives committed effective ingestion doses to man based on high consumption rates of these wild foods. Edible wild berries and mushrooms accumulated similar levels of (210)Pb, but mushrooms accumulated higher levels of (210)Po and (40)K than berries. There appears to be a clear difference in the ability of Leccinum spp. of fungi to accumulate (210)Po and/or translocate (210)Po to mushrooms compared to Russula spp. of fungi. Activity concentrations of (137)Cs in edible wild berries and mushrooms from Øvre Dividalen national park reflected the lower levels of fallout of this radionuclide in Northern Norway compared to more central areas following the Chernobyl accident. For mushrooms, ingestion doses are dominated by (210)Po, while for berries, (40)K is typically the main contributor to dose. Based on high consumption rates, ingestion doses arising from the combination of (210)Po, (210)Pb and (40)K were up to 0.05 mSv/a for berries and 0.50 mSv/a for mushrooms. Consumption of such wild foods may result in a significant contribution to total annual doses when consumed in large quantities, particularly when selecting mushrooms species that accumulate high activity concentrations of (210)Po.

  11. 210Pb and 210Po, manganese and iron cycling across the O2/H2S interface of a permanently anoxic fjord: Framvaren, Norway

    Science.gov (United States)

    Swarzenski, Peter W.; McKee, Brent A.; Sorensen, Kai; Todd, James F.

    1999-01-01

    Vertical profiles of dissolved and particulate 210Po and 210b were measured across the redox transition zone at Station F1 in Framvaren Fjord, Norway. In this fjord, a sharp decrease in pH above the O2/H2S interface facilitates the aerobic dissolution of MnO2. In contrast, Fe(II) concentrations begin to increase only at the O2/H2S interface depth. Activity profiles reveal that dissolved 210Po and 210Pb are sequestered efficiently by particulates in surface waters. As polonium-210 and lead-210 activities descend down into the aerobic manganese reduction (AMR) zone, they are remobilized during the reductive dissolution of the carrier phase oxyhydroxides. Both 210Po and 210Pb are highly enriched at the O2/H2S interface where an active community of microbes, such as anoxygenic phototrophs (e.g., Chromatium, Chlorobium sp.), thrives. The coincident peaks in 210Po, 210Pb and microbial biomass suggest a strong biological influence on the behavior of these radionuclides. There is a strong covariance between the vertical distribution of Mn and Pb, indicating that their redox cycling is closely coupled and is likely microbially mediated.

  12. A study on possible use of Urtica dioica (common nettle) plant as polonium (210)Po and lead (210)Pb contamination biomonitor in the area of phosphogypsum stockpile.

    Science.gov (United States)

    Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan

    2016-04-01

    The aim of this study was to test a possible use of Urtica dioica (common nettle) plant as a biomonitor of polonium (210)Po and lead (210)Pb contamination near phosphogypsum stacks by determining concentrations of these radionuclides in samples collected from the area of phosphogypsum stockpile in Wiślinka (northern Poland). The (210)Po and (210)Pb contents in roots depended on their concentrations in soils. Bioconcentration factor values from soil to root of the plant did not depend on (210)Po and (210)Pb contents in soils that leads to the conclusion that different polonium and lead species have different affinities to U. dioica plants. The main sources of both analyzed radionuclides in green parts of plants are wet and dry air deposition and transportation from soil. The values of (210)Po/(210)Pb activity ratio indicate natural origin of these radioisotopes in analyzed plants. (210)Po and (210)Pb concentration in U. dioica roots is negatively weakly correlated with distance from phosphogypsum stockpile.

  13. Polonium-210 poisoning: a first-hand account.

    Science.gov (United States)

    Nathwani, Amit C; Down, James F; Goldstone, John; Yassin, James; Dargan, Paul I; Virchis, Andres; Gent, Nick; Lloyd, David; Harrison, John D

    2016-09-10

    Polonium-210 ((210)Po) gained widespread notoriety after the poisoning and subsequent death of Mr Alexander Litvinenko in London, UK, in 2006. Exposure to (210)Po resulted initially in a clinical course that was indistinguishable from infection or exposure to chemical toxins, such as thallium. A 43-year-old man presented to his local hospital with acute abdominal pain, diarrhoea, and vomiting, and was admitted to the hospital because of dehydration and persistent gastrointestinal symptoms. He was initially diagnosed with gastroenteritis and treated with antibiotics. Clostridium difficile toxin was subsequently detected in his stools, which is when he first raised the possibility of being poisoned and revealed his background and former identity, having been admitted under a new identity with which he had been provided on being granted asylum in the UK. Within 6 days, the patient had developed thrombocytopenia and neutropenia, which was initially thought to be drug induced. By 2 weeks, in addition to bone marrow failure, he had evidence of alopecia and mucositis. Thallium poisoning was suspected and investigated but ultimately dismissed because blood levels of thallium, although raised, were lower than toxic concentrations. The patient continued to deteriorate and within 3 weeks had developed multiple organ failure requiring ventilation, haemofiltration, and cardiac support, associated with a drop in consciousness. On the 23rd day after he first became ill, he suffered a pulseless electrical activity cardiorespiratory arrest from which he could not be resuscitated and was pronounced dead. Urine analysis using gamma-ray spectroscopy on day 22 showed a characteristic 803 keV photon emission, raising the possibility of (210)Po poisoning. Results of confirmatory analysis that became available after the patient's death established the presence of (210)Po at concentrations about 10(9)-times higher than normal background levels. Post-mortem tissue analyses showed autolysis

  14. Particle-reactive radionuclides (234Th, 210Pb, 210 as tracers for the estimation of export production in the South China Sea

    Directory of Open Access Journals (Sweden)

    P. H. Santschi

    2011-12-01

    Full Text Available The time-series station, SEATS (18° N, 116° E in the South China Sea was visited six times during October 2006–December 2008 to carry out seawater sampling and floating trap deployments for the determination of distributions and fluxes of POC, PIC, PN, 234Th, 210Pb, and 210Po in the upper 200 m of the water column. Radionuclide deficiencies resulted in removal fluxes from the euphotic layer of 1.1×103–1.8×103 dpm m−2d−1 and 7.1–40.2 dpm m−2d−1 for 234Th and 210Po, respectively. Due to atmospheric input, an excess of 210Pb relative to 226Ra is commonly observed in the upper water column. Sinking fluxes of total mass, POC, PIC, PN, 234Th, 210Pb, and 210Po measured at the euphotic depth were low in summer-fall and high in winter-spring, reflecting the seasonal variability of biological pumping. Excluding the suspiciously low primary productivity data point in July 2007, a relatively high e-ratio of 0.28–0.69 was estimated by the ratio of the POC flux at the euphotic depth and the integrated primary productivity. The ratios of 234Th, 210Pb, and 210Po to organic carbon, inorganic carbon, and nitrogen in the sinking particles were combined with the disequilibria of 234Th–238U, 210Pb–226Ra, and 210Po–210Pb to estimate export fluxes of POC, PIC, and PN from the euphotic layer. Compared with measured fluxes by the sediment trap and estimated fluxes by other approaches, it is concluded that the export production in the South China Sea, ranging from 1.8 to 21.3 mmol-C m−2d−1, can be reasonably estimated using 234Th, 210Pb, and 210Po as carbon proxies.

  15. Particle-reactive radionuclides (234Th, 210Pb, 210Po as tracers for the estimation of export production in the South China Sea

    Directory of Open Access Journals (Sweden)

    P. H. Santschi

    2011-09-01

    Full Text Available The time-series station, SEATS (18° N, 116° E in the South China Sea was visited six times during October 2006–December 2008 to carry out seawater sampling and floating trap deployments for the determination of distributions and fluxes of POC, PIC, PN, 234Th, 210Pb, and 210Po in the upper 200 m of the water column. Radionuclide deficiencies resulted in removal fluxes from the euphotic layer of 1.1 × 103–1.8 × 103 dpm m−2 d−1 and 7.1–40.2 dpm m−2 d−1 for 234Th and 210Po, respectively. Due to atmospheric input, an excess of 210Pb relative to 226Ra is commonly observed in the upper water column. Sinking fluxes of total mass, POC, PIC, PN, 234Th, 210Pb, and 210Po measured at the euphotic depth were low in summer-fall and high in winter-spring, reflecting the seasonal variability of biological pumping. Excluding the suspiciously low primary productivity data point in July 2007, a relatively high e-ratio of 0.28–0.69 was estimated by the ratio of the POC flux at the euphotic depth and the integrated primary productivity. The ratios of 234Th, 210Pb, and 210Po to organic carbon, inorganic carbon, and nitrogen in the sinking particles were combined with the disequilibria of 234Th-238U, 210Pb-226Ra, and 210Po-210Pb to estimate export fluxes of POC, PIC, and PN from the euphotic layer. Compared with measured fluxes by the sediment trap and estimated fluxes by other approaches, it is concluded that the export production in the South China Sea, ranging from 1.8 to 21.3 mmol-C m−2 d−1, can be reasonably estimated using 234Th, 210Pb, and 210Po as carbon proxies.

  16. Hypoxia-Induced miR-210 Modulates Tissue Response to Acute Peripheral Ischemia

    Science.gov (United States)

    Zaccagnini, Germana; Maimone, Biagina; Di Stefano, Valeria; Fasanaro, Pasquale; Greco, Simona; Perfetti, Alessandra; Capogrossi, Maurizio C.; Gaetano, Carlo

    2014-01-01

    Abstract Aims: Peripheral artery disease is caused by the restriction or occlusion of arteries supplying the leg. Better understanding of the molecular mechanisms underpinning tissue response to ischemia is urgently needed to improve therapeutic options. The aim of this study is to investigate hypoxia-induced miR-210 regulation and its role in a mouse model of hindlimb ischemia. Results: miR-210 expression was induced by femoral artery dissection. To study the role of miR-210, its function was inhibited by the systemic administration of a miR-210 complementary locked nucleic acid (LNA)-oligonucleotide (anti-miR-210). In the ischemic skeletal muscle, anti-miR-210 caused a marked decrease of miR-210 compared with LNA-scramble control, while miR-210 target expression increased accordingly. Histological evaluation of acute tissue damage showed that miR-210 inhibition increased both apoptosis at 1 day and necrosis at 3 days. Capillary density decrease caused by ischemia was significantly more pronounced in anti-miR-210-treated mice; residual limb perfusion decreased accordingly. To investigate the molecular mechanisms underpinning the increased damage triggered by miR-210 blockade, we tested the impact of anti-miR-210 treatment on the transcriptome. Gene expression analysis highlighted the deregulation of mitochondrial function and redox balance. Accordingly, oxidative damage was more severe in the ischemic limb of anti-miR-210-treated mice and miR-210 inhibition increased oxidative metabolism. Further, oxidative-stress resistant p66Shc-null mice displayed decreased tissue damage following ischemia. Innovation: This study identifies miR-210 as a crucial element in the adaptive mechanisms to acute peripheral ischemia. Conclusions: The physiopathological significance of miR-210 is context dependent. In the ischemic skeletal muscle it seems to be cytoprotective, regulating oxidative metabolism and oxidative stress. Antioxid. Redox Signal. 21, 1177–1188. PMID:23931770

  17. 210Po in Nevada groundwater and its relation to gross alpha radioactivity

    Science.gov (United States)

    Seiler, R.L.

    2011-01-01

    Polonium-210 (210Po) is a highly toxic alpha emitter that is rarely found in groundwater at activities exceeding 1 pCi/L. 210Po activities in 63 domestic and public-supply wells in Lahontan Valley in Churchill County in northern Nevada, United States, ranged from 0.01 ± 0.005 to 178 ± 16 pCi/L with a median activity of 2.88 pCi/L. Wells with high 210Po activities had low dissolved oxygen concentrations (less than 0.1 mg/L) and commonly had pH greater than 9. Lead-210 activities are low and aqueous 210Po is unsupported by 210Pb, indicating that the 210Po is mobilized from aquifer sediments. The only significant contributors to alpha particle activity in Lahontan Valley groundwater are 234/238U, 222Rn, and 210Po. Radon-222 activities were below 1000 pCi/L and were uncorrelated with 210Po activity. The only applicable drinking water standard for 210Po in the United States is the adjusted gross alpha radioactivity (GAR) standard of 15 pCi/L. 210Po was not volatile in a Nevada well, but volatile 210Po has been reported in a Florida well. Additional information on the volatility of 210Po is needed because GAR is an inappropriate method to screen for volatile radionuclides. About 25% of the samples had 210Po activities that exceed the level associated with a lifetime total cancer risk of 1× 10−4 (1.1 pCi/L) without exceeding the GAR standard. In cases where the 72-h GAR exceeds the uranium activity by more than 5 to 10 pCi/L, an analysis to rule out the presence of 210Po may be justified to protect human health even though the maximum contaminant level for adjusted GAR is not exceeded.

  18. 17 CFR 210.2-05 - Examination of financial statements by more than one accountant.

    Science.gov (United States)

    2010-04-01

    ... statements by more than one accountant. 210.2-05 Section 210.2-05 Commodity and Securities Exchanges... Qualifications and Reports of Accountants § 210.2-05 Examination of financial statements by more than one accountant. If, with respect to the examination of the financial statements, part of the examination is...

  19. 27 CFR 24.210 - Classes of wine other than standard wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Classes of wine other than standard wine. 24.210 Section 24.210 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.210...

  20. 5 CFR 792.210 - What is the definition of civilian employee?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false What is the definition of civilian employee? 792.210 Section 792.210 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL... Legislation and to Whom Does It Apply? § 792.210 What is the definition of civilian employee? The term...

  1. 5 CFR 210.101 - Applicability of various parts of regulations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Applicability of various parts of regulations. 210.101 Section 210.101 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS BASIC CONCEPTS AND DEFINITIONS (GENERAL) Applicability of Regulations; Definitions § 210.101...

  2. 27 CFR 44.210 - Return of shipment to factory or export warehouse.

    Science.gov (United States)

    2010-04-01

    ... factory or export warehouse. 44.210 Section 44.210 Alcohol, Tobacco Products and Firearms ALCOHOL AND... Proprietors Miscellaneous Provisions § 44.210 Return of shipment to factory or export warehouse. A manufacturer or export warehouse proprietor may return to his factory or export warehouse, without...

  3. 17 CFR 210.8-06 - Real estate operations acquired or to be acquired.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Real estate operations acquired or to be acquired. 210.8-06 Section 210.8-06 Commodity and Securities Exchanges SECURITIES AND... Statements of Smaller Reporting Companies § 210.8-06 Real estate operations acquired or to be acquired. If...

  4. 20 CFR 666.210 - How may Incentive Grant funds be used?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How may Incentive Grant funds be used? 666.210 Section 666.210 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR... Performance § 666.210 How may Incentive Grant funds be used? Incentive grant funds are awarded to States...

  5. 17 CFR 210.3-14 - Special instructions for real estate operations to be acquired.

    Science.gov (United States)

    2010-04-01

    ... General Instructions As to Financial Statements § 210.3-14 Special instructions for real estate operations... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Special instructions for real estate operations to be acquired. 210.3-14 Section 210.3-14 Commodity and Securities Exchanges...

  6. 20 CFR 703.210 - Increase or reduction in security deposit amount.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Increase or reduction in security deposit amount. 703.210 Section 703.210 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF... Insurance Carrier Security Deposit Requirements § 703.210 Increase or reduction in security deposit amount...

  7. 40 CFR 92.210 - Amending the application and certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... certificate of conformity. 92.210 Section 92.210 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Certification Provisions § 92.210 Amending the application and certificate of conformity. (a) The manufacturer... covered by a certificate of conformity. This notification must include a request to amend the...

  8. 40 CFR 94.210 - Amending the application and certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... certificate of conformity. 94.210 Section 94.210 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Certification Provisions § 94.210 Amending the application and certificate of conformity. (a) The manufacturer... for certification are to be made to a product line covered by a certificate of conformity....

  9. 5 CFR 295.210 - Procedure in the event of an adverse ruling.

    Science.gov (United States)

    2010-01-01

    ... ruling. 295.210 Section 295.210 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE... LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 295.210 Procedure in the event of... by counsel not to provide the requested testimony or produce documents, and respectfully decline...

  10. 33 CFR 162.210 - Lake Tahoe, Calif.; restricted areas along south shore.

    Science.gov (United States)

    2010-07-01

    ... § 162.210 Lake Tahoe, Calif.; restricted areas along south shore. (a) The areas—(1) Baldwin Beach, under... areas along south shore. 162.210 Section 162.210 Navigation and Navigable Waters COAST GUARD, DEPARTMENT...) Pope Beach, under the control of the Forest Service, Department of Agriculture. The waters of...

  11. 23 CFR 972.210 - Federal lands bridge management system (BMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands bridge management system (BMS). 972.210 Section 972.210 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL LANDS....210 Federal lands bridge management system (BMS). In addition to the requirements provided in §...

  12. 23 CFR 973.210 - Indian lands bridge management system (BMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands bridge management system (BMS). 973.210 Section 973.210 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL LANDS... PROGRAM Bureau of Indian Affairs Management Systems § 973.210 Indian lands bridge management system...

  13. 9 CFR 354.210 - Minimum standards for sanitation, facilities, and operating procedures in official plants.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Minimum standards for sanitation, facilities, and operating procedures in official plants. 354.210 Section 354.210 Animals and Animal Products... sanitation, facilities, and operating procedures in official plants. The provisions of §§ 354.210 to...

  14. 25 CFR 171.210 - Where will BIA provide my irrigation service?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Where will BIA provide my irrigation service? 171.210 Section 171.210 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER IRRIGATION OPERATION AND MAINTENANCE Irrigation Service § 171.210 Where will BIA provide my irrigation service? (a)...

  15. 13 CFR 113.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-01-01

    ... educational institutions. 113.210 Section 113.210 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... Financial Assistance Coverage § 113.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training...

  16. 18 CFR 1317.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-04-01

    ... marine educational institutions. 1317.210 Section 1317.210 Conservation of Power and Water Resources... RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 1317.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose...

  17. 31 CFR 28.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... educational institutions. 28.210 Section 28.210 Money and Finance: Treasury Office of the Secretary of the... FINANCIAL ASSISTANCE Coverage § 28.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of...

  18. 15 CFR 8a.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-01-01

    ... educational institutions. 8a.210 Section 8a.210 Commerce and Foreign Trade Office of the Secretary of Commerce... Coverage § 8a.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a...

  19. 38 CFR 23.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... marine educational institutions. 23.210 Section 23.210 Pensions, Bonuses, and Veterans' Relief DEPARTMENT... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 23.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose...

  20. 41 CFR 101-4.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... marine educational institutions. 101-4.210 Section 101-4.210 Public Contracts and Property Management... Coverage § 101-4.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for...

  1. 40 CFR 270.210 - What records must I maintain concerning my RAP?

    Science.gov (United States)

    2010-07-01

    ... concerning my RAP? 270.210 Section 270.210 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Remedial Action Plans (RAPs) Operating Under Your Rap § 270.210 What records must I maintain concerning my RAP? You are required to keep records of: (a) All data used to complete RAP applications and any...

  2. 41 CFR 102-38.210 - What happens when bids have been rejected?

    Science.gov (United States)

    2010-07-01

    ... have been rejected? 102-38.210 Section 102-38.210 Public Contracts and Property Management Federal... OF PERSONAL PROPERTY Bids Acceptance of Bids § 102-38.210 What happens when bids have been rejected? You may re-offer items for which all bids have been rejected at the same sale, if possible, or...

  3. 17 CFR 210.12-28 - Real estate and accumulated depreciation. 1

    Science.gov (United States)

    2010-04-01

    ... depreciation. 1 210.12-28 Section 210.12-28 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... § 210.12-28 Real estate and accumulated depreciation. 1 Column A—Description 2 Column B—Encumbrances... Land Buildings and improvements Total Column F—Accumulated depreciation Column G—Date of...

  4. Biomonitoring of {sup 210}Po and {sup 210}Pb using lichens and mosses around coal-fired power plants in Western Turkey

    Energy Technology Data Exchange (ETDEWEB)

    Sert, Emel, E-mail: emel.sert@mail.ege.edu.tr [Ege University, Institute of Nuclear Sciences, 35100 Bornova, Izmir (Turkey); Ugur, Aysun, E-mail: aysun.ugur@ege.edu.tr [Ege University, Institute of Nuclear Sciences, 35100 Bornova, Izmir (Turkey); Ozden, Banu, E-mail: banu.ozden@ege.edu.tr [Ege University, Institute of Nuclear Sciences, 35100 Bornova, Izmir (Turkey); Sac, Mueslim Murat, E-mail: muslum.murat.sac@ege.edu.tr [Ege University, Institute of Nuclear Sciences, 35100 Bornova, Izmir (Turkey); Camgoez, Berkay, E-mail: berkay.camgoz@ege.edu.tr [Ege University, Institute of Nuclear Sciences, 35100 Bornova, Izmir (Turkey)

    2011-06-15

    Mosses and lichens are useful biological indicators of environmental contamination for a variety of metals and radionuclides of both natural and artificial origin. These plants lack a well-developed root system and rely largely on atmospheric deposition for nourishment. Therefore in the study, different lichens (Cladonia convoluta, Cladonia foliacea) and mosses (Homalothecium sericeum, Hypnum lacunosum, Hypnum cupressiforme, Tortella tortuosa, Didymodon acutus, Syntrichia ruralis, Syntrichia intermedia, Pterogonium graciale, Isothecium alopecuroides, Pleurochatae squarrosa) were collected around the Yatagan (Mugla), Soma (Manisa), Seyitoemer - Tuncbilek (Kuetahya) coal-fired power plants and investigated for potential use as biomonitors for {sup 210}Po and {sup 210}Pb deposition. While the activity concentrations of {sup 210}Po and {sup 210}Pb in lichens are in the ranges of 151 {+-} 7-593 {+-} 21 and 97 {+-} 5-364 {+-} 13 Bq kg{sup -1}, for mosses the ranges for {sup 210}Po and {sup 210}Pb are 124 {+-} 5-1125 {+-} 38 and 113 {+-} 4-490 {+-} 17 Bq kg{sup -1}, respectively. In the study, the moss samples were observed to accumulate more {sup 210}Po and {sup 210}Pb compared to lichens. While the most suitable biomonitor was a moss species (H. lacunosum) for Yatagan (Mugla), it was another moss species (S. intermedia) for Soma (Manisa) and Seyitoemer - Tuncbilek (Kuetahya) sites. {sup 210}Po concentrations were found higher than {sup 210}Pb concentrations at the all sampling stations. - Highlights: > Lichens and mosses have been used as biomonitors of 210Po and 210Pb deposition. > The morphology of lichens and mosses does not vary with seasons. > Lichens and mosses retain and accumulate pollutants deposited from the atmosphere. > Canopy is an important factor causing differences in the concentrations of radionuclides.

  5. Distribution, cycling and mean residence time of {sup 226}Ra, {sup 210}Pb and {sup 210}Po in the Tagus estuary

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Fernando P. [Direccao Geral do Ambiente, Departamento de Proteccao e Seguranca Radiologica, Sacavem (Portugal)

    1997-02-28

    Results for dissolved and particulate {sup 226}Ra, {sup 210}Pb and {sup 210}Po in the Tagus river, estuary and coastal sea system show different distribution and chemical behaviour patterns for these radionuclides in the three aquatic environments. {sup 226}Ra from riverborne particles dissolves in the estuary and contributes to increased concentrations of dissolved {sup 226}Ra in estuarine water. In the estuary, dissolved {sup 210}Pb and {sup 210}Po from river discharge and atmospheric deposition are scavenged by suspended matter, which in turn becomes enriched in these nuclides in comparison with riverborne particles. As a result of these processes, the estuarine water flowing into the coastal sea contains enhanced concentrations of dissolved {sup 226}Ra, but is depleted in dissolved {sup 210}Pb and {sup 210}Po. Under average river flow conditions, mass balance calculations for dissolved {sup 210}Po and {sup 210}Pb in the estuary allowed their mean residence times to be estimated as 18 and 30 days, respectively. Due to the rapid sorption of these radionuclides on to settling particles, bottom sediments in the estuary represent a sink for {sup 210}Pb and {sup 210}Po from both natural sources and industrial waste releases. Results also suggest that partial re-dissolution of these radionuclides from bottom sediments and intertidal mudflats is likely to occur in the mid- and low-estuary zones. Nevertheless, box-model computations indicate that the discharge of {sup 210}Pb and {sup 210}Po into the coastal sea takes place mainly with the transport of sediment, whereas the discharge in the dissolved fraction can only account for one third of the activities entering the estuary in the soluble phase. Implications of these results to the cycling of radionuclides in phosphate waste releases into estuarine environments are discussed.

  6. 儿童昏迷210例原因分析%Causes analysis of 210 cases with pediatric coma

    Institute of Scientific and Technical Information of China (English)

    邸春阳; 张妮; 王爱华

    2015-01-01

    目的 研究儿童重症监护病房(PICU)昏迷患儿的病因分布,以指导临床治疗.方法 采用回顾分析方法对210例昏迷患儿的病因进行分析.结果 210例昏迷患儿中,内科疾病150例,占71.43%,外科疾病60例,占28.57%.感染引起者110例,占52.38%,颅脑外伤58例,占27.62%,其中车祸31例,占14.76%.结论 PICU收治的昏迷患儿中,以感染性疾病为主,但外伤,尤其是车祸外伤所致昏迷患儿有所增加.因昏迷就诊患儿,尽快明确病因,对正确治疗及改善预后有积极意义.%Objective To investigate the causes of coma children in Pediatric Intensive Care Unit (PICU).Methods The causes of 210 children with coma were retrospectively analyzed.Results Among 210 cases,150 cases attributed to medical disease (71.43 %),while 60 cases attributed to surgical disease (28.57 %).110 cases were caused by infection(52.38%),58 cases were caused by cranioeerebral trauma (27.62%),while 31 cases involved in traffic accident(14.76%).Conclusion The main cause of coma in PICU is infectious diseases,but traffic accident trauma coma has been increased.It is positive to correct treatment and improve prognosis to recognize the cause as soon as possible.

  7. Seasonal variation of atmospheric Pb-210 and Al in the western North Pacific region

    Science.gov (United States)

    Tsunogai, Shizuo; Kurata, Takayoshi; Suzuki, Toshitaka; Yokota, Kiichiro

    1988-11-01

    The atmospheric concentrations of Pb-210 over a period of two years were determined from aerosol samples collected at six stations in the western North Pacific. The results are compared with those for Al, showing that, although Pb-210 concentrations vary widely from week to week, the degree of variation is about half of that for Al. For Pb-210, the year-to-year variation is not pronounced and the seasonal variation is well represented by a sine curve. The results suggest that Pb-210 has a longer residence time than Al, because Pb-210 is transported through higher altitudes and is deposited more evenly onto the earth's surface and the ocean.

  8. A record of atmospheric 210Pb accumulation in the industrial city

    CERN Document Server

    Buraeva, E A; Stasov, V V; Zorina, L V; Shramenko, B I

    2013-01-01

    The deposition flux of total atmospheric 210Pb in the industrial city Rostov-on-Don, Russia from 2002 to 2010 has been measured. The variations in annual 210Pb deposition flux appear to be mainly correlated with the number of rains and significant amount of anthropogenic 210Pb, polluted into the surface layer of air in the home-heating period. The average 210Pb deposition is 1.75 mBq/m3. Several meteorological parameters which are strongly associated with the fluctuations of concentrations of 210Pb are identified. These results are useful to provide typical information on the atmosphere radioactivity in an industrial city.

  9. Lead-210 and Beryllium-7 fallout rates on the southeastern coast of Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Sanders, Christian J., E-mail: zinosanders@yahoo.com [Universidade Federal de Fluminense (UFF), Departamento de Geoquimica, Outeiro de Sao Joao Baptista s/n, Morro do Valonguinho Centro, Niteroi, RJ (Brazil); Smoak, Joseph M. [University of South Florida (USF), Environmental Science, St. Petersburg, FL (United States); Cable, Peter H. [Tulane University, Department of Earth and Environmental Sciences, New Orleans, LA (United States); Patchineelam, Sambasiva R. [Universidade Federal de Fluminense (UFF), Departamento de Geoquimica, Outeiro de Sao Joao Baptista s/n, Morro do Valonguinho Centro, Niteroi, RJ (Brazil); Sanders, Luciana M. [Istituto de Radioprotecao e Dosimetria (IRD), Rio de Janeiro 22780 (Brazil)

    2011-12-15

    Total {sup 210}Pb and {sup 7}Be fallout rates were measured on the coastal region of Niteroi, Brazil. The monthly depositional flux of {sup 210}Pb and {sup 7}Be varied by a factor of 26, from 1.7 to 43.3 mBq cm{sup -2} year{sup -1} and {approx}27, from 7.5 to 203.5 mBq cm{sup -2} year{sup -1}, respectively. The relatively large oscillations in the depositional flux of {sup 210}Pb at this study site were likely due to variations in air mass sources, while the {sup 7}Be fluctuations may be driven by a combination of weather conditions. Local geology could support the periodic high fluxes of {sup 210}Pb from continental air masses, as shifting oceanic wind sources were affirmed by the uncorrelated {sup 210}Pb and {sup 7}Be fallout activities and {sup 7}Be/{sup 210}Pb ratios. The {sup 210}Pb atmospheric deposition was found to be in agreement with local sediment inventories, an important consideration in geochemical studies that estimate sedimentation processes. - Highlights: > Fallout rates of {sup 210}Pb and {sup 7}Be indicate depositional flux during a 12-month period. > Oscillations in {sup 210}Pb and {sup 7}Be fallout are driven by geology ({sup 210}Pb) and weather. > Regional trends in {sup 7}Be and {sup 210}Pb fluxes used in geochemical processes.

  10. Assay methods for U-238, Th-232, and Pb-210 in lead and calibration of Bi-210 bremsstrahlung emission from lead

    CERN Document Server

    Orrell, John L; Arnquist, Isaac J; Eggemeyer, Tere A; Glasgow, Brian D; Hoppe, Eric W; Keillor, Martin E; Morley, Shannon M; Myers, Allan W; Overman, Cory T; Shaff, Sarah M; Thommasson, Kimbrelle S

    2015-01-01

    Assay methods for measuring 238U, 232Th, and 210Pb concentrations in refined lead are presented. The 238U and 232Th concentrations are determined using isotope dilution inductively coupled plasma mass spectrometry (ID-ICP-MS) after anion exchange column separation of dissolved lead samples. The 210Pb concentration is inferred through {\\alpha}-spectroscopy of a daughter isotope, 210Po, after chemical precipitation separation on dissolved lead samples. Subsequent to the 210Po {\\alpha}-spectroscopy assay, a method for evaluating 210Pb concentrations in solid lead samples was developed via measurement of bremsstrahlung radiation from \\b{eta}-decay of a daughter isotope, 210Bi, by employing a 14-crystal array of high purity germanium (HPGe) detectors. Ten sources of refined lead were assayed. The 238U concentrations were <34 microBq/kg and the 232Th concentrations ranged <0.6-15 microBq/kg, as determined by the ICP-MS assay method. The 210Pb concentrations ranged from ~0.1-75 Bq/kg, as inferred by the 210Po ...

  11. De dosis ten gevolge van eenheidslozingen 226Ra, 210Pb en 210Po in de Nieuwe Waterweg; een herberekening op basis van nieuwe inzichten

    NARCIS (Netherlands)

    Lembrechts J; LSO

    1998-01-01

    Lozingen door de fosfaatertsverwerkende industrieen van 1 TBq/a van de radionucliden 226Ra, 210Pb en 210Po in de Nieuwe Waterweg veroorzaken een potentiele individuele dosis van ten hoogste 0,53 mSv/a. Circa 96% van deze dosis wordt veroorzaakt door blootstelling aan 222Rn in woningen en 4% door

  12. A study on lead (210Pb) and polonium (210Po) contamination from phosphogypsum in the environment of Wiślinka (northern Poland).

    Science.gov (United States)

    Boryło, Alicja; Olszewski, Grzegorz; Skwarzec, Bogdan

    2013-08-01

    The results of polonium ((210)Po) and lead ((210)Pb) determination in different environmental soil samples collected in the vicinity of the phosphogypsum stack in Wiślinka (northern Poland) are presented and discussed in this paper. The (210)Po and (210)Pb concentrations in soil samples from the phosphogypsum stack recorded in this study are significantly higher only in areas that are close to the heap. The relationship between atmospheric deposition and elevated analyzed radionuclides concentrations in top soil layers, especially in the vicinity of the phosphogypsum stack, was showed in this study. (210)Po and (210)Pb radionuclides were detected in concentrations which could have harmful effects on human health or the environment. The considerably high concentrations of (210)Po and (210)Pb in soil samples collected from the vicinity of the phosphogypsum stack obtained in this study can lead to the conclusion that the presently undertaken recultivation process is successful and the 300 m(2) protection zone around the phosphogypsum stack seems to be able to offset the negative influence of the phosphogypsum stack on the surrounding environment.

  13. Scientific Opinion on Flavouring Group Evaluation 210 Revision 2 (FGE.210Rev2): Consideration of genotoxic potential for α,β-unsaturated alicyclic ketones and precursors from chemical subgroup 2.4 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Nørby, Karin Kristiane

    Safety Authority was requested to evaluate the genotoxic potential of 14 flavouring substances in Flavouring Group Evaluation 210 (FGE.210). In FGE.210, the Panel concluded that the genotoxic potential could not be ruled out for any of the flavouring substances. In FGE.210 Revision1, the Panel co...

  14. Bibi Bird FPV 210穿越机

    Institute of Scientific and Technical Information of China (English)

    2016-01-01

    创客火公司的这款DIY四轴穿越机,轴距为210mm。产品为套装形式,用户需自行组装,并需自备遥控器。这款套材提供了详细的组装指导,为客户带来组装和飞行的双重体验。此外,创客火公司还推出了DIY四轴穿越机配件,方便更换零部件。

  15. Milanés 210, un patrimonio matancero

    OpenAIRE

    Ramón Félix Recondo Pérez

    2010-01-01

    Cada año, desde el 2003, el Consejo Nacional de Patrimonio Cultural convoca al Premio Nacional de Conservación y Restauración, a entregarse cada 18 de abril, Día Internacional de los Monumentos, con el objetivo de estimular la protección y el rescate del patrimonio edificado, histórico y natural de la nación. En la versión del 2010, nuestra provincia, Matanzas, estuvo representada en la categoría de Conservación por la edificación ubicada en la calle Milanés 210, vivienda del ilustre Doctor y...

  16. [Polonium-210 in fishes from the Black Sea].

    Science.gov (United States)

    Lazorenko, G E; Polikarpov, G G

    2010-01-01

    The specific activity of naturally occurring radionuclide 210Po in main species of the Black Sea fishes and some their organs were used for the calculation of absorbed and equivalent dose rates. The values of the dose in investigated fish depend on their ecological belonging. Maximum values of equivalent dose rates for viscera and, first of all, liver exceed such for the whole body of fishes. But they are significantly lower than the dose rate limit recommended by IAEA for the protection of aquatic organisms from ionizing radiation.

  17. Origin of Pb-210 in Florida Bay, A Constant Non-atmospheric Source.

    Science.gov (United States)

    Holmes, C. W.

    2005-12-01

    Establishing the timing of surface processes with 210Pb has been commonly used over the last 4 decades. Radon diffuses from the earth's crust and decays through a series of very short lived isotopes to Pb-210. Because the production of Pb-210 depends on the expose of continental material, the atmospheric concentration at any one location is related to the proximity of continental masses and prevailing air flow. This process produces excess Pb-210 in the atmosphere and subsequently the hydrosphere. Pb-210 inventories in Florida Bay sediments were found to exceed that which could be accounted for by atmospheric deposition. Since these sediments are formed in situ, transportation of Pb-210 enriched material can not account for this disequilibrium. Detailed analysis of the entire sediment column showed that significant Pb-210 concentrations were present at the sediment rock interface. Previous isotopic measurements showed that the strata underlying Florida Bay contained high concentrations of Rn-222 diffusing into the overlying waters. Sediment dynamic monitoring studies have demonstrated that most sediment transported in Florida Bay are deposited during the winter months. It is in these months during which the water is cold which allows radon concentrations build up in the waters. With the three day half life, this radon produces Pb-210 that is available to be adsorbed on the moving sediment. This mechanism creates a constant supply of Pb-210 and produces the ideal condition 210Pb dating Florida Bay sediment. There is evidence that such a condition is common to other carbonate environments.

  18. Polonium-210 and lead-210 in the Southern Polar Ocean: Naturally occurring tracers of biological and hydrographical processes in the surface waters of the Antarctic Circumpolar Current and the Weddell Sea; Polonium-210 und Blei-210 im Suedpolarmeer: Natuerliche Tracer fuer biologische und hydrographische Prozesse im Oberflaechenwasser des Antarktischen Zirkumpolarstroms und des Weddellmeeres

    Energy Technology Data Exchange (ETDEWEB)

    Friedrich, J.

    1997-11-01

    In this thesis the distribution of {sup 210}Po and {sup 210}Pb in the upper 600 m of the Antarctic Circumpolar Current and the Weddell Sea was investigated along north-south transects in austral spring and autumn. {sup 210}Po and {sup 210}Pb can serve as sensitive tracers for the special hydrographic conditions of the Antarctic Circumpolar Current and the Weddell Sea as well as for biological processes during phytoplankton blooms. The {sup 210}Po/{sup 210}Pb disequilibrium was used as a tracer for particle export. This tracer integrates export on a timescale of 276 days because of the 138 day half-life of {sup 210}Po and complements the {sup 234}Th/{sup 238}U disequilibrium as another tracer for plankton production and export on a shorter timescale of several weeks. (orig.) [Deutsch] In der vorliegenden Arbeit wurde die Verteilung von Blei-210 und seinem Enkelnuklid Polonium-210 im Antarktischen Zirkumpolarstrom und im Weddellmeer bis 600 m Tiefe in mehreren meridionalen Transekten im australen Fruehjahr und Herbst waehrend der `Polarstern`-Expeditionen ANT-X/6 und ANT-XI/4 untersucht. Die Verteilung von {sup 210}Pb und {sup 210}Po wird von mehreren Faktoren beeinflusst, sowohl durch die Advektion von Wassermassen im Antarktischen Zirkumpolarstrom und im Weddellmeer als auch von biologischen Prozessen z.B. innerhalb einer Planktonbluete. Bevor die Verteilungsmuster von {sup 210}Pb und {sup 210}Po jedoch als Tracer fuer einen Prozess genutzt werden koennen, muss der Effekt der einzelnen Faktoren auf die Verteilung betrachtet werden. (orig.)

  19. Distribution of some chemical elements between dissolved and particulate phases in the ocean. Research period: August 1, 1975--July 31, 1976. [Fallout /sup 210/Po and /sup 210/Pb diffusion in oceans

    Energy Technology Data Exchange (ETDEWEB)

    1976-01-01

    Progress is reported on studies on the distributions of fallout /sup 210/Pb and /sup 210/Po in dissolved and particulate states in the Gulf of Maine and a transect of the equatorial North Atlantic Ocean. The ratio of /sup 210/Pb//sup 226/Ra and /sup 210/Po//sup 210/Pb in seawater and suspended particulate matter in samples collected from 10 stations in the tropical and eastern North Atlantic and two stations in the Pacific was also determined. (CH)

  20. 7Be and 210Pb radioactivity and implications on sources of surface ozone at Mt. Waliguan

    Institute of Scientific and Technical Information of China (English)

    ZHENG Xiangdong; WANG Guojiang; TANG Jie; ZHANG Xiaochun; YANG Wei; H. N. Lee; WANG Changsheng

    2005-01-01

    Beryllium-7 (7Be) and lead-210 (210Pb) radioac- tivity in aerosols collected, from October 2002 to January 2004 at Mt. Waliguan, by the Global Atmospheric Watch (GAW) Station, Qinghai Province is presented. The data were analyzed together with simultaneously measured surface ozone concentrations. We found that short time variations of 7Be and 210Pb were linked to alternations of synoptic weather around the Mt. Waliguan region. 210Pb showed the lowest concentration in summer while 7Be showed no obvious sea- sonal changes. Relatively high 7Be and 210Pb radioactivity was observed at Mt. Waliguan when compared with the ob- servations at other mountain sites in other parts of the world. Surface ozone and 7Be showed a consistent seasonal variation. Surface ozone correlated fairly well with 7Be/210Pb ratio. This suggested that vertical transport from higher altitudes of the atmosphere has predominant effects on the budget of surface ozone at Mt. Waliguan.

  1. Cerenkov counting: an alternative for determining {sup 210} Pb low-levels

    Energy Technology Data Exchange (ETDEWEB)

    Mingote, Raquel Maia; Gomes, Nilton Carlos [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil). Servico de Quimica e Radioquimica]. E-mail: mingote@cdtn.br; Oliveira, Arno Heeren de [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear]. E-mail: heeren@nuclear.ufmg.br

    2005-07-01

    Determining the {sup 210}Pb by Cerenkov counting is an indirect method which is measured by the Cerenkov radiation produced by its daughter {sup 210}Bi. {sup 210}Pb does not interfere because it does not produce Cerenkov radiation and only the lead chemical recovery is necessary, decreasing the uncertainty sources. This work presents a methodology for determining {sup 210}Pb in water for Cerenkov counting by using a conventional spectrometer liquid scintillation and lead pre-concentration. Several factors that affect the {sup 210}Pb determination were evaluated. Some reference material was analysed showing that the procedure gives accurate and reproducible results. The lower limit of detection for {sup 210}Pb of 0.10 Bq/L was obtained (500 minutes counting time, 70 % of lead chemical recovery and, the Cerenkov counting efficiency about 14 % and 800 mL of the sample). (author)

  2. Transfer of {sup 40}K, {sup 238}U, {sup 210}Pb, and {sup 210}Po from soil to plant in various locations in south of Syria

    Energy Technology Data Exchange (ETDEWEB)

    Al-Masri, M.S. [Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic)], E-mail: scientific1@aec.org.sy; Al-Akel, B.; Nashawani, A.; Amin, Y.; Khalifa, K.H.; Al-Ain, F. [Atomic Energy Commission of Syria, Damascus, P.O. Box 6091 (Syrian Arab Republic)

    2008-02-15

    Transfer factors of {sup 40}K, {sup 238}U, {sup 210}Pb, and {sup 210}Po from soil to some agriculture crops in various locations in south of Syria (Dara'a and Assuwaydaa districts) have been determined. Soil and vegetable crops (green pepper, cucumber, tomato, and eggplant), legumes crops (lentil, chickpea, and broad bean), fruit trees (apple, grape, and olives) and cereals (barley and wheat) were collected and analyzed for {sup 238}U, {sup 210}Pb, and {sup 210}Po. The results have shown that higher transfer factors (calculated as Bq kg{sup -1} dry wt. plant material per Bq kg{sup -1} dry wt. soil) for {sup 210}Po, {sup 210}Pb and {sup 238}U were observed in vegetable leaves than fruits and cereals leaves; the highest values of transfer factor (TF) for {sup 238}U were found to be 0.1 for straw of chickpea. Transfer factors for {sup 210}Po varied between 2.8 x 10{sup -2} and 2 in fruits of eggplant and grain of barley, respectively. In addition, several parameters affecting transfer factors of the radionuclides were evaluated. The results can be considered as base values for TF of natural radionuclides in the region.

  3. Despite WT1 binding sites in the promoter region of human and mouse nucleoporin glycoprotein 210, WT1 does not influence expression of GP210

    Directory of Open Access Journals (Sweden)

    Licht Jonathan D

    2004-12-01

    Full Text Available Abstract Background Glycoprotein 210 (GP210 is a transmembrane component of the nuclear pore complex of metazoans, with a short carboxyterminus protruding towards the cytoplasm. Its function is unknown, but it is considered to be a major structural component of metazoan nuclear pores. Yet, our previous findings showed pronounced differences in expression levels in embryonic mouse tissues and cell lines. In order to identify factors regulating GP210, the genomic organization of human GP210 was analyzed in silico. Results The human gene was mapped to chromosome 3 and consists of 40 exons spread over 102 kb. The deduced 1887 amino acid showed a high degree of alignment homology to previously reported orthologues. Experimentally we defined two transcription initiation sites, 18 and 29 bp upstream of the ATG start codon. The promoter region is characterized by a CpG island and several consensus binding motifs for gene regulatory transcription factors, including clustered sites associated with Sp1 and the Wilms' tumor suppressor gene zinc finger protein (WT1. In addition, distal to the translation start we found a (GTn repetitive sequence, an element known for its ability to bind WT1. Homologies for these motifs could be identified in the corresponding mouse genomic region. However, experimental tetracycline dependent induction of WT1 in SAOS osteosarcoma cells did not influence GP210 transcription. Conclusion Although mouse GP210 was identified as an early response gene during induced metanephric kidney development, and WT1 binding sites were identified in the promoter region of the human GP210 gene, experimental modulation of WT1 expression did not influence expression of GP210. Therefore, WT1 is probably not regulating GP210 expression. Instead, we suggest that the identified Sp binding sites are involved.

  4. Influence of heavy metals upon the retention and mobilization of polonium-210 in rats.

    Science.gov (United States)

    Rencová, J; Vlková, A; Curík, R; Holusa, R; Veselá, G

    2004-10-01

    To provide information about the tissue retention and mobilization of the alpha-emitting radionuclide, polonium-210 (210Po), in rats under combined exposure to heavy metal ions and the chelating agent, 2, 3-dimercaptopropane-1-sulfonate (DMPS). Rats were pre-exposed intraperitoneally to either CdCl2 or Pb(CH3COO)2. 9 or 15 h later they received 210Po nitrate intravenously. The retention and excretion of 210Po via the urine and faeces of pre-exposed rats, as well as in pre-exposed rats treated with DMPS, were followed. The radioactivity due to 210Po in a broad spectrum of body tissues and excreta was measured by the liquid scintillation counting after sample digestion in a mixture of perchloric acid and hydrogen peroxide. The immunohistochemical localization of metallothioneins (MT) was studied using a mixture of murine monoclonal antibodies directed against MT I+II. The present study revealed different tissue distributions of polonium-210 in the rats pre-exposed to lead or cadmium ions when compared with that in 210Po only controls. Under combined exposure to Pb or Cd, the spontaneous excretion of 210Po was enhanced and could be further enhanced by treatment with DMPS. Treatment with this chelator was efficient even when its start was postponed until 24h after internal contamination of the body with 210Po. Polonium-210 is bound in vivo to binding sites on various biomolecules, among them erythrocytic enzymes and MT. This phenomenon explains the different affinity and overall distribution of 210Po in control body tissues. When the appropriate binding sites are occupied by lead or cadmium, enhanced natural excretion of polonium-210 occurs.

  5. Decay studies of a long lived high spin isomer of /sup 210/Bi

    Energy Technology Data Exchange (ETDEWEB)

    Tuggle, D.G.

    1976-08-01

    A source of approximately 30 ..mu..g of pure (> 90%) /sup 210m/Bi (J..pi.. = 9-) was prepared by irradiating /sup 209/Bi in a nuclear reactor. After chemical separations to remove /sup 210/Po from the irradiated bismuth sample were completed, the /sup 210/Bi was electromagnetically separated from the /sup 209/Bi by a series of two isotope separations to create the source mentioned above. This source was then used to conduct alpha, conversion electron, gamma, gamma-gamma coincidence, and alpha-gamma coincidence spectroscopic studies of the decay of /sup 210m/Bi. The partial half life for the alpha decay of /sup 210m/Bi was measured as 3.0 x 10/sup 6/ yr. A lower limit of 10/sup 13/ years was set for the partial half life for the decay of /sup 210m/Bi to /sup 210/Po. Alpha decay of /sup 210m/Bi to 8 excited states of /sup 206/Tl was observed. A lower limit of 10/sup -4/% was set for the branching ratio of the parity forbidden alpha decay of /sup 210/Bi to the /sup 206/Ti ground state. Theoretical decay rates for the alpha decays of /sup 210m/Bi, /sup 210/Bi, /sup 211/Po, and /sup 211m/Po were calculated using the method developed by Hans Mang. A comparison of the calculated and experimentally measured alpha decay rates of /sup 210m/Bi showed good agreement for the relative alpha decay rates.

  6. Annual effective dose of {sup 210}Po from sea food origin (Oysters and Mussels) in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Bo Eum; Hong, Gi Hoon; Kim, Suk Hyun; Lee, Hyun Mi [Korea Institute of Ocean Science and Technology, Ansan (Korea, Republic of)

    2016-09-15

    Ingestion of {sup 210}Po laden seafood accounts for a substantial amount of the effective dose of {sup 210}Po. Among seafood items, mollusks, especially domestically produced oysters and mussels, are highly enriched in {sup 210}Po and are consumed in large quantities in Korea. Oysters and mussels around the Korean coasts were collected from major farm areas in November 2013. Samples were spiked with an aliquot of {sup 210}Po as a yield tracer, and they were digested with 6 mol·L{sup -1} HNO{sub 3} and H{sub 2}O{sub 2}. The {sup 210}Po and {sup 209}Po were spontaneously deposited onto a silver disc in an acidic solution of 0.5 mol·L{sup -1} HCl and measured using an alpha spectrometer. The activity concentrations of {sup 210}Pb and {sup 210}Po were decay corrected to the sampling date, accounting for the possible in-growth and decay of {sup 210}Po. {sup 210}Po activity concentrations in oysters were in a range from 41.3 to 206 Bq·(kg-ww{sup -1} and mussels in a range from 42.9 to 46.7 Bq·(kg-ww){sup -1}. The {sup 210}Po activity concentration of oysters in the turbid Western coast was higher than the Southern coast. The {sup 210}Po activity concentration of the oysters was positively correlated (R2=0.89) with those of the suspended particulate matter in the surface water. The calculated annual effective dose of {sup 210}Po from oysters and mussels consumed by the Korean population was 21-104 and 5.01-5.46 μSv·y{sup -1}. The combined effective dose due to the consumption of oysters and mussels appears to account for about 35±19% of that arising from seafood consumption in the Korean population. The annual effective dose of {sup 210}Po for oysters in the Korean population was found to be higher than other countries. The total annual effective dose of 210Po{sup 210}Po due to consumption of oysters and mussels consumed in Korea was found to be 76±42 μSv·y{sup -1}, accounting for 28±16% of the total effective dose of {sup 210}Po from food in Korea.

  7. MD210 Note: Creation of Hollow Bunches in the PSB

    CERN Document Server

    Oeftiger, Adrian; Findlay, Alan James; Hancock, Steven; Rumolo, Giovanni; CERN. Geneva. ATS Department

    2016-01-01

    MD210 aims for the creation of longitudinally hollow bunches in the CERN PS Booster. The first three sessions have been carried out using the radial loop feedback system in order to drive the beam on a dipolar parametric resonance (instead of the phase loop). It has been found that the damping by the phase loop inhibits the excitation of the resonance to a major extent. The hollow distributions generated under these circumstances fail to reach a satisfying bunching factor. Nonetheless, proving the principally successful application of this technique to the PS Booster promises good results once the phase loop system supports trim functions. The approach, actions and detailed results of the first three MD sessions are presented in this paper.

  8. CPLOAS_2 V2.10 verification report.

    Energy Technology Data Exchange (ETDEWEB)

    Groth, Katrina M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-07-01

    A series of test cases designed to verify the correct implementation of several features of the CPLOAS_2 program are documented. CPLOAS_2 is used to calculate the probability of loss of assured safety (PLOAS) for a weak link (WL)/strong link (SL) system. CPLOAS_2 takes physical properties (e.g., temperature, pressure, etc.) of a WL/SL system and uses these properties and definitions of link failure properties in probabilistic calculations to determine PLOAS. The features being tested include (i) six aleatory distribution forms, (ii) five numerical procedures for the determination of PLOAS (i.e., one quadrature procedure, two simple random sampling procedures, and two importance sampling procedures), and (iii) time and environmental margin calculations. All tests were performed with CPLOAS_2 version 2.10.

  9. Baseline concentration of {sup 210}Po in Sargassum from the Northern Gulf

    Energy Technology Data Exchange (ETDEWEB)

    Uddin, S.; Bebhehani, M.; Talebi, L. [Kuwait Institute for Scientific Research (Kuwait)

    2014-07-01

    The concentration of the {sup 210}Po is of enormous interest because of its large contribution to the natural radiation dose received by marine organisms and human populations consuming seafood. In fact natural {sup 210}Po is responsible for higher radiation doses to humans consuming marine products than is plutonium and other man-made radionuclides. Many marine organisms are capable of concentrating {sup 210}Po in their tissues. {sup 210}Po is an alpha emitter in the {sup 238}U series, with 138-d half-life, that is supplied to seawater from atmospheric inputs and river runoff, however, the main source of {sup 210}Po in the environment is {sup 222}Rn exhalation from the ground. Assessing the impact of radionuclides in the environment requires the establishment of baseline levels in the environmental compartments. The objective of this study was to establish baseline levels in Sargassum. Two most common species of Sargassum found in the northern Gulf were analysed for {sup 210}Po. These macro-algae were collected from three different locations during January 2013. This study sets the baseline for {sup 210}Po concentration in northern Gulf, {sup 210}Po is absorbed from water and concentrated by Phytoplankton and macro-algae. This concentrated {sup 210}Po can then be passed along to the next trophic level of the marine food web. The {sup 210}Po concentration measured in Sargassum boveanum (4.405 - 4.952 BqKg{sup -1}) was significantly higher (p>0.084) than Sargassum oligocystum (3.838 - 4.358 BqKg{sup -1}). The {sup 210}Po concentration in these seaweeds from the Arabian/Persian Gulf were substantially lower than those found in various Phytoplankton and macro-algae species from other regions; this may be due to the lower background {sup 210}Po concentration in the Kuwait marine waters (0.282 - 0.382 mBq l{sup -1}). The {sup 210}Po concentrations in seawater measured at the 3 stations during January 2013 were less than those reported previously from the same region

  10. Variation of the activity concentrations and fluxes of natural (210Po, 210Pb) and anthropogenic (239,240Pu, 137Cs) radionuclides in the Strait of Gibraltar (Spain).

    Science.gov (United States)

    Gascó, C; Antón, M P; Delfanti, R; González, A M; Meral, J; Papucci, C

    2002-01-01

    The activity concentrations and fluxes of natural (210Pb, 210Po) and anthropogenic (239,240Pu, 137Cs) radionuclides have been determined in the different water masses crossing the Strait of Gibraltar. New data have been gathered during four multidisciplinary and multinational sampling campaigns, performed between 1997 and 1999 within the framework of the CANIGO-FLUGIST Project. Mean activity concentrations of 210Po (1.53+/-0.34 Bq m(-3), n = 30) and 210Pb (1.16+/-0.50 Bq m(-3), n = 31) in the Atlantic water entering the Mediterranean basin are about double those measured in the Mediterranean outflow, namely 0.84+/-0.34 Bq m(-3) (n = 22) for 210Po and 0.66+/-0.34 Bq m(-3) (n = 22) for 210Pb. The opposite trend is observed for 231,240Pu, with average concentrations of 9.9+/-3.0 mBq m(-3) (n = 29) in the incoming Atlantic flow and 22.0+/-3.0 mBq m(-3) (n = 22) in the outpouring Mediterranean water. In the case of 137Cs, the same concentrations were quantified in the waters moving inwards (2.52+/-0.28 Bq m(-3), n = 27) and outwards (2.14+/-0.52 Bq m(-3), n = 21) from the Mediterranean Sea. On this basis, the Mediterranean basin experiences a net annual input flux of 14 TBq of 210Pb and 19 TBq of 210Po, and a net annual loss of 0.34 TBq of 239,240Pu, while--at present--137Cs input and output fluxes appear to be balanced.

  11. Seasonal and vertical changes of molecular size distribution of lead-210 and polonium-210 in an oligotrophic lake, lake Towada in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsuka, Y.; Takaku, Y.; Kakiuchi, H.; Hisamatsu, S.; Inaba, J.; Yamamoto, M. [Institute for Environmental Sciences (IES), Dept. of radioecology, okkasho-mura, Aomori Prefecture (Japan)

    2004-07-01

    Lead-210 and {sup 210}Po are naturally occurring long-lived radionuclides in the {sup 238}U decay series. These nuclides are easily measurable, and have been used as tracers of non-conservative material cycling in aquatic systems because of reactivity with particles in water. To deepen our understandings of the behaviors and cycling of these nuclides in lake systems, it is important to know the existing forms (speciation) of these nuclides in the water and seasonal variations of the speciation, including their material balances. We report here a detailed study of molecular size distributions and their seasonal variations for {sup 210}Pb and {sup 210}Po in the water column of an oligo-trophic lake, Lake Towada in the northern area of Japan, Aomori Prefecture. The samples were separated to four fractions; particulate phase (>0.45 {mu}m), 0.45 {mu}m - 100 kDa, 100 10 kDa and <10 kDa. Dissolved phases (<0.45 {mu}m) were separated to the three fractions by using a tangential flow ultra-filtering system. The concentrations of particulate {sup 210}Pb and {sup 210}Po in the epi-limnion over thermocline (20 - 25 m) were higher than those in the hypo-limnion. Fluctuations of total concentrations of both nuclides in water could attribute to concentration variation of them in particulate phase. The pattern of seasonal variation of particulate {sup 210}Pb were reverse to that of the <10 kDa fraction in both epi-limnion and hypo-limnion. However, the variation pattern of <10 kDa fraction of the {sup 210}Po was similar to that of the particulate phase. (author)

  12. Evaluation of the uncertainty for the efficiency curve determination of {sup 210}Pb by liquid scintillation; Avaliacao da incerteza para a curva de eficiencia da determinacao de {sup 210}Pb por cintilacao liquida

    Energy Technology Data Exchange (ETDEWEB)

    Sampaio, C.S.; Sousa, W.O.; Dantas, B.M., E-mail: camilla@ird.gov.br [Instituto de Radioprotecao e Dosimetria, (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2014-07-01

    Methodologies for the evaluation of uncertainties associated with the determination of the efficiency curve of {sup 210}Pb by liquid scintillation counting (LSC) are presented. No statistical difference were found when compared the uncertainties of the curves that represented the counting net before and after the secular equilibrium between {sup 210}Pb and {sup 210}Bi, nether when compared the curves when counting only {sup 210}Pb and the curve with the total count of {sup 210}Pb and {sup 210}Bi, for the same time interval after precipitation. (author)

  13. Using natural radionuclides 210Po and 210Pb in GEOTRACES data from the North Atlantic to estimate particulate and biologically reactive trace element scavenging and regeneration

    Science.gov (United States)

    Rigaud, Sylvain; Church, Thomas

    2016-04-01

    Central to understanding the coupling of oceanic carbon and nutrient cycles are trace elements that can limit ocean production and ultimately climate change. These include elements that are both lithogenic (particle reactive) and biogenic (biologically reactive) central to particle scavenging, exchange and bioavailability. The natural 210Po and 210Pb radionuclide (granddaughter/parent) pair provides the radiometric means to model particle scavenging and exchange in the ocean on monthly to annual time scales. Data on dissolved (0.2 μm, >53μm) 210Po (t1/2= 138.4 d) and 210Pb (T1/2 = 22.3 y) are available from seven complete water profiles during two U.S. GEOTRACES cruises that transited the North Atlantic during fall 2010 and 2011. The transects correspond to a wide range of marine environments: coastal slopes at the western and eutrophic up-welling at the eastern margins, Saharan dust sources from the east, hydro-thermal vents in the TAG plume on the Mid-Atlantic Ridge, and oligotrophic gyres in both the western and eastern basins. Steady state box modeling at each depth interval was employed to estimate radionuclide exchange rates at the fine-large particle and fine particulate-dissolved interface, in terms of biological uptake, and net of radioactive support or decay. By proxy, the results should predict the rates of biological (210Po) and particle reactive (210Pb) trace element adsorption and resorption, vertical particulate and carbon export, and respective residence times. The model results show the contrasting chemical behaviour of the two nuclides over the large range of oceanic conditions encountered in the North Atlantic. In the surface ocean, 210Po scavenging is linearly correlated with the concentration of particulate organic carbon (POC) in large particles, supporting the role of biogenic particles in 210Po bioaccumulation and export. At depth, 210Po exhibits significant widespread deficit with respect to 210Pb, which could in part be attributed to in

  14. 20 CFR 665.210 - What are allowable Statewide workforce investment activities?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What are allowable Statewide workforce investment activities? 665.210 Section 665.210 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... assist in skills upgrading; and (2) Programs targeted to Empowerment Zones and Enterprise Communities. (e...

  15. 13 CFR 120.210 - What percentage of a loan may SBA guarantee?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What percentage of a loan may SBA guarantee? 120.210 Section 120.210 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS... percent, except as otherwise authorized by law....

  16. 77 FR 40626 - RP9580.210, Personal Assistance Services in Shelters Fact Sheet

    Science.gov (United States)

    2012-07-10

    ... SECURITY Federal Emergency Management Agency RP9580.210, Personal Assistance Services in Shelters Fact... comments. SUMMARY: The Federal Emergency Management Agency (FEMA) is accepting comments on Recovery Fact Sheet RP9580.210, Personal Assistance Services in Shelters. The purpose of this new fact sheet is to...

  17. 40 CFR 158.210 - Experimental use permit data requirements for product chemistry.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Experimental use permit data requirements for product chemistry. 158.210 Section 158.210 Protection of Environment ENVIRONMENTAL PROTECTION... Experimental use permit data requirements for product chemistry. All product chemistry data, as described in...

  18. 20 CFR 410.210 - Conditions of entitlement; widow or surviving divorced wife.

    Science.gov (United States)

    2010-04-01

    ... divorced wife. 410.210 Section 410.210 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL COAL MINE... surviving divorced wife. An individual is entitled to benefits if such individual: (a) Is the widow (see § 410.320) or surviving divorced wife (see § 410.321) of a miner (see § 410.110(j)); (b) Is not...

  19. 7 CFR Appendix C to Part 210 - Child Nutrition Labeling Program

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Child Nutrition Labeling Program C Appendix C to Part 210 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NATIONAL SCHOOL LUNCH PROGRAM Pt. 210, App. C Appendix...

  20. 76 FR 40594 - Special Conditions: Pratt and Whitney Canada Model PW210S Turboshaft Engine

    Science.gov (United States)

    2011-07-11

    .... Applicability These special conditions are applicable to the PWC PW210S turbo shaft engine. If PWC applies later... following special conditions as part of the type certification basis for the PWC PW210S turbo shaft engine... Turboshaft Engine AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final special...

  1. 25 CFR 39.210 - When must a school drop a student from its membership?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false When must a school drop a student from its membership? 39.210 Section 39.210 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION THE INDIAN... must a school drop a student from its membership? If a student is absent for 10 consecutive school...

  2. 23 CFR 971.210 - Federal lands bridge management system (BMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands bridge management system (BMS). 971.210 Section 971.210 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL LANDS... lands bridge management system (BMS). In addition to the requirements provided in § 971.204, the...

  3. 23 CFR 970.210 - Federal lands bridge management system (BMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands bridge management system (BMS). 970.210 Section 970.210 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL LANDS... Federal lands bridge management system (BMS). In addition to the requirements provided in § 970.204,...

  4. Skeletal sup 210 Pb from inhalation of sup 222 Rn and its decay products

    Energy Technology Data Exchange (ETDEWEB)

    Keane, A.T.; Schlenker, R.A.; Stebbings, J.H.

    1990-01-01

    Concern about health effects of radon and its decay products has recently broadened to include the potential role of radon in the causation of myeloid leukemia, multiple myeloma, and melanoma, kidney cancer, and certain childhood cancers. Description of the distribution of radon and its daughters in the skeleton and the marrow, and the dose delivered to red marrow, are of particular relevance. Our interest in a metabolic model for inhaled radon and radon decay products originated with an interest in the use of radioactivity measurement techniques in vivo to quantify the {sup 210}Pb activity of bone. In this paper we estimate the rates of transfer to body fluids of {sup 210}Pb originating from inhaled radon and radon decay products and the quantity of {sup 210}Pb deposited in compact and in cancellous bone for the ideal case of continuous exposure to a constant level of radon and its daughters. We review the contributions of ambient airborne {sup 210}Pb, diet, and active and passive smoking to skeletal levels of {sup 210}Pb, and finally, from the magnitude and the variability of the natural {sup 210}Pb content of the skeleton, we estimate the minimal rate of exposure to airborne radon and its decay products that is required to elevate the skeletal {sup 210}Pb content of an individual to a statistically significant level above the population mean skeletal {sup 210}Pb content derived from all the other environmental sources combined. 55 refs., 4 tabs.

  5. 19 CFR 210.67 - Remedy, the public interest, and bonding.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Remedy, the public interest, and bonding. 210.67... PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Temporary Relief § 210.67 Remedy, the public interest... appropriate form of temporary relief, whether the public interest factors enumerated in the statute...

  6. 40 CFR 141.210 - Notice by primacy agency on behalf of the public water system.

    Science.gov (United States)

    2010-07-01

    ... the public water system. 141.210 Section 141.210 Protection of Environment ENVIRONMENTAL PROTECTION... system. (a) May the primacy agency give the notice on behalf of the public water system? The primacy... water system if the primacy agency complies with the requirements of this subpart. (b) What is...

  7. 44 CFR 19.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Military and merchant marine educational institutions. 19.210 Section 19.210 Emergency Management and Assistance FEDERAL EMERGENCY... marine educational institutions. These Title IX regulations do not apply to an educational...

  8. 45 CFR 618.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-10-01

    ... institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is... 45 Public Welfare 3 2010-10-01 2010-10-01 false Military and merchant marine educational institutions. 618.210 Section 618.210 Public Welfare Regulations Relating to Public Welfare...

  9. 45 CFR 2555.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-10-01

    ... educational institutions. These Title IX regulations do not apply to an educational institution whose primary... 45 Public Welfare 4 2010-10-01 2010-10-01 false Military and merchant marine educational institutions. 2555.210 Section 2555.210 Public Welfare Regulations Relating to Public Welfare...

  10. 32 CFR 196.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... educational institutions. These Title IX regulations do not apply to an educational institution whose primary... 32 National Defense 2 2010-07-01 2010-07-01 false Military and merchant marine educational institutions. 196.210 Section 196.210 National Defense Department of Defense (Continued) OFFICE OF...

  11. 36 CFR 1211.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Military and merchant marine educational institutions. 1211.210 Section 1211.210 Parks, Forests, and Public Property NATIONAL ARCHIVES AND... educational institutions. These Title IX regulations do not apply to an educational institution whose...

  12. 32 CFR 37.210 - To what types of recipients may I award a TIA?

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false To what types of recipients may I award a TIA? 37.210 Section 37.210 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Appropriate Use of...

  13. Atmospheric (210)Pb as a tracer for soil organic carbon transport in a coniferous forest.

    Science.gov (United States)

    Teramage, Mengistu T; Onda, Yuichi; Wakiyama, Yoshifumi; Kato, Hiroaki; Kanda, Takashi; Tamura, Kenji

    2015-01-01

    Core soils and falling litter samples were collected in a Japanese cypress forest (Chamaecyparis obtusa) to determine the litter-fed (210)Pbex and organic carbon transfer from the forest canopy to soil and their subsequent distribution. Of the canopy residing (210)Pbex pool, litterfall annually transports 53% to the forest floor while it adds 117 g m(-2) per year of organic carbon to the forest soil, implying that litterfall dynamics can influence the distribution of (210)Pbex and soil organic carbon (SOC). (210)Pbex and SOC showed identical profile shapes and strong correlation in spatial as well as along the soil depth, indicating that both are affected by a similar process. Given the ubiquitous natural source of (210)Pbex, it is plausible to infer that radiolead can be a possible tracer to study the SOC redistribution at regional and global scales.

  14. Downregulation of miR-210 protected bupivacaine-induced neurotoxicity in dorsal root ganglion.

    Science.gov (United States)

    Wang, Yiheng; Ni, Hongxia; Zhang, Wenrui; Wang, Xiu; Zhang, Haishan

    2016-04-01

    Local anesthetic may cause neurotoxicity in developing neurons. In this study, we examined the molecular mechanisms of microRNA-210 (miR-210) in regulating bupivacaine-induced dorsal root ganglia (DRG) neurotoxicity in vitro. Young mouse (P30) DRG explants were cultured in vitro and treated with 5 mM bupivacaine to induce neurotoxicity. QRT-PCR was used to evaluate the expression profiles of miRNAs within 24 h after bupivacaine treatment. MiR-210 was downregulated in DRG, and its effects on bupivacaine-induced neurotoxicity were evaluated by apoptosis and neurite growth assays, respectively. Putative downstream target of miR-210 in DRG, BDNF, was evaluated by dual-luciferase assay, qRT-PCR, and western blot, respectively. BDNF was then knocked down by siRNA to assess its associated effects in regulating DRG neurotoxicity. Within the initial 24 h after bupivacaine treatment, various patterns of miRNA expression were observed, whereas miR-210 was constantly upregulated. Application of miR-210 inhibitor efficiently downregulated endogenous miR-210, protected apoptosis and neurite retraction in bupivacaine damaged DRG neurons. Using dual-luciferase assay, qRT-PCR, and western blot, BDNF was confirmed to the downstream target of miR-210 in DRG. SiRNA-mediated BDNF downregulation reversed the effect of miR-210 downregulation in DRG neurotoxicity. MiR-210, through the regulation of BDNF, plays important role in anesthetics-induced DRG neurotoxicity.

  15. Involvement of upregulation of miR-210 in a rat epilepsy model

    Science.gov (United States)

    Chen, Licheng; Zheng, Hao; Zhang, Shimeng

    2016-01-01

    Epilepsy is a common type of neurological disorder with complex etiology. The mechanisms are still not clear. MicroRNAs are endogenous noncoding RNAs with many physiological activities. Multiple microRNAs were abnormally expressed in status epilepticus, including miR-210. In this study, we applied lithium chloride and pilocarpine to induce epileptic activity and aimed to disclose the potential mechanisms. Our data showed that miR-210 was significantly upregulated in hippocampus one day after modeling (P<0.05 vs control) and the high expression of miR-210 lasted for at least 30 days. By contrast, γ-aminobutyric acid (GABA) level significantly decreased concurrently after modeling (P<0.05 vs control). To question whether miR-210 could be a potential therapeutic target for epilepsy, miR-210 inhibitor was administrated through intrahippocampal injection after epilepsy modeling. Our data showed that morphological changes of hippocampal neurons and apoptosis triggered by epilepsy were mitigated by miR-210 inhibition. More importantly, the expressions of GABA-related proteins, including GABAA receptor α1, glutamate decarboxylase, and GABA transporter 1, were significantly elevated after epilepsy modeling in both mRNA and protein levels 3 days postmodeling (P<0.05 vs control), which were mitigated by miR-210 inhibitor treatment (P<0.05 vs model). In addition, epilepsy-induced upregulation of GABA transaminase was alleviated by miR-210 inhibitor. Taken together, these data implicated potential roles of miR-210 in lithium chloride–pilocarpine-induced epilepsy model and miR-210 could serve as a potential therapeutic target in status epilepticus. PMID:27471387

  16. Enrichment of {sup 210}Po and {sup 210}Pb in ash samples from oil shale-fired power plants in Estonia

    Energy Technology Data Exchange (ETDEWEB)

    Ozden, B. [University of Tartu, Institute of Physics/Ege University, Institute of Nuclear Sciences (Estonia); Vaasma, T.; Kiisk, M.; Suursoo, S.; Tkaczyk, A.H. [University of Tartu,Institute of Physics (Estonia)

    2014-07-01

    Energy production in Estonia is largely dependent on the oil shale industry. Oil shale is a fossil fuel typically characterized by relatively high mineral composition, modest organic fraction (varying between 10 and 65%), high ash content (usually 45% to 50%), and average lower heating value of 8.4 MJ/kg{sup -1}. Oil shale-fired power plants account for 85% of Estonian electricity production and produce up to 6 million tons of oil shale ash annually. This ash contains elevated amounts of natural radionuclides (from the {sup 238}U and {sup 232}Th series and {sup 40}K), which were bound to oil shale during its formation. These radionuclides become enriched in ash fractions during the combustion process and are partially emitted to the atmosphere via fly ash and flue gases. Oil shale-fired electricity production is foreseen to remain a dominant trend in Estonia, suggesting that the radionuclide emissions to the atmosphere will continue in the future. The natural radionuclides {sup 210}Po and {sup 210}Pb, with half-lives of 138 days and 22.3 years respectively, originate from the radioactive decay of radionuclides of {sup 238}U series present in the earth's crust. These radionuclides are also built up artificially in the environment due to waste discharge from phosphate, oil, and gas industries, combustion of fossil fuels and other energy production as technically enhanced natural radionuclides. There are few studies on oil shale power plants influence on the levels of natural radioactivity in the surrounding areas. Realo, et al. reported that the annual doses from fly ash depositions over a 30 year period are in the range 90 - 200 μSv a{sup -1}. A study previously initiated by the University of Tartu, Institute of Physics (IPh) evaluated enrichment in the activity concentrations of {sup 238}U, {sup 226}Ra, {sup 210}Pb, {sup 232}Th, {sup 228}Ra and {sup 40}K in ash samples collected from Eesti Power Plant's circulating fluidized bed (CFB) boiler. According

  17. Effect of oxidative stress injury on miR-210 expression in spinal neurons and the neuroprotective effect of miR-210 inhibitor

    Institute of Scientific and Technical Information of China (English)

    Yong-Jin He; Chang-Hong Li; Zhi-Bin Liu

    2016-01-01

    Objective:To study the effect of oxidative stress injury on miR-210 expression in spinal neurons and the neuroprotective effect of miR-210 inhibitor.Methods: Spinal neurons of rats were cultured and divided into control group (group A), H2O2 group (group B), NC group (group C), H2O2+NC group (group D) and H2O2+miR-210 inhibitor group (group E), miR-210 expression levels in group A and group B as well as the cell vitality and expression levels of oxidative stress molecules, apoptotic molecules and function-related molecules in group C, group D and group E were determined.Results:miR-210 expression level in group B was significantly higher than that in group A; after 12 h, 18 h and 24 h of treatment, OD values of group D were significantly lower than those of group C, and OD values of group E were significantly higher than those of group D; after 24 h of treatment, HO-1, NOX-2, CAT, GAP-43 and synapsin-I levels in group D were significantly lower than those in group C while ROS, 8-OHdG, c-fos, c-jun, AP1, caspase-3, PSD-93 and PSD-95 levels were significantly higher than those in group C; HO-1, NOX-2, CAT, GAP-43 and synapsin-I levels in group E were significantly higher than those in group D while ROS, 8-OHdG, c-fos, c-jun, AP1, caspase-3, PSD-93 and PSD-95 levels were significantly lower than those in group D.Conclusion:Oxidative stress injury can cause high miR-210 expression in spinal neurons, and miR-210 inhibitor can reduce the neuron injury caused by oxidative stress.

  18. {sup 210}Po in the marine environment with emphasis on its behaviour within the biosphere

    Energy Technology Data Exchange (ETDEWEB)

    Fowler, Scott W., E-mail: s.fowler@free.f [School of Marine and Atmospheric Sciences, Stony Brook University, Stony Brook, NY 11794-5000 (United States)

    2011-05-15

    The distribution and behaviour of the natural-series alpha-emitter polonium-210 in the marine environment has been under study for many years primarily due to its enhanced bioaccumulation, its strong affinity for binding with certain internal tissues, and its importance as a contributor to the natural radiation dose received by marine biota as well as humans consuming seafoods. Results from studies spanning nearly 5 decades show that {sup 210}Po concentrations in organisms vary widely among the different phylogenic groups as well as between the different tissues of a given species. Such variation results in {sup 210}Po concentration factors ranging from approximately 10{sup 3} to over 10{sup 6} depending upon the organism or tissue considered. {sup 210}Po/{sup 210}Pb ratios in marine species are generally greater than unity and tend to increase up the food chain indicating that {sup 210}Po is preferentially taken up by organisms compared to its progenitor {sup 210}Pb. The effective transfer of {sup 210}Po up the food chain is primarily due to the high degree of assimilation of the radionuclide from ingested food and its subsequent strong retention in the organisms. In some cases this mechanism may lead to an apparent biomagnification of {sup 210}Po at the higher trophic level. Various pelagic species release {sup 210}Po and {sup 210}Pb packaged in organic biodetrital particles that sink and remove these radionuclides from the upper water column, a biogeochemical process which, coupled with scavenging rates of this radionuclide pair, is being examined as a possible proxy for estimating downward organic carbon fluxes in the sea. Data related to preferential bioaccumulation in various organisms, their tissues, resultant radiation doses to these species, and the processes by which {sup 210}Po is transferred and recycled through the food web are discussed. In addition, the main gaps in our present knowledge and proposed areas for future studies on the biogeochemical

  19. Etiology of epilepsy a prospective study of 210 cases

    Directory of Open Access Journals (Sweden)

    Walter Oleschko Arruda

    1991-09-01

    Full Text Available The objective of this study was to establish the etiology of epilepsy in 210 chronic epileptics (110 female, 100 male, aged 14-82 years (34.2±13.3. Patients less than 10 years-old and alcoholism were excluded. All underwent neurological examination, routine blood tests, EEG and CT-scan. Twenty patients (10.5% were submitted to spinal tap for CSF examination. Neurological examination was abnormal in 26 (12.4%, the EEG in 68 (45.5%, and CT-scan in 93 (44.3%. According to the International Classification of Epileptic Seizures (1981, 101 (48.1% have generalized seizures, 66 (31.4% partial seizures secondarily generalized, 25 (11.8% simple partial and complex partial seizures, and 14 (6.6% generalized and partial seizures. Four patients (2.0% could not be classified. In 125 (59.5% patients the etiology was unknown. Neurocysticercosis accounted for 57 (27.1% of cases, followed by cerebrovascular disease 8 (3.8%, perinatal damage 5 (2.4%, familial epilepsy 4 (1.9%, head injury 4 (1.9%, infective 1 (0.5%, and miscelanea 6 (2.8%.

  20. Morphological Characterization of the Polyflux 210H Hemodialysis Filter Pores

    Directory of Open Access Journals (Sweden)

    A. Hedayat

    2012-01-01

    Full Text Available Background. Morphological characterization of hemodialysis membranes is necessary to improve pore design. Aim. To delineate membrane pore structure of a high flux filter, Polyflux 210H. Methods. We used a Joel JSM-6010LV scanning electron microscope (SEM and a SU6600 Hitachi field emission scanning electron microscope (FESEM to characterize the pore and fiber morphology. The maximal diameters of selected uremic toxins were calculated using the macromolecular modeling Crystallographic Object-Oriented Toolkit (COOT software. Results. The mean pore densities on the outermost and innermost surfaces of the membrane were 36.81% and 5.45%, respectively. The membrane exhibited a tortuous structure with poor connection between the inner and outer pores. The aperture’s width in the inner surface ranged between 34 and 45 nm, which is 8.76–11.60 times larger than the estimated maximum diameter of β2-microglobulin (3.88 nm. Conclusion. The results suggest that the diameter size of inner pore apertures is not a limiting factor to middle molecules clearance, the extremely diminished density is. Increasing inner pore density and improving channel structure are strategies to improve clearance of middle molecules.

  1. Aerosol deposition and origin in French mountains estimated with soil inventories of 210Pb and artificial radionuclides

    OpenAIRE

    Le Roux, Gaël; Pourcelot, Laurent; Masson, Olivier; Duffa, Céline; Vray, Françoise; Renaud, Philippe

    2008-01-01

    International audience; Radionuclide inventories were measured in soils from different French mountainous areas: Chaîne des Puys (Massif Central), Eastern Corsica, Jura, Montagne Noire, Savoie, Vosges and Rhine Valley. 210Pb soil inventories were used to estimate long-term (>75 yr) deposition of submicron aerosols. Whereas 210Pb total deposition is explained partly by wet deposition, as demonstrated by increase of 210Pb inventory with annual rainfall; a part of 210Pb in the soils of higher al...

  2. Distribution of 210Po in soils of Virajpet taluk, Coorg District, Karnataka

    Directory of Open Access Journals (Sweden)

    M.M. Prakash

    2017-01-01

    Full Text Available The present investigation involves the distribution of 210Po in the soils of Virajpet taluk, in Coorg District. The soil samples were collected along a vertical profile at various locations. The samples were analyzed for determination of 210Po activity using standard radiochemical analytical method. The distribution of 210Po along vertical profile was found. The dependence of 210Po activity on organic matter and clay in a vertical profile were analysed. The texture of soil shows that soil is sandy loam or loamy sand, in which illuviation takes place easily. The 210Po activity varies from 1.59 Bqkg−1 to 13.95 Bqkg−1 in first layer, 0.49 Bqkg−1 to 9.79 Bqkg−1 in second layer and 0.58 Bqkg−1 to 6.14 Bqkg−1 in third layer. A negative correlation between organic matter percentage and 210Po activity was found in all the three layers with correlation coefficient −0.872, −0.643 and −0.505. A negative correlation was observed between clay percentage and 210Po activity, in all the three layers with correlation coefficient −0.749, −0.512 and −0.402. The organic matter leaches vertically downwards, due to flow of rainwater.

  3. Radioprotective Effect of Aminothiol PrC-210 on Irradiated Inner Ear of Guinea Pig.

    Directory of Open Access Journals (Sweden)

    Arnaud P J Giese

    Full Text Available Radiotherapy of individuals suffering with head & neck or brain tumors subserve the risk of sensorineural hearing loss. Here, we evaluated the protective effect of Aminothiol PrC-210 (3-(methyl-amino-2-((methylaminomethylpropane-1-thiol on the irradiated inner ear of guinea pigs. An intra-peritoneal or intra-tympanic dose of PrC-210 was administered prior to receiving a dose of gamma radiation (3000 cGy to each ear. Auditory Brainstem Responses (ABRs were recorded one week and two weeks after the radiation and compared with the sham animal group. ABR thresholds of guinea pigs that received an intra-peritoneal dose of PrC-210 were significantly better compared to the non-treated, control animals at one week post-radiation. Morphologic analysis of the inner ear revealed significant inflammation and degeneration of the spiral ganglion in the irradiated animals not treated with PrC-210. In contrast, when treated with PrC-210 the radiation effect and injury to the spiral ganglion was significantly alleviated. PrC-210 had no apparent cytotoxic effect in vivo and did not affect the morphology or count of cochlear hair cells. These findings suggest that aminothiol PrC-210 attenuated radiation-induced cochlea damage for at least one week and protected hearing.

  4. Variations of 210Pb concentrations in surface air at Thessaloniki, Greece (40°N

    Directory of Open Access Journals (Sweden)

    Papastefanou C.

    2012-04-01

    Full Text Available Atmospheric concentrations of 210Pb were measured over the year 2009 in ground level air at Thessaloniki, Northern Greece (40°62′ N, 22°95′E. The mean activity concentrations of 210Pb in surface air have been found to be 671 ± 213 μBq m−3. The highest values of monthly atmospheric concentrations of 210Pb were observed in the autumn and the lowest in the spring period. The higher values of 210Pb during autumn were attributed to frequent inversion conditions of the surface layers, resulting in an enrichment of radon and its decay products in surface air. The lower values during the winter months might be due to the low emanation of radon from the frozen or snow-covered soil. The minima of 210Pb concentrations during spring might reflect on higher washout during this period, which results in less emanation of radon from saturated with water soil, resulting in less production of 210Pb near ground-level air. The relative high values during summer are probably due to the higher 222Rn exhalation from the ground and due to the higher air mixing within the troposphere, which has as a result to carry down to the surface layer 210Pb whose origin is older air masses which entered into the free troposphere.

  5. An Argonaute 2 Switch Regulates Circulating miR-210 to Coordinate Hypoxic Adaptation across Cells

    Science.gov (United States)

    Hale, Andrew; Lee, Changjin; Annis, Sofia; Min, Pil-Ki; Pande, Reena; Creager, Mark A.; Julian, Colleen G.; Moore, Lorna G.; Mitsialis, S. Alex; Hwang, Sarah J.; Kourembanas, Stella; Chan, Stephen Y.

    2014-01-01

    Complex organisms may coordinate molecular responses to hypoxia by specialized avenues of communication across multiple tissues, but these mechanisms are poorly understood. Plasma-based, extracellular microRNAs have been described, yet, their regulation and biological functions in hypoxia remain enigmatic. We found a unique pattern of release of the hypoxia-inducible microRNA-210 (miR-210) from hypoxic and reoxygenated cells. This microRNA is also elevated in human plasma in physiologic and pathologic conditions of altered oxygen demand and delivery. Released miR-210 can be delivered to recipient cells, and its direct suppression of its direct target ISCU and mitochondrial metabolism is primarily evident in hypoxia. To regulate these hypoxia-specific actions, prolyl-hydroxylation of Argonaute 2 acts as a molecular switch that reciprocally modulates miR-210 release and intracellular activity in source cells as well as regulates intracellular activity in recipient cells after miR-210 delivery. Therefore, Argonaute 2-dependent control of released miR-210 represents a unique communication system that integrates the hypoxic response across anatomically distinct cells, preventing unnecessary activity of delivered miR-210 in normoxia while still preparing recipient tissues for incipient hypoxic stress and accelerating adaptation. PMID:24983771

  6. LEADAT: a MATLAB-based program for lead-210 data analysis of sediment cores

    Institute of Scientific and Technical Information of China (English)

    LU Xueqiang; MATSUMOTO Eiji

    2006-01-01

    The program described herein (LEADAT) serves to calculate sediment date and sedimentation rate using the 210Pb method for the studies of environmental processes and pollution history on a time scale of 100~150 a. The program written in MATLAB (Version7.0) permits the user to select the principal models of 210Pb method, I.e., the constant fluxes of sediment and lead-210 (CFSL) model, the constant flux of lead-210 (CFL) model, the constant initial concentration of lead-210 (CICL) model and the two-layer mixing (TLM) model. Although appropriate model selection is essentially based on understanding of the sedimentary processes, the pattern of the excess 210Pb profile is also helpful for model selection. The excess 210Pb profiles for two sediment cores collected from a brackish lake and an embayment respectively are used to demonstrate the application of the program. With a graphical user interface, the program can be easily executed. Not only ASCII but also graphical output can be generated by means of the program. Meanwhile, the code can be modified easily for extension.

  7. Polonium-210 accumulates in a lake receiving coal mine discharges-anthropogenic or natural?

    Science.gov (United States)

    Nelson, A W; Eitrheim, E S; Knight, A W; May, D; Wichman, M D; Forbes, T Z; Schultz, M K

    2017-02-01

    Coal is an integral part of global energy production; however, coal mining is associated with numerous environmental health impacts. It is well documented that coal-mine waste can contaminate the environment with naturally-occurring radionuclides from the uranium-238 ((238)U) decay series. However, the behavior of the final radionuclide in the (238)U-series, i.e., polonium-210 ((210)Po) arising from coal-mine waste-water discharge is largely unexplored. Here, results of a year-long (2014-2015) field study, in which the concentrations of (210)Po in sediments and surface water of a lake that receives coal-mine waste-water discharge in West Virginia are presented. Initial measurements identified levels of (210)Po in the lake sediments that were in excess of that which could be attributed to ambient U-series parent radionuclides; and were indicative of discharge site contamination of the lake ecosystem. However, control sediment obtained from a similar lake system in Iowa (an area with no coal mining or unconventional drilling) suggests that the levels of (210)Po in the lake are a natural phenomenon; and are likely unrelated to waste-water treatment discharges. Elevated levels of (210)Po have been reported in lake bottom sediments previously, yet very little information is available on the radioecological implications of (210)Po accumulation in lake bottom sediments. The findings of this study suggest that (Monthly Energy Review, 2016) the natural accumulation and retention of (210)Po in lake sediments may be a greater than previously considered (Chadwick et al., 2013) careful selection of control sites is important to prevent the inappropriate attribution of elevated levels of NORM in lake bottom ecosystems to industrial sources; and (Van Hook, 1979) further investigation of the source-terms and potential impacts on elevated (210)Po in lake-sediment ecosystems is warranted. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. 28 CFR 5.210 - Amount of detail required in information relating to registrant's activities and expenditures.

    Science.gov (United States)

    2010-07-01

    ... § 5.210 Amount of detail required in information relating to registrant's activities and expenditures... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Amount of detail required in information relating to registrant's activities and expenditures. 5.210 Section 5.210 Judicial...

  9. 23 CFR 636.210 - What requirements apply to projects which use the modified design-build procedure?

    Science.gov (United States)

    2010-04-01

    ... modified design-build procedure? 636.210 Section 636.210 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS DESIGN-BUILD CONTRACTING Selection Procedures, Award Criteria § 636.210 What requirements apply to projects which use the modified...

  10. 20 CFR 1010.210 - In which Department job training programs do covered persons receive priority of service?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false In which Department job training programs do covered persons receive priority of service? 1010.210 Section 1010.210 Employees' Benefits OFFICE OF THE... PRIORITY OF SERVICE FOR COVERED PERSONS Understanding Priority of Service § 1010.210 In which...

  11. 7 CFR 989.210 - Handling of varietal types of raisins acquired pursuant to a weight dockage system.

    Science.gov (United States)

    2010-01-01

    ... pursuant to a weight dockage system. 989.210 Section 989.210 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables... Regulations § 989.210 Handling of varietal types of raisins acquired pursuant to a weight dockage system....

  12. 17 CFR 210.2-02T - Accountants' reports and attestation reports on internal control over financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Accountants' reports and attestation reports on internal control over financial reporting. 210.2-02T Section 210.2-02T Commodity and... attestation reports on internal control over financial reporting. (a) The requirements of § 210.2-02(f)...

  13. Ethylene adsorption on regularly stepped copper surface: C 2H 4 on Cu(210)

    Science.gov (United States)

    Yamazaki, Daichi; Okada, Michio; Franco, Francisco C., Jr.; Kasai, Toshio

    2011-05-01

    Ethylene adsorption on regularly stepped Cu(210) surface was investigated with infrared reflection-adsorption spectroscopy and temperature programmed desorption. At 90 K, π-bonded ethylene was adsorbed on Cu(210) molecularly and all species were desorbed below 160 K. There were three types of π-bonded ethylene on the surface. Recent experimental studies have suggested that ethylene is dehydrogenated on Cu(410) due to the regular step [Kravchuk et al ., J. Phys. Chem. C, 113 (2009) 20881]. However, neither the formation of di-σ-bonded ethylene nor dehydrogenation occurred on Cu(210).

  14. Elevation of circulating miR-210-3p in high-altitude hypoxic environment

    Directory of Open Access Journals (Sweden)

    Yan eYan

    2016-03-01

    Full Text Available Background: The induction of miR-210-3p, a master hypoxamir, is a consistent feature of the hypoxic response in both normal and malignant cells. However, whether miR-210-3p acts as a circulating factor in response to a hypoxic environment remains unknown. The current study aimed to examine the effect of a high-altitude hypoxic environment on circulating miR-210-3p.Methods: We examined and compared the levels of miR-210-3p using TaqMan-based qRT-PCR in both peripheral blood cells and plasma from 84 ethnic Chinese Tibetans residing at 3560 m, 46 newly arrived migrant Han Chinese (Tibet Han and 82 Han Chinese residing at 8.9 m (Nanjing Han. Furthermore, we analyzed the correlations of miR-210-3p with hematological indices. Results: The relative concentrations of miR-210-3p to internal reference U6 in blood cells were significantly higher in the Tibet Han group (1.01±0.11, P<0.001 and in the Tibetan group (1.17±0.09, P<0.001 than in the Nanjing Han group (0.51±0.04. The absolute concentrations of plasma miR-210-3p were also markedly elevated in the Tibet Han group (503.54±42.95 fmol/L, P=0.004 and in the Tibetan group (557.78±39.84 fmol/L, P<0.001 compared to the Nanjing Han group (358.39±16.16 fmol/L. However, in both blood cells and plasma, miR-210-3p levels were not significantly different between the Tibet Han group and the Tibetan group (P=0.280, P=0.620, respectively. Plasma miR-210-3p concentrations were positively correlated with miR-210-3p levels in blood cells (r=0.192, P=0.005. Furthermore, miR-210-3p levels in both blood cells and plasma showed strong positive correlations with red blood cell counts and hemoglobin and hematocrit values. Conclusion: These data demonstrated, for the first time, that miR-210-3p might act as a circulating factor in response to hypoxic environments and could be associated with human adaptation to life at high altitudes.

  15. MicroRNA-210 is involved in the regulation of postmenopausal osteoporosis through promotion of VEGF expression and osteoblast differentiation.

    Science.gov (United States)

    Liu, Xiao-Dong; Cai, Feng; Liu, Liang; Zhang, Yan; Yang, An-Li

    2015-04-01

    MicroRNAs (miRNAs) are small non-protein-codingRNAs that function as negative gene expression regulators. miRNA-210 (miR-210) has recently been recognized in the pathogenesis of osteonecrosis associated with angiogenesis. Herein we aimed to explore the clinical significance of miR-210 treatment for postmenopausal osteoporosis. The expression of miR-210 was detected in bone marrow mesenchymal stem cells (BMSCs) in vitro and miR-210 significantly promoted the expression of vascular edothelial growth factor (VEGF) in BMSCs in a time-dependent manner (posteoporosis through promotion the VEGF expression and osteoblast differentiation.

  16. 19 CFR 210.40 - Proposed findings and conclusions and briefs.

    Science.gov (United States)

    2010-04-01

    ... UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Prehearing Conferences and Hearings § 210... law may be filed with the administrative law judge for his consideration. Such proposals and...

  17. 7 CFR 62.210 - Denial, suspension, or cancellation of service.

    Science.gov (United States)

    2010-01-01

    ... Section 62.210 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING... AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) LIVESTOCK, MEAT, AND OTHER AGRICULTURAL COMMODITIES (QUALITY SYSTEMS VERIFICATION...

  18. Measurement of the {sup 210}Po production induced by thermal neutron capture on {sup 209}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Letourneau, A. [CEA Saclay, DSM/DAPNIA/SPhN, 91191 Gif-sur-Yvette (France)]. E-mail: aletourneau@cea.fr; Fioni, G. [CEA Saclay, DSM/DAPNIA/SPhN, 91191 Gif-sur-Yvette (France); Marie, F. [CEA Saclay, DSM/DAPNIA/SPhN, 91191 Gif-sur-Yvette (France); Ridikas, D. [CEA Saclay, DSM/DAPNIA/SPhN, 91191 Gif-sur-Yvette (France); Mutti, P. [Institut Laue-Langevin, 38000 Grenoble (France)

    2006-03-15

    A measurement of the polonium production in a solid Bi target, placed in a high thermal neutron flux of 2.3 x 10{sup 13} n/cm{sup 2}/s, was performed. Two different activation methods, based on {alpha} and {gamma} spectroscopy, were used to cross check the results. Values of (16.08 {+-} 1.8) mb and (18.4 {+-} 0.9) mb for the {sup 210}Po (i.e. {sup 210gs}Bi) formation cross-section were obtained and a recommended value of (17.9 {+-} 0.8) mb was proposed. Our results are in disagreement with adopted cross-section values in the main nuclear data libraries, namely smaller by 25% for {sup 210gs}Bi. These new values will account for more precise evaluations of {sup 210}Po formation in moderated spallation targets containing {sup 209}Bi.

  19. 22 CFR 210.110 - Are any of my Federal assistance awards exempt from this part?

    Science.gov (United States)

    2010-04-01

    ... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 210.110 Are any... with the international obligations of the United States or the laws or regulations of a...

  20. Polonium-210 in mussels and fish from the Baltic-North Sea estuary

    DEFF Research Database (Denmark)

    Dahlgaard, H.

    1996-01-01

    Polonium-210 has been measured in Danish fish meat caught in the North Sea, the Kattegat and the Baltic in 1991-1994. Average values of 0.35, 0.65 and 0.96 Bq Po-210 kg(-1) fresh weight were observed for cod, herring and plaice fillets, respectively. The difference between species is statistically...... significant, whereas no effect of salinity could be observed. There is a high variation giving SD values in the range 70-100%. Mytilus edulis soft parts were analysed for Po-210 from II Danish locations ranging from full North Sea salinity to Baltic 8 parts per thousand water. Significantly increasing Po-210...... in fish and mussels may represent a natural baseline. Copyright (C) 1996 Elsevier Science Ltd....

  1. Collateral contamination concomitant to the polonium-210 poisoning of Mr Alexander Litvinenko.

    Science.gov (United States)

    Harrison, John D; Smith, Tracy; Fell, Tim; Smith, Jenny; Ham, George; Haylock, Richard; Hodgson, Alan; Etherington, George

    2017-07-20

    Mr Litvinenko died on 23rd November 2006, having been poisoned with polonium-210 on 1st November, with evidence of a previous poisoning attempt during October 2006. Measurements of 210Po in urine samples were made for a large number of people to determine whether they may have been contaminated. In the majority of cases, measured levels were attributable to the presence of 210Po from normal dietary sources. For a small number of cases, elevated levels provided evidence of direct contamination associated with the poisonings. For one individual, while estimated doses were below thresholds for irreversible organ damage, a notably increased risk of cancer can be inferred. The use of the chelating agent, Unithiol, to increase 210Po excretion in this case was only moderately effective in reducing doses received. © 2017 IOP Publishing Ltd.

  2. Implications of excess 210Pb and 137Cs in sediment cores from Mikawa Bay, Japan

    Institute of Scientific and Technical Information of China (English)

    LU Xueqiang; MATSUMOTO Eiji

    2009-01-01

    Four sediment cores were collected from Mikawa Bay, Japan, and excess 210Pb and 137Cs were measured by gamma spectrometry. Sedimentation rates for the four cores were determined by 210Pb method. The sedimentation rate range is 0.10--0.70 g/(cm2·year). The bio-mixing depth for each core is less than 7.0 cm, and was determined by the excess 210Pb profiles as well. Therefore, the bioturbation is slight. The 210Pb-derived dates coincide with the results from 137Cs geochronology. Acceleration in sedimentation rate due to environmental alteration has been found in cores A2.5 and 05AS8, representing two depocenters due to their topography. Evidence of the Tokai Flood in 2000 was found in core 05AS8 according to the profiles of both radioisotopes and trace metals.

  3. Measurement and Meteorological Analysis of 7Be and 210Pb in Aerosol at Waliguan Observatory

    Institute of Scientific and Technical Information of China (English)

    ZHENG Xiangdong; WAN Guojiang; CHEN Zunyu; TANG Jie

    2008-01-01

    Beryllium-7 (7Be) and lead-210 (210Pb) activities were measured from October 2002 to January 2004 at Waliguan Observatory (WO: 36.287 N, 100.898 E, 3816 m a.s.l (above sea level) in northwest China. 7Be and 210Pb activities are high with overall averages of 14.7 3.5 mBq m-3 and 1.8 0.8 mBq m-3 respectively. For both 7Be and 210Pb, there are significant short-term and seasonal variations with a commonly low value in summer (May-September) and a monthly maximum in April (for 7Be) and in December (for 210Pb). The ratio of 7Be/210Pb showed a broad maximum extending from April to July, coinciding with a seasonal peak in surface ozone (O3). The seasonal cycles of 7Be and 210Pb activities were greatly influenced by precipitation and thermal dynamical conditions over the boundary layer, especially for 210Pb. The vertical mixing process between the boundary layer and the aloft air modulates the variations of 7Be and 210Pb at WO in summer. It is indicated that air mass had longer residence time and originated from higher altitudes at WO in the spring-summer time and the winter in 2003. During an event with extremely high weekly-averaged 7Be concentration (24.8 mBq m-3) together with high O3 levels and low water mixing ratio, we found that air masses had been convectively transported a long distance to WO from high latitude source regions in central Asia, where significant subsiding motions were observed. In another case with the extreme 210Pb activity of 5.7 mBq m-3 high CO2 level and specific humidity (in winter), air masses had come from south China and north Indian regions where 222Rn activities were high. This study, using 7Be and 210Pb as atmospheric tracers, has revealed that complex interactions of convective mixing from the upper troposphere and long-range transports exist at WO.

  4. miR-210 Targets Iron-Sulfur Cluster Scaffold Homologue in Human Trophoblast Cell Lines

    Science.gov (United States)

    Lee, Deug-Chan; Romero, Roberto; Kim, Jung-Sun; Tarca, Adi L.; Montenegro, Daniel; Pineles, Beth L.; Kim, Ernest; Lee, JoonHo; Kim, Sun Young; Draghici, Sorin; Mittal, Pooja; Kusanovic, Juan Pedro; Chaiworapongsa, Tinnakorn; Hassan, Sonia S.; Kim, Chong Jai

    2011-01-01

    This study was performed to assess the biological significance of miR-210 in preeclampsia and small-for-gestational-age (SGA) pregnancies. Placental miR-210 expression was evaluated by quantitative RT-PCR (RT-qPCR) in the following groups: i) appropriate-for-gestational-age pregnancies (n = 72), ii) preeclampsia (n = 52), iii) SGA (n = 66), and iv)preeclampsia with SGA (n = 31). The effects of hypoxia (1% O2) on miR-210 and iron-sulfur cluster scaffold homologue (ISCU) expressions and miR-210 binding to ISCU 3′ UTR were examined in Swan 71 and BeWo cell lines. Perls' reaction (n = 229) and electron microscopy (n = 3) were conducted to verify siderosis of trophoblasts. miR-210 expression was increased in preeclampsia and SGA cases and was decreased with birth weight and gestational age. In both cell lines, miR-210 was induced by hypoxia, whereas ISCU expression was decreased. The luciferase assay confirmed miR-210 binding to ISCU mRNA 3′ UTR. RNA interference knockdown of ISCU expression in Swan 71, but not in BeWo, cells resulted in autophagosomal and siderosomal iron accumulation and a fourfold decrease of Matrigel invasion (P = 0.004). Placental ISCU expression was decreased in preeclampsia (P = 0.002) and SGA (P = 0.002) cases. Furthermore, hemosiderin-laden trophoblasts were more frequent in the placental bed of preterm preeclampsia and/or SGA births than in control cases (48.7% versus 17.9%; P = 0.004). Siderosis of interstitial trophoblasts is a novel pathological feature of preeclampsia and SGA. The findings herein suggest that ISCU down-regulation by miR-210 perturbing trophoblast iron metabolism is associated with defective placentation. PMID:21801864

  5. Small Molecule Inhibition of microRNA-210 Reprograms an Oncogenic Hypoxic Circuit.

    Science.gov (United States)

    Costales, Matthew G; Haga, Christopher L; Velagapudi, Sai Pradeep; Childs-Disney, Jessica L; Phinney, Donald G; Disney, Matthew D

    2017-03-08

    A hypoxic state is critical to the metastatic and invasive characteristics of cancer. Numerous pathways play critical roles in cancer maintenance, many of which include noncoding RNAs such as microRNA (miR)-210 that regulates hypoxia inducible factors (HIFs). Herein, we describe the identification of a small molecule named Targapremir-210 that binds to the Dicer site of the miR-210 hairpin precursor. This interaction inhibits production of the mature miRNA, derepresses glycerol-3-phosphate dehydrogenase 1-like enzyme (GPD1L), a hypoxia-associated protein negatively regulated by miR-210, decreases HIF-1α, and triggers apoptosis of triple negative breast cancer cells only under hypoxic conditions. Further, Targapremir-210 inhibits tumorigenesis in a mouse xenograft model of hypoxic triple negative breast cancer. Many factors govern molecular recognition of biological targets by small molecules. For protein, chemoproteomics and activity-based protein profiling are invaluable tools to study small molecule target engagement and selectivity in cells. Such approaches are lacking for RNA, leaving a void in the understanding of its druggability. We applied Chemical Cross-Linking and Isolation by Pull Down (Chem-CLIP) to study the cellular selectivity and the on- and off-targets of Targapremir-210. Targapremir-210 selectively recognizes the miR-210 precursor and can differentially recognize RNAs in cells that have the same target motif but have different expression levels, revealing this important feature for selectively drugging RNAs for the first time. These studies show that small molecules can be rapidly designed to selectively target RNAs and affect cellular responses to environmental conditions, resulting in favorable benefits against cancer. Further, they help define rules for identifying druggable targets in the transcriptome.

  6. Variation of {sup 210}Po daily urinary excretion for male subjects at environmental level

    Energy Technology Data Exchange (ETDEWEB)

    Hoelgye, Z.; Hyza, M.; Mihalik, J.; Rulik, P.; Skrkal, J. [National Radiation Protection Institute, Prague (Czech Republic)

    2015-05-15

    {sup 210}Po was determined in 24-h urine of seven healthy males from Prague, Czech Republic, for ten consecutive days. The results show that for each volunteer, the urinary excretion of {sup 210}Po changed only little from day to day in the studied time period. For two volunteers, the difference in the daily excreted {sup 210}Po activity for two consecutive days was not significant, given the 95 % confidence interval (two sigma) of the activity measurements. The same is valid for the excretion data of the other volunteers, except for some days where the differences were slightly higher. The range of daily urinary excretion of {sup 210}Po of each volunteer in the studied time period was quite narrow. Among the volunteers, the maximum daily urinary excretion value of {sup 210}Po was at most about a factor of 2.5 higher than the lowest excretion value. An attempt to explain the observed small inter-individual variability of {sup 210}Po excretion in daily urine is made. (orig.)

  7. The Golgin GMAP210/TRIP11 anchors IFT20 to the Golgi complex.

    Directory of Open Access Journals (Sweden)

    John A Follit

    2008-12-01

    Full Text Available Eukaryotic cells often use proteins localized to the ciliary membrane to monitor the extracellular environment. The mechanism by which proteins are sorted, specifically to this subdomain of the plasma membrane, is almost completely unknown. Previously, we showed that the IFT20 subunit of the intraflagellar transport particle is localized to the Golgi complex, in addition to the cilium and centrosome, and hypothesized that the Golgi pool of IFT20 plays a role in sorting proteins to the ciliary membrane. Here, we show that IFT20 is anchored to the Golgi complex by the golgin protein GMAP210/Trip11. Mice lacking GMAP210 die at birth with a pleiotropic phenotype that includes growth restriction, ventricular septal defects of the heart, omphalocele, and lung hypoplasia. Cells lacking GMAP210 have normal Golgi structure, but IFT20 is no longer localized to this organelle. GMAP210 is not absolutely required for ciliary assembly, but cilia on GMAP210 mutant cells are shorter than normal and have reduced amounts of the membrane protein polycystin-2 localized to them. This work suggests that GMAP210 and IFT20 function together at the Golgi in the sorting or transport of proteins destined for the ciliary membrane.

  8. Neuroprotective effects of the cannabinoid agonist HU210 on retinal degeneration.

    Science.gov (United States)

    Lax, Pedro; Esquiva, Gema; Altavilla, Cesare; Cuenca, Nicolás

    2014-03-01

    Cannabinoids have been demonstrated to exert neuroprotective effects on different types of neuronal insults. Here we have addressed the therapeutic potential of the synthetic cannabinoid HU210 on photoreceptor degeneration, synaptic connectivity and functional activity of the retina in the transgenic P23H rat, an animal model for autosomal dominant retinitis pigmentosa (RP). In P23H rats administered with HU210 (100 μg/kg, i.p.) from P24 to P90, ERG recordings showed an amelioration of vision loss, as compared to vehicle-administered animals. Under scotopic conditions, the maximum a-wave amplitudes recorded at P60 and P90 were higher in HU210-treated animals, as compared to the values obtained in untreated animals. The scotopic b-waves were significantly higher in treated animals than in untreated rats at P30, P60 and P90. This attenuation of visual deterioration correlated with a delay in photoreceptor degeneration and the preservation of retinal cytoarchitecture. HU210-treated animals had 40% more photoreceptors than untreated animals. Presynaptic and postsynaptic elements, as well as the synaptic contacts between photoreceptors and bipolar or horizontal cells, were also preserved in HU210-treated P23H rats. These results indicate that HU210 preserves cone and rod structure and function, together with their contacts with postsynaptic neurons, in P23H rats. These data suggest that cannabinoids are potentially useful to delay retinal degeneration in RP patients.

  9. Calibration and measurement of {sup 210}Pb using two independent techniques

    Energy Technology Data Exchange (ETDEWEB)

    Villa, M. [Centro de Investigacion, Tecnologia e Innovacion, CITIUS, Universidad de Sevilla, Av. Reina Mercedes 4B, 41012 Sevilla (Spain)], E-mail: mvilla@us.es; Hurtado, S. [Centro de Investigacion, Tecnologia e Innovacion, CITIUS, Universidad de Sevilla, Av. Reina Mercedes 4B, 41012 Sevilla (Spain); Manjon, G.; Garcia-Tenorio, R. [Departamento de Fisica Aplicada II, E.T.S. Arquitectura, Universidad de Sevilla, Av. Reina Mercedes 2, 41012 Sevilla (Spain)

    2007-10-15

    An experimental procedure has been developed for a rapid and accurate determination of the activity concentration of {sup 210}Pb in sediments by liquid scintillation counting (LSC). Additionally, an alternative technique using {gamma}-spectrometry and Monte Carlo simulation has been developed. A radiochemical procedure, based on radium and barium sulphates co-precipitation have been applied to isolate the Pb-isotopes. {sup 210}Pb activity measurements were done in a low background scintillation spectrometer Quantulus 1220. A calibration of the liquid scintillation spectrometer, including its {alpha}/{beta} discrimination system, has been made, in order to minimize background and, additionally, some improvements are suggested for the calculation of the {sup 210}Pb activity concentration, taking into account that {sup 210}Pb counting efficiency cannot be accurately determined. Therefore, the use of an effective radiochemical yield, which can be empirically evaluated, is proposed. {sup 210}Pb activity concentration in riverbed sediments from an area affected by NORM wastes has been determined using both the proposed method. Results using {gamma}-spectrometry and LSC are compared to the results obtained following indirect {alpha}-spectrometry ({sup 210}Po) method.

  10. Assessing public health risk in the London polonium-210 incident, 2006.

    Science.gov (United States)

    Maguire, H; Fraser, G; Croft, J; Bailey, M; Tattersall, P; Morrey, M; Turbitt, D; Ruggles, R; Bishop, L; Giraudon, I; Walsh, B; Evans, B; Morgan, O; Clark, M; Lightfoot, N; Gilmour, R; Gross, R; Cox, R; Troop, P

    2010-06-01

    Mr Alexander Litvinenko died in a London hospital on 23 November 2006, allegedly from poisoning with the radionuclide polonium-210 ((210)Po). Associated circumstances required an integrated response to investigate the potential risk of internal contamination for individuals exposed to contaminated environments. Descriptive study. Contaminated locations presenting a potential risk to health were identified through environmental assessment by radiation protection specialists. Individuals connected with these locations were identified and assessed for internal contamination with (210)Po. In total, 1029 UK residents were identified, associated with the 11 most contaminated locations. Of these, 974 were personally interviewed and 787 were offered urine tests for (210)Po excretion. Overall, 139 individuals (18%) showed evidence of probable internal contamination with (210)Po arising from the incident, but only 53 (7%) had assessed radiation doses of 1mSv or more. The highest assessed radiation dose was approximately 100mSv. Although internal contamination with (210)Po was relatively frequent and was most extensive among individuals associated with locations judged a priori to pose the greatest risk, a high degree of assurance could be given to UK and international communities that the level of health risk from exposure to the radionuclide in this incident was low. Copyright 2010 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  11. [Biological function prediction of mir-210 in the liver of acute cold stress rat].

    Science.gov (United States)

    Guo, Wen-Jin; Lian, Shuai; Guo, Jing-Ru; Zhai, Jun-Fei; Zhang, Yu-Chen; Li, Yue; Zhen, Li; Ji, Hong; Yang, Huan-Min

    2016-04-25

    The study was aimed to observe mir-210 expression in liver tissue of acute cold stress rat and predict the function of mir-210 in cold stress. Thirty SPF Wistar male rats which were 12-week-old and weighed (340 ± 20) g were used. The rats were pre-fed in normal room temperature for one week, and then were randomly divided into acute cold stress group at (4 ± 0.1) °C and normal control group at (24 ± 0.1) °C. After the rats were treated with cold stress for 12 h, the liver tissue was extracted and the gene expression of mir-210 was assayed using qRT-PCR. The results demonstrated that the gene expression of mir-210 was significantly enhanced in acute cold stress group compared with that in normal control group (n = 3, P kinds of target genes such as E2F3, RAD52, ISCU and Ephrin-A3 are more relative with liver cold stress. ISCU regulates the cell respiratory metabolism and Ephrin-A3 is related with cell proliferation and apoptosis. On the other hand, up-regulated mir-210 affects the DNA repairing mechanism which usually leads to genetic instabilities. Our results suggest that cold stress-induced up-regulation of mir-210 in liver harmfully influences cell growth, energy metabolism and hereditary.

  12. Polonium-210 in mussels and its implications for environmental alpha-autoradiography

    Energy Technology Data Exchange (ETDEWEB)

    McDonald, P.; Baxter, M.S.; Fowler, S.W.; Heyraud, M.

    1986-01-01

    Alpha-autoradiographic and radiochemical studies of the distributions of transuranic nuclides in the tissues and organs of mussels collected from the vicinity of the British Nuclear Fuels reprocessing plant at Sellafield, England, appeared to require assessment also of baseline alpha-activities of natural /sup 210/ Po levels. To ensure that the levels of /sup 210/Po in Cumbrian mussels were not artificially enhanced by local discharges, mussels from remote British and French coastal sites were also analysed. General similarities in /sup 210/Po concentrations found in mussel soft parts suggest that the /sup 210/Po levels in the Ravenglass mussels are natural and largely unsupported by /sup 210/Pb; however these levels are as much as four times greater than the present day /sup 239 +240/Pu concentrations in the same samples. These findings severely limit the usefulness of alpha-autoradiography studies for transuranic nuclides performed on such samples. Because of the recently lower concentrations of alpha-emitting transuranic nuclides (mainly /sup 238/Pu, /sup 239 +240/Pu and /sup 241/Am) in the Ravenglass environment, natural /sup 210/Po is now a major contributor to alpha-track distributions in auto-radiographic studies.

  13. Milanés 210, un patrimonio matancero

    Directory of Open Access Journals (Sweden)

    Ramón Félix Recondo Pérez

    2010-01-01

    Full Text Available Cada año, desde el 2003, el Consejo Nacional de Patrimonio Cultural convoca al Premio Nacional de Conservación y Restauración, a entregarse cada 18 de abril, Día Internacional de los Monumentos, con el objetivo de estimular la protección y el rescate del patrimonio edificado, histórico y natural de la nación. En la versión del 2010, nuestra provincia, Matanzas, estuvo representada en la categoría de Conservación por la edificación ubicada en la calle Milanés 210, vivienda del ilustre Doctor y Pedagogo Mario Emilio Dihigo Llanos y diseñada por el eminente arquitecto Enrique Marcet Palomino, cuyo legado en obras hasta nuestros días dignifica nuestra ciudad. No sería justo detallarles el valor urbano arquitectónico y contextual de la edificación sin entrar a resaltar la significación histórica del Dr. Dihigo, pues es precisamente su vida y su obra la que le aporta valor histórico a la edificación, y es por ello que en este artículo, antes de precisar valores técnico-constructivos y de ubicación de esta edificación de estilo neocolonial, representativa de modernismo matancero, a manera de introducción, haciendo un poco de historia, los familiarizamos con la figura de este prestigioso hijo de Matanzas. Valoramos además en nuestro trabajo, la necesidad del respeto al patrimonio, como libro abierto de nuestra historia, y significamos que la preservación de este inmueble es hoy realidad gracias a la sensibilidad y el respeto de las personas que lo habitan, no sólo por la figura de Dihigo, sino además por el reconocimiento al genio y la manera de hacer y construir de una época de buenas prácticas. Lleva este artículo intrínseco el homenaje también a esa familia de arquitectos, que a criterio del autor, supieron ganarse un espacio en el buen hacer de la creación arquitectónica del pasado reciente matancero, los Marcet Beato.

  14. Biogeochemical factors affecting the presence of {sup 210}Po in groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Seiler, Ralph L., E-mail: rseiler@usgs.gov [US Geological Survey, Nevada Water Science Center, 2730 N. Deer Run Road, Carson City, NV 89701 (United States); Stillings, Lisa L. [US Geological Survey, MacKay School of Mines, MS-176, University of Nevada Reno, Reno, NV 89557 (United States); Cutler, Nichole [Hydrologic Sciences Graduate Program, MS-176, University of Nevada Reno, Reno, NV 89557 (United States); Salonen, Laina; Outola, Iisa [STUK, Radiation and Nuclear Safety Authority, P.O. Box 14, FIN-00881 Helsinki (Finland)

    2011-04-15

    Research highlights: {yields} {sup 210}Po activities in numerous domestic wells in Fallon NV exceed 500 mBq/L. {yields} {sup 210}Po levels in sediment are not the primary determinant on levels in groundwater. {yields} {delta}{sup 34}S measurements indicate SO{sub 4} reduction occurred in all {sup 210}Po contaminated wells. {yields} {sup 210}Po contaminated wells are anoxic, have high pH and low Ca. {yields} Po mobilization probably involves an anaerobic S cycle in which H{sub 2}S dissolves MnO{sub 2}. - Abstract: The discovery of natural {sup 210}Po enrichment at levels exceeding 500 mBq/L in numerous domestic wells in northern Nevada, USA, led to a geochemical investigation of the processes responsible for its mobilization. {sup 210}Po activities in 63 domestic and public-supply wells ranged from below 1 mBq/L to 6590 {+-} 590 mBq/L, among the highest reported levels in the USA. There is little spatial or depth variability in {sup 210}Pb activity in study-area sediments and mobilization of a few percent of the {sup 210}Po in the sediments would account for all of the {sup 210}Po in water. Stable-isotope measurements indicate SO{sub 4} reduction has occurred in all {sup 210}Po contaminated wells. Sulfide species are not accumulating in the groundwater in much of Lahontan Valley, probably because of S cycling involving microbial SO{sub 4} reduction, abiotic oxidation of H{sub 2}S to S{sup 0} by Mn(IV), followed by microbial disproportionation of S{sup 0} to H{sub 2}S and SO{sub 4}. The high pH, Ca depletion, MnCO{sub 3} saturation, and presence of S{sup 0} in Lahontan Valley groundwater may be consequences of the anaerobic S cycling. Consistent with data from naturally-enriched wells in Florida, {sup 210}Po activities begin to decrease when aqueous sulfide species begin to accumulate. This may be due to formation and precipitation of PoS, however, Eh-pH diagrams suggest PoS would not be stable in study-area groundwater. An alternative explanation for the study area

  15. Ra-226 and Pb-210/Ra-226 Activity Ratio in the Northern South China Sea

    Science.gov (United States)

    Chi-Ju, L.; Yu-Chia, C.; Tsung-En, W.

    2004-05-01

    The surface water distributions and vertical profiles of Ra-226 in the northern South China Sea (SCS) have been measured. Surface water Ra-226 varies between 10 and 16 dpm/100 kg with higher values at stations adjacent to the landmass. Each Ra-226 profile shows an increase from the surface toward the bottom. Above 1000m depth Ra-226 is systematically about 5 dpm/100kg higher in the northern South China Sea than in the western North Pacific. This difference may be attributed to a strong Ra-226 source from the shelf and slope area of the SCS. Below this depth Ra-226 displays large variation within some of the profiles with lower limits being comparable to the activities of the western North Pacific but higher limits being systematically about 5 dpm/100kg higher. These high Ra-226 activities may reflect effects of the longer isolation time for the deep water in the SCS basin and strong Ra input from the underlying sediments. The Pb-210/Ra-226 activity ratio ranges between 1.4 and 2.7 in the surface water with higher activity ratio at the station closer to the Luzon Strait. The Pb-210 in excess over Ra-226 in the surface water due to atmospheric input may penetrate to a depth of about 200 to 500m. Below this depth, Pb-210/Ra-226 activity ratio ranges between 0.5 and 0.7 because Pb-210 is scavenged by settling particulates. Box model calculations within a mixed layer of 50m in the area yield a mean residence time of about 1 yr for Pb-210 if an atmospheric Pb-210 flux of 1 dpm/cm2/y is adopted. The activity ratio of about 0.5 to 0.7 in the deep water corresponds to a Pb-210 mean residence time of about 30 to 70 yrs with respect to particulate scavenging.

  16. {sup 210}Pb and stable lead content in fungi: Its transfer from soil

    Energy Technology Data Exchange (ETDEWEB)

    Guillen, J., E-mail: fguillen@unex.es [LARUEX, Dpt. Applied Physics, C.U.M. University of Extremadura, c/ Sta. Teresa de Jornet, 38, 06800 Merida (Badajoz) (Spain); Baeza, A. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Science, University of Extremadura, Avda. Universidad, s/n, 10071 Caceres (Spain); Ontalba, M.A. [LARUEX, Dpt. Applied Physics, Polytechnics School, University of Extremadura, Avda. Universidad, s/n, 10071 Caceres (Spain); Miguez, M.P. [Unit of Toxicology, Faculty of Veterinary Science, University of Extremadura, Avda. Universidad, s/n, 10071 Caceres (Spain)

    2009-07-01

    The uptake and transfer of natural radionuclides, other than {sup 40}K, from soil to mushrooms has been somewhat overlooked in the literature. Their contribution to the dose due to the consumption of mushrooms was considered negligible. But the contribution of {sup 210}Pb in areas unaffected by any recent radioactive fallout has been found to be significant, up to 35% of the annual dose commitment in Spain. More than 30 species of mushrooms were analyzed, and the {sup 210}Pb detected was in the range of 0.75-202 Bq/kg d.w. A slight difference was observed between species with different nutritional mechanisms (saprophytes {>=} mycorrhizae). The {sup 210}Pb content was correlated with the stable lead content, but not with its predecessor in the uranium radioactive series, {sup 226}Ra. This suggested that {sup 210}Pb was taken up from the soil by the same pathway as stable lead. The bioavailability of {sup 210}Pb in soil was determined by means of a sequential extraction procedure (NH{sub 4}OAc, 1M HCl, 6M HCl, and residue). About 30% of the {sup 210}Pb present in the soil was available for transfer to mushrooms, more than other natural radionuclides in the same ecosystem. Lycoperdon perlatum, Hebeloma cylindrosporum, and Amanita curtipes presented the highest values of the available transfer factor, ATF. As reflected in their ATF values, the transfer from soil to mushroom of some natural and anthropogenic radionuclides was in the following order: {sup 228,230,232}Th {approx} {sup 40}K {>=} {sup 137}Cs {>=} {sup 234,238}U {approx} {sup 226}Ra {>=} {sup 90}Sr {>=} {sup 210}Pb {approx} {sup 239+240}Pu {approx} {sup 241}Am.

  17. Excess of polonium-210 activity in the surface urban atmosphere. Part 2: origin of ²¹⁰Po excess.

    Science.gov (United States)

    Długosz-Lisiecka, Magdalena

    2015-02-01

    The presence of significant (210)Po activity, unsupported by its grandparent radionuclide (210)Pb, in the surface atmosphere of industrialized regions can originate from human technical activities. In urban air, the activity ratio of (210)Po to (210)Pb might increase as a result of natural condensation and coagulation processes of relatively volatile (210)Po-containing species emitted during coal combustion processes. The presence of excess of (210)Po cannot be explained by its in-growth from radioactive decay of (210)Bi. About 50% of (210)Po radionuclide released during coal combustion processes can be emitted into air as gaseous or ultrafine products. Subsequently, these products are quickly attached to the surface of fine particles suspended in the air. As a result, an excess of (210)Po activity in aerosols has been reported. However, in this manner, As much as 11 GBq of (210)Po per year can enter the urban air from the local coal power plants in Lodz city, Poland.

  18. Pb-210 fluxes and sedimentation rates on the lower continental slope between Taiwan and the South Okinawa Trough

    Science.gov (United States)

    Chung, Y.; Chang, W. C.

    1995-03-01

    Pb-210 and Ra-226 have been measured on 11 cores taken from the continental slope between northern Taiwan and the western South Okinawa Trough. Ra-226 activities generally fall between 0.5 and 2 dpm g -1. Pb-210 activities are widely variable in these cores: negligible excess Pb-210 (or no Pb-210 flux) is observed on the upper and middle slope while large excess Pb-210 values (50-90 dpm g -1) are present on the lower slope. Sedimentation rates estimated from the excess Pb-210 profiles of the cores range from 0.09 to 0.52 cm y -1 (0.08 - 0.42 g cm -2 y -1) for the lower slope and decrease toward the deeper (eastern) slope. Excess Pb-210 inventories and the Pb-210 fluxes calculated from the lower slope are 320-840 dpm cm -2 and 10-26 dpm cm -2 y -1 , respectively, assuming a steady-state input at each site for the past 100 years. Atmospheric input of Pb-210 and local production from Ra-226 do not account for the observed fluxes. Two alternative explanations are proposed: (1) boundary scavenging coupled with the Kuroshio water flowing through the area; or (2) downslope transport of high Pb-210 activity fine-grained particles from the shelf and upper/middle slope to the lower slope where they are deposited.

  19. Determination of Po-210 content in cigarette smoke using a smoking machine: A case study of Iranian cigarettes.

    Science.gov (United States)

    Horváth, Mária; Shahrokhi, Amin; Bátor, Péter; Tóth-Bodrogi, Edit; Kovács, Tibor

    2017-08-01

    The Po-210 content of tobacco has been known for a long time, however, different results can be found about the estimated amount of Po-210 that is inhaled by humans as a result of smoking cigarettes. Because of the unique properties of Po-210, the smoking machines available on the market are not suitable because of their failure to quantitatively collect Po-210 for measurement. Therefore, to estimate precisely the amount of Po-210 entering the lungs as a result of smoking, a smoking machine and sampling protocol based on relevant ISO standards - ISO-3308, ISO-3402 and ISO-4387 - was developed. A 5% HCl solution was found to be the best absorber of Po-210 from smoke. Seventeen different brands of cigarettes distributed in Iran were used to validate the new machine and sampling protocol. The Po-210 concentration was determined by alpha spectrometry; the cigarette smoke solution underwent combined acid treatment after adding a Po-209 tracer. The Po-210 activity concentration of cigarettes sold in Iran was between 9.7 ± 1.2 and 26.5 ± 4.6 mBq/cigarette and it was determined that there was no relationship between the Po-210 and nicotine contents of cigarette smoke. Additionally, it was found that 15 ± 10% of the cigarette Po-210 was transferred to the mainstream smoke. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Atmospheric deposition patterns of (210)Pb and (7)Be in Cienfuegos, Cuba.

    Science.gov (United States)

    Alonso-Hernández, Carlos M; Morera-Gómez, Yasser; Cartas-Águila, Héctor; Guillén-Arruebarrena, Aniel

    2014-12-01

    The radiometric composition of bulk deposition samples, collected monthly for one year, February 2010 until January 2011, at a site located in Cienfuegos (22° 03' N, 80° 29' W) (Cuba), are analysed in this paper. Measurement of (7)Be and (210)Pb activity concentrations were carried out in 12 bulk deposition samples. The atmospheric deposition fluxes of (7)Be and (210)Pb are in the range of 13.2-132 and 1.24-8.29 Bq m(-2), and their mean values are: 56.6 and 3.97 Bq m(-2), respectively. The time variations of the different radionuclide have been discussed in relation with meteorological factors and the mean values have been compared to those published in recent literature from other sites located at different latitudes. The annual average flux of (210)Pb and (7)Be were 47 and 700 Bq m(-2) y(-1), respectively. Observed seasonal variations of deposition data are explained in terms of different environmental features. The atmospheric deposition fluxes of (7)Be and (210)Pb were moderately well correlated with precipitation and well correlated with one another. The (210)Pb/(7)Be ratios in the monthly depositions samples varied in the range of 0.05-0.10 and showed a strong correlation with the number of rainy days.

  1. Polonium-210 in marine mussels (bivalve molluscs) inhabiting the southern coast of India.

    Science.gov (United States)

    Khan, M Feroz; Wesley, S Godwin; Rajan, M P

    2014-12-01

    The present study focused on the determination of the alpha-emitter, (210)Po, in two species of marine mussels (bivalve molluscs) commonly available in the southern coastal region of India. The brown mussel, Perna indica was collected from the west coast and the green mussel, Perna viridis from the east coast. The concentration of (210)Po was related to the allometry (length of shell, wet/dry weight of shell/soft tissue) of the mussels and significant results were found. The study period focused on three seasons namely, pre-monsoon, monsoon and post-monsoon for a 1-year period (2010-2011). The results revealed higher activity levels in smaller-sized mussels compared to larger ones. Marked variation in (210)Po activity concentration was noted in the whole-body soft tissues between seasons and sampling site (p < 0.05). The dose rate assessment for mussels was performed using the ERICA Assessment tool. The chronic exposure to mussels due to (210)Po was found to be lesser than the global benchmark dose rate of 10 μGy h(-1). The effective ingestion dose to adults who intake mussels was estimated to be in the range 5.1-34.9 μSv y(-1). The measurement contributes to the furthering of knowledge of (210)Po, since no data exist in this region. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Determination of 210Pb and 222Rn in ground water of Okinawa Island

    Science.gov (United States)

    Ito, M.; Tanahara, A.

    2012-12-01

    In this study, we developed the method of 210Pb measurement from a large amount of ground water. The chelating resin (NOBIAS CHELATE-PA1; Hitachi High-technology) column combined with the ion-exchange resin (DOWEX-88; Dow Chemical Company) column were used for pre-treatment of 210Pb from ground water of 20 litter. It should be mentioned that this determination procedure is simple, fast, and give high recovery (more than 80 %). It avoids precipitation and large consumption of chemicals. Finally 210Pb was precipitated as PbSO4 and determined with low background 2πgas flow counter. 210Pb concentration in ground water of Okinawa Island ranged from 1.40-16.7 mBq/L. We also found that the organo-210Pb complex which could not be detected by this method was involved in some water samples. By increasing the column radius and the resin mass, while keeping a constant height of the resin column, it is possible to additionally increase the flow rate and accelerate the isolation procedure. 222Rn was determined by the direct method. The emulsion scintillation cocktail (10 mL) and water sample (10 mL) were put into a vial. After shaking and stand for 200 min, 222Rn was counted by LSC for 120 min. 222Rn concentration in ground water of Okinawa Island ranged from 0.71-14.0 Bq/L.

  3. Increase of {sup 210}Po levels in human semen fluid after mussel ingestion

    Energy Technology Data Exchange (ETDEWEB)

    Kelecom, Alphonse, E-mail: lararapls@hotmail.co [Laboratory of Radiobiology and Radiometry-LARARA-PLS, Universidade Federal Fluminense, P.O.Box 100.436, 24001-970 Niteroi, RJ (Brazil); Programs in Environmental Science and Marine Biology, Universidade Federal Fluminense, Niteroi, RJ (Brazil); Gouvea, Rita de Cassia dos Santos [Laboratory of Radiobiology and Radiometry-LARARA-PLS, Universidade Federal Fluminense, P.O.Box 100.436, 24001-970 Niteroi, RJ (Brazil)

    2011-05-15

    Polonium-210 ({sup 210}Po) radioactive concentrations were determined in human semen fluid of vasectomized non-smoker volunteers. The {sup 210}Po levels ranged from 0.10 to 0.39 mBq g{sup -1} (mean: 0.23 {+-} 0.08 mBq g{sup -1}). This value decreased to 0.10 {+-} 0.02 mBq g{sup -1} (range from 0.07 to 0.13 mBq g{sup -1}) after two weeks of a controlled diet, excluding fish and seafood. Then, volunteers ate during a single meal 200 g of the cooked mussel Perna perna L., and {sup 210}Po levels were determined again, during ten days, in semen fluid samples collected every morning. Volunteers continued with the controlled diet and maintained sexual abstinence through the period of the experiment. A 300% increase of {sup 210}Po level was observed the day following mussel consumption, with a later reduction, such that the level returned to near baseline by day 4.

  4. /sup 210/Po in marine organisms: a wide range of natural radiation dose domains

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, F.P.

    1988-01-01

    Marine biota is able to concentrate /sup 210/Po to high levels, as 10/sup 3/-10/sup 5/ relative to sea water concentration. /sup 210/Po concentrations in mixed zooplankton reaches 34-51 Bq.kg/sup -1/ (fresh wt), special groups such as copepods reaching even higher concentrations /similar to/ 90 Bq.kg/sup -1/, whereas gelatinous zooplankton display /similar to/ 1 Bq.kg/sup -1/. Epipelagic teleosts feeding on plankton displayed the highest concentrations found in fish muscle, 2-21 Bq.kg/sup -1/. Contrasting with this, demersal teleosts and elasmobranchs display lower /sup 210/Po concentrations, in the ranges 0.5-7 Bq.kg/sup -1/ and 0.2-1.7 Bq.kg/sup -1/, respectively. Much higher concentrations can, however, be measured in fish liver, gonad, bone and piloric caecca, and small mesopelagic fish can reach /similar to/ 800 Bq.kg/sup -1/ on a whole-body basis. Due to these /sup 210/Po activity concentrations, dose equivalent rates delivered to biological tissues in marine organisms can vary widely, from 0.4 mSv.y/sup -1/ in gelatinous plankton up to 5.6 x 10/sup 3/ mSv.y/sup -1/ in the gut wall of sardines. It is concluded that in organisms living in the same ocean layer a wide range of internal radiation doses exists and it is essentially sustained by /sup 210/Po food-chain transfer. (author).

  5. Increase of 210Po levels in human semen fluid after mussel ingestion.

    Science.gov (United States)

    Kelecom, Alphonse; Gouvea, Rita de Cássia dos Santos

    2011-05-01

    Polonium-210 ((210)Po) radioactive concentrations were determined in human semen fluid of vasectomized non-smoker volunteers. The (210)Po levels ranged from 0.10 to 0.39 mBq g(-1) (mean: 0.23 ± 0.08 mBq g(-1)). This value decreased to 0.10 ± 0.02 mBq g(-1) (range from 0.07 to 0.13 mBq g(-1)) after two weeks of a controlled diet, excluding fish and seafood. Then, volunteers ate during a single meal 200 g of the cooked mussel Perna perna L., and (210)Po levels were determined again, during ten days, in semen fluid samples collected every morning. Volunteers continued with the controlled diet and maintained sexual abstinence through the period of the experiment. A 300% increase of (210)Po level was observed the day following mussel consumption, with a later reduction, such that the level returned to near baseline by day 4.

  6. The Radial Growth Rate of Japanese Precious Corals Using Pb-210 Dating Method

    Science.gov (United States)

    Yamada, M.; Iwasaki, N.; Suzuki, A.; Aono, T.

    2014-12-01

    Precious corals belong to the subclass Octocorallia of the class Anthozoa. Its major component is calcium carbonate and the crystal structure is high-Mg calcite. Their skeletal axes are used for jewellery, rosary, amulet, etc. They are found mainly in the Japanese coast, the Mediterranean and off the Midway Islands and they are distributed at a depth of 100 m to 1500m. The growing skeletons of precious corals have potential for recording environmental change. Pb-210 is a naturally occurring radionuclide with a half-life of 22.3 years. Pb-210 is a natural sediment marker suitable for dating events that have occurred over the past 100 years and has been used to measure the sedimentation rates of lake and coastal marine sediments. The objectives of this study were to measure the Pb-210 concentration in the skeletons of Japanese red coral, pink coral and white coral and to estimate the radial growth rate using Pb-210 dating method. The radial growth rate of the skeleton can be estimated by the gradual decrease in Pb-210 concentrations measured from the surface inwards. The radial growth rate of the pink coral skeleton (Corallium elatius), collected at depths of 200 to 300 m off the coast of the Ryukyu Islands, Japan, was 0.15 mm/year, so slow that it would take as long as 50 years for a colony to grow to 15 mm in diameter.

  7. 210Po and major ions in drainage water from soil treated with various types of fertilizers.

    Science.gov (United States)

    Jiménez, Fernando; López, Raúl; Debán, Luis; Pardo, Rafael; García-Talavera, Marta

    2007-07-01

    The levels of (210)Po, nutrients (NH(4)(+), NO(3)(-), PO(4)(3 -)) and major ions (Na(+), K(+), Mg(2 +), Ca(2 +), F(-), NO(2 -), Br(-), Cl(-), SO(4)(2 -)) were determined, by means of lysimeter experiences, in drainage waters for agricultural soils untreated and treated with different types of fertilizers (animal manure, sewage sludge and NPK synthetic fertilizer) applied at several rates. Analytical determinations were performed by using alpha -spectrometry in the case of (210)Po, or Ion Exchange liquid chromatography for the other ionic species. Statistical uni and multivariate analysis of the results shown significant differences among lixiviates according to the different fertilizer treatments. Sewage sludge and manure applications resulted in similar compositions of lixiviates with low (210)Po levels, whereas synthetic fertilizers produced higher (210)Po concentrations and different concentration patterns of ionic species when applied at or above the recommended rates. All (210)Po levels were well below the limits proposed by the 2001/928/ Euratom Recommendation. The concentrations of the rest of the ionic species, exception made from NH(4)(+) and NO(3)(-), were also below the limits proposed by Spanish regulations.

  8. {sup 137}Cs and {sup 210}Po dose assessment from marine food in Cienfuegos Bay (Cuba)

    Energy Technology Data Exchange (ETDEWEB)

    Alonso-Hernandez, C. E-mail: carlos@ceac.perla.inf.cu; Diaz-Asencio, M.; Munos-Caravaca, A.; Suarez-Morell, E.; Avila-Moreno, R

    2002-07-01

    One part of Radiological Monitoring Programme in central Cuba (1991-1995) was dedicated to study the background levels of natural and anthropogenic radioactivity in Cienfuegos Bay in the vicinity of the first Cuban nuclear power station under construction. {sup 210}Po and {sup 137}Cs concentrations in fish, molluscs and crustaceans collected in Cienfuegos Bay were determined and the committed effective doses (CED) were calculated for two population groups inhabiting this region. The highest values of {sup 210}Po concentrations were found in crustaceans, but significant accumulation was also observed in fish and molluscs. The mean {sup 137}Cs concentrations in organisms are several times lower with respect to {sup 210}Po, a situation that characterises the regions affected by the global fallout only. Values of CED from the consumption of crustaceans and molluscs are very low both from{sup 210}Po and {sup 137}Cs. The mean individual dose from {sup 210}Po in the seafood consumed varies from 39 {mu}Sv for general populations to 2802 {mu}Sv for the 'critical group' consuming 320 kg of fish per year. The dose from {sup 137}Cs is negligible.

  9. Up-Regulation of microRNA-210 is Associated with Spermatogenesis by Targeting IGF2 in Male Infertility.

    Science.gov (United States)

    Tang, Dongdong; Huang, Yuanyuan; Liu, Weiqun; Zhang, Xiansheng

    2016-08-18

    BACKGROUND MicroRNAs (miRNAs) play pivotal roles in spermatogenesis. MicroRNA-210 (miR-210) expression was up-regulated in the testes of sterile men with non-obstructive azoospermia (NOA). However, the underlying mechanisms of miR-210 involved in the spermatogenesis in patients with NOA are unknown. MATERIAL AND METHODS Expression of miR-210 and insulin-like growth factor II (IGF2) in the testes of NOA cases (only including maturation arrest and hypospermatogenesis) were detected in this study. We carried out in vitro experiments to determine if IGF2 was directly targeted by miR-210 in NT2 cells. RESULTS Compared with obstructive azoospermia (OA) as normal control, our results suggest that miR-210 was significantly up-regulated in testis of patients with NOA (Pspermatogenesis by targeting IGF2 in male infertility.

  10. Determination of 210Pb, 210Po, 226Ra, 228Ra and uranium isotopes in drinking water in order to comply with the requirements of the EU ‘Drinking Water Directive.

    Science.gov (United States)

    Vasile, M; Loots, H; Jacobs, K; Verheyen, L; Sneyers, L; Verrezen, F; Bruggeman, M

    2016-03-01

    The European Union published in 2013 a new Drinking Water Directive with stricter requirements for measuring natural radioactivity. In order to adhere to this, a method for sequential separation of 210Pb, 210Po, 238U and 234U in drinking water was applied using UTEVA® and Sr resins. Polonium-210, 238U and 234U were quantified using alpha-particle spectrometry and 210Pb using liquid scintillation counting. Radium-226 and 228Ra were determined using 3M Empore Radium RAD Disks, and their quantification was done using a Quantulus™ 1220 liquid scintillation counter.

  11. Study of the particulate matter transfer and dumping using {sup 210} Po et le {sup 210} Pb. Application to the Gulf of Biscary (NE Atlantic Ocean) and the Gulf of Lion (NW Mediterranean Sea) continental margins; Etude du transfert et du depot du materiel particulaire par le {sup 210} Po et le {sup 210} Pb. Application aux marges continentales du Golfe de Gascogne (NE Atlantique) et du Golfe du Lion (NW Mediterranee)

    Energy Technology Data Exchange (ETDEWEB)

    Radakovitch, O.

    1995-07-07

    {sup 210} Po and {sup 210} Pb activities and fluxes were measured on seawater, sediment-trapped material collected during one year and sediment. Focalization of {sup 210} Pb is clearly noticed on the Cap-Ferret canyon (Gulf of Biscary) and the Lacaze-Duthiers canyon (western part of the Gulf of Lion). In both sites, {sup 210} Pb fluxes in traps and sediment are always higher than {sup 210} Pb flux available from atmospheric and in situ production. On the contrary, Grand-Rhone canyon and its adjacent open slope exhibit a {sup 210} Pb budget near equilibrium in the near-bottom sediment traps, but focalization is important in the sediment. For the entire Gulf of Lion margin, focalization of {sup 210} Pb in the sediment occurred principally between 500 and 1500 m water depth on the slope, and on the middle shelf mud-patch. {sup 210} Po and {sup 210} Pb have been used in the Cap Ferret and Grand-Rhone canyons to characterize the origin of the particulate trapped material. Two main sources feed the water column. The first source, localized in surface waters, is constituted by biogenic particles from primary production and lithogenic material. The second source, deeper, is due to resuspension at the shelf break and/or on the open slope. In each site, {sup 210} Po and {sup 210} Pb activities of the trapped particles did not show any relations with the major constituents. Quantity of particles appeared to be the main factor regulating adsorption processes of these nuclides. Sedimentation rates based on {sup 210} Po profiles decreased with increasing water depth, from 0.4 ti 0.06 cm y-1 on the Cap Ferret canyon (400 to 3000 m water depth) and from 0.5 to 0.05 cm y-1 for the entire Gulf of Lion margin (50 to 2000 m water depth). (author). 243 refs.

  12. Synergistic effect of polonium-210 and cigarette smoke in rats. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Black, S.C.; Bretthauer, E.W.

    1975-06-01

    An experimental procedure was devised to test the possible synergistic effect of polonium-210 and cigarette smoke in rats. Appropriate techniques were developed to expose the rats to cigarette smoke through mouth-breathing and to add known amounts of polonium-210 to the cigarette smoke. The findings from this experiment included: (1) lung deposition of polonium-210 was 31 plus or minus 2%, (2) early retention of polonium was two-phased with half-times of 4 and 84 hours, and (3) bronchitis, emphysema and lung tumors were observed in the experimental animals. Though the spontaneous occurrence of two lung tumors in the number of animals at risk was highly improbable, any conclusion that this resulted from the exposure to cigarette smoke must be highly qualified. (GRA)

  13. Accumulation of polonium 210Po in tissues and organs of deer carvidae from Northern Poland.

    Science.gov (United States)

    Skwarzec, Bogdan; Prucnal, Malgorzata

    2007-01-01

    This study was undertaken to provide information on accumulation of polonium in tissues and organs of deer carvidae in order to assess the potential transport of this element via food-chain to game meat consumers. Livers, kidneys and muscles of large herbivorous animals belonging to three species: roe deer (Capreolus capreolus), red deer (Cervus elaphus) and fallow deer (Dama dama), collected in Northern Poland, were the subject of the present investigation. Activities of (210)Po were determined by means of alpha spectrometry along with relevant radiochemical procedures. The concentration of (210)Po in analyzed animals decreased in the order kidney > liver > muscle tissue. The average activity concentrations of (210)Po ranged between 0.02 +/- 0.01 Bq. kg(- 1) w.w. in muscles and 7.15 +/- 0.12 Bq. kg(- 1) w.w. in kidneys. Levels of polonium were not influenced by sampling location, sex, age and species of animals.

  14. A case study of soil erosion and sedimentation magnitudes in Morocco using 137-Cs & 210-Pbex

    Science.gov (United States)

    Mabit, L.,; Benmansour, M.,; Nouira, A.,

    2010-05-01

    Despite the severity of land degradation in Morocco, only limited data are available on the actual magnitude of soil erosion rates. Most of the previous research used conventional measurements. Since the mid 1990's only a few studies reported the use of the 137-Cs approach and, excess lead-210 (210-Pbex) as soil tracer in Morocco. The site under investigation is a one hectare agricultural field dominated by cereals under conventional tillage (plough depth ~ 16 cm) and semiarid climate located in Marchouch 68 km south east from Rabat (Morocco). In this field, 50 soil core samples were collected along 5 parallel transects. The initial 137-Cs and 210-Pb fallout were assessed through 12 core samples collected in an undisturbed pasture located 3 km from the field studied. After γ-spectrometry analysis, the areal activities of 137-Cs and 210-Pbex were converted into soil redistribution rates using the convertion model Mass Balance Model II (MBM II). Soil redistribution rates obtained from both isotopes were analyzed using geostatistic approach and a classical interpolation concept (Inverse Distance Weighting (IDW)). Maps of soil redistribution were established and a sediment budget for the whole field was calculated. For the reference site, the vertical distribution associated with both radionuclides was similar and concentrated in the top 10 cm with a clear exponential decrease with depth. The reference inventories values were estimated at 3305 Bq m-2 (n = 12; CV of 30%) and 1445 Bq m-2 (n = 12; CV of 18%) for 210-Pbex and 137-Cs, respectively. For the cultivated site, experimental variograms of soil redistribution rate calculated from the data provided by the 137-Cs and 210-Pbex results were fitted. Following the optimization of variographic parameters and the cross-validation analysis, the geostatistical study of the data set reported a very weak autocorrelation. So, a simple spatialisation of the data set using IDW2 was used to spatialise the soil redistribution

  15. Hypoxia-inducible miR-210 contributes to preeclampsia via targeting thrombospondin type I domain containing 7A.

    Science.gov (United States)

    Luo, Rongcan; Wang, Yongqing; Xu, Peng; Cao, Guangming; Zhao, Yangyu; Shao, Xuan; Li, Yu-xia; Chang, Cheng; Peng, Chun; Wang, Yan-ling

    2016-01-22

    Preeclampsia, a relatively common pregnancy disorder, is a major contributor to maternal mortality and morbidity worldwide. An elevation in microRNA-210 (miR-210) expression in the placenta has been reported to be associated with preeclampsia. Our bioinformatic analysis showed that thrombospondin type I domain containing 7A (THSD7A) is a predicted target for miR-210. The aim of this study was to determine whether miR-210 is involved in preeclampsia through its targeting of THSD7A in human placental trophoblasts. In preeclamptic placental tissues, THSD7A levels were significantly downregulated, and were inversely correlated with the levels of miR-210. THSD7A was validated as a direct target of miR-210 using quantitative real time PCR (qRT-PCR), Western blotting, and dual luciferase assays in HTR8/SVneo cells. Transwell insert invasion assays showed that THSD7A mediated the invasion-inhibitory effect of miR-210 in HTR8/SVneo cells. Interestingly, hypoxia markedly increased miR-210 expression while suppressing THSD7A expression in a time-dependent manner in HTR8/SVneo cells. This study provides novel data on the function of THSD7A in human placental cells, and extends our knowledge of how miR-210 is involved in the development of the preeclampsia.

  16. Analysis of {sup 210} Pb and {sup 137} Cs in diets of university students; Analise de {sup 210} Pb e {sup 137} Cs em dietas de estudantes universitarios

    Energy Technology Data Exchange (ETDEWEB)

    Saito, Roberto T.; Cunha, Ieda I.L.; Maihara, Vera A.; Favaro, Deborah I.T. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Supervisao de Radioquimica]. E-mail: biologia@curiango.ipen.br; Cozzolino, Silvia M.F. [Sao Paulo Univ., SP Faculdade de Ciencias Farmaceuticas (Brazil)

    2000-07-01

    In this work, {sup 210} P and {sup 137} Cs were determined in the male students diets (age: 19-25) of Sao Paulo University, by gamma spectrometry. The sampling was made using the duplicate portion methodology, which consists in collecting duplicate portions of all food and beverage consumed during three days of a week. The levels obtained for {sup 210} Pb in these samples varied from the Minimum Detectable Concentration (0.43 Bq.kg{sup -1} ) to 1.68 Bq.kg{sup -1} . For {sup 137} Cs, the values ranged from the Minimum Detectable Concentration (0.17 Bq.kg{sup -1} ) to 0.95 Bq.kg{sup -1} . An estimate of the daily ingestion of those radionuclides was made according to the data obtained. The values varied from 78 to 309 mBq.d{sup -1} for {sup 210} Pb, and 53 to 157 mBq.d{sup -1} , for {sup 137} Cs, among the diets analyzed. The data obtained these diets agreed with the data obtained for other authors. (author)

  17. 137Cs and 210Po in Pacific Walrus and Bearded Seal from St. Lawrence Island, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T F; Seagars, D J; Jokela, T; Layton, D

    2005-02-02

    The activity concentration of Cesium-137 ({sup 137}Cs) and naturally-occurring Polonium-210 ({sup 210}Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea. The mean {sup 137}Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg{sup -1} (N= 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg{sup -1} (N=2, wet weight), respectively, in bearded seal. In general, {sup 137}Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, {sup 210}Po activity concentrations appear to be higher than those reported elsewhere but a larger variation. The mean {sup 210}Po concentration in the muscle tissue, liver and kidney of Pacific walrus (N=5, wet weight) were 28.7, 189, and 174 Bq kg{sup -1}, respectively. This compares with {sup 210}Po concentration values (N=2, wet weight) of 27, 207, and 68 Bq kg{sup -1} measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated bioaccumulation factors--as defined by the radionuclide concentration ratio between the target tissue to that in sea water--were two to three orders of magnitude higher for {sup 210}Po that those of {sup 137}Cs. We conclude from radiological dose estimates that ingestion of {sup 137}Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessing health risks to Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic.

  18. The human alimentary tract transfer and body retention of environmental polonium-210.

    Science.gov (United States)

    Hunt, G J; Rumney, H S

    2007-12-01

    This paper presents the results of a 4 year study to investigate the human alimentary tract transfer factor (f(A) value) and body retention of 210 Po in shellfish. In the first 3 years, mussels (Mytilus edulis L.), cockles (Cerastoderma edule L.) and brown meat from crab (Cancer pagurus L.) were successively studied. In each year five volunteers (from a pool of seven) ate a suitable portion of the shellfish and provided 24 h samples of excreta usually for 3 days before and for at least 7 days during and after eating. Subsamples of shellfish were analysed to determine the intakes of 210 Po. Faeces were analysed and the data used to assess apparent fA values. Urine samples were analysed in the mussel and crab studies to provide urinary excretion parameters. Pb-210 was also analysed during the mussel study; the levels were low, leading to large uncertainties, but confirming the negligible effect of radioactive decay to its granddaughter 210 Po in the main study. In the fourth year, larger samples of brown crab meat were eaten by five volunteers and faecal samples were taken at suitable times over periods of up to 43 days to study body retention of 210 Po. The first approximately 7 days provided additional data on fA values. Pooled results for the apparent fA for the whole study lay in the range 0.15-0.65 with a mean of 0.46; corrections for endogenous excretion suggest a true fA value of approximately 0.51, supporting the value of 0.5 currently used by the International Commission on Radiological Protection (ICRP). The retention data suggest a biological half-time of about 40 days, in broad consistency with the 50 days currently used by the ICRP. Thus there is no strong evidence from this study suggesting a change in dose coefficient for 210 Po. Full experimental data are provided to allow independent further interpretation.

  19. The international follow-up of individuals potentially exposed to polonium-210 in London 2006.

    Science.gov (United States)

    Shaw, K; Anders, K; Olowokure, B; Fraser, G; Maguire, H; Bailey, M; Smith, J; Frossell, S; Yap, K; Evans, B

    2010-06-01

    Following a death from polonium-210 ((210)Po), contamination was found at several sites in London. This paper describes the UK Health Protection Agency's follow-up and assessment of individuals resident overseas who were potentially exposed to (210)Po. Descriptive follow-up study. Individuals were classified into three exposure groups (higher, lower and unknown). Presence and degree of internal contamination were measured by 24-h urinary (210)Po activity (mBq/day). Results over 30mBq/day were taken to indicate probable contact with (210)Po in this incident. Dose assessments were conducted to determine degree of exposure and to identify individuals requiring further follow-up. Overall, 664 potentially exposed persons from 52 countries and territories were identified. Of these, 157 (24%) were in the higher exposure category, and urinary measurements were reported for 31% (48/157). Results for 19% (9/48) of those at higher exposure were more than 30mBq/day. For those at lower exposure, the percentage was 4% (3/68). Results above 30mBq/day were significantly more likely to be reported for the higher exposure category than the lower exposure category (Fisher's exact test P=0.010). Reported dose assessments suggested that identified individuals were not at increased health risk in the long term. Challenges and practical lessons were identified during the investigation. The results suggest that it is unlikely that any overseas resident had significant internal contamination with (210)Po. However, this incident clearly demonstrated the scale of international involvement likely to be necessary in other public health emergencies in large cities. The lessons identified have implications for the international health community, particularly with regard to the follow-up of individuals exposed to radiation in one country who then travel to another. Copyright 2010 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  20. Multilayers of InGaAs Nanostructures Grown on GaAs(210 Substrates

    Directory of Open Access Journals (Sweden)

    Wang Zhiming

    2010-01-01

    Full Text Available Abstract Multilayers of InGaAs nanostructures are grown on GaAs(210 by molecular beam epitaxy. With reducing the thickness of GaAs interlayer spacer, a transition from InGaAs quantum dashes to arrow-like nanostructures is observed by atomic force microscopy. Photoluminescence measurements reveal all the samples of different spacers with good optical properties. By adjusting the InGaAs coverage, both one-dimensional and two-dimensional lateral ordering of InGaAs/GaAs(210 nanostructures are achieved.

  1. Polonium-210 and Caesium-137 in lynx (Lynx lynx), wolverine (Gulo gulo) and wolves (Canis lupus).

    Science.gov (United States)

    Gjelsvik, Runhild; Holm, Elis; Kålås, John Atle; Persson, Bertil; Asbrink, Jessica

    2014-12-01

    Wolves, lynx and wolverines are on the top of the food-chain in northern Scandinavia and Finland. (210)Po and (137)Cs have been analysed in samples of liver, kidney and muscle from 28 wolves from Sweden. In addition blood samples were taken from 27 wolves. In 9 of the wolves, samples of muscle, liver and blood were analysed for (210)Po. Samples of liver and muscle were collected from 16 lynx and 16 wolverines from Norway. The liver samples were analysed for (210)Po and (137)Cs. Only (137)Cs analyses were carried out for the muscle samples. The wolves were collected during the winter 2010 and 2011, while the samples for lynx and wolverines were all from 2011. The activity concentrations of (210)Po in wolves were higher for liver (range 20-523 Bq kg(-1) d.w.) and kidney (range 24-942 Bq kg(-1) d.w.) than muscle (range 1-43 Bq kg(-1) d.w.) and blood (range 2-54 Bq kg(-1) d.w.). Activity ratios, (210)Po/(210)Pb, in wolf samples of muscle, liver and blood were in the ranges 2-77, 9-56 and 2-54. Using a wet weight ratio of 3.8 the maximal absorbed dose from (210)Po to wolf liver was estimated to 3500 μGy per year. Compared to wolf, the ranges of (210)Po in liver samples were lower in lynx (range 22-211 Bq kg(-1) d.w.) and wolverine (range16-160 Bq kg(-1) d.w.). Concentration of (137)Cs in wolf samples of muscle, liver, kidney and blood were in the ranges 70-8410 Bq kg(-1) d.w., 36-4050 Bq kg(-1) d.w., 31-3453 Bq kg(-1) d.w. and 4-959 Bq kg(-1) d.w., respectively. (137)Cs in lynx muscle and liver samples were in the ranges 44-13393 Bq kg(-1) d.w. and 125-10260 Bq kg(-1) d.w. The corresponding values for (137)Cs in wolverine were 22-3405 Bq kg(-1) d.w. for liver and 53-4780 Bq kg(-1) d.w. for muscle. The maximal absorbed dose from (137)Cs to lynx was estimated to 3000 μGy per year.

  2. Mobilization Of Polonium-210 In Naturally-Contaminated Groundwater, Churchill County, Nevada

    Science.gov (United States)

    Seiler, R. L.; Stillings, L. L.; Cutler, N.

    2009-12-01

    Polonium-210 activities in groundwater rarely exceed about 40 mBq/L because it strongly binds to sediments. The recent discovery of natural 210Po at levels ranging from below 1 to 6,300±280 mBq/L in 62 drinking-water wells in Lahontan Valley, Churchill County, Nevada, led to a geochemical investigation of the processes responsible for its mobilization from the aquifer sediments. The source of the 210Po is radioactive decay of uranium in sediments transported into the valley by erosion of granitic rocks in the Sierra Nevada during the Pleistocene. There is little spatial or depth variability in 210Pb activity in study-area sediments (average 35 Bq/kg) and detailed analysis at a contaminated well indicates mobilization of 200 mBq/L) are associated with anoxic water (DO 9.0). Investigations in the 1980s by William Burnett and colleagues of naturally-contaminated wells in Florida showed that 210Po was mobilized by sulfate-reducing bacteria and remained in solution as long as sulfides did not accumulate above certain levels. Similarly, δ34SSO4 values in Lahontan Valley indicate that significant sulfate reduction has occurred in wells containing >200 mBq/L of 210Po, but sulfide is not accumulating and its concentrations are low (<0.03 mg/L) in 25 of 28 of those wells. In our working hypothesis, mobilization of 210Po in Lahontan Valley is linked to reduction of Mn oxides by sulfide in an anaerobic sulfur cycle (Figure 1). Such a sulfur cycle is consistent with the high pH, less than predicted δ18OSO4 values, low sulfide concentrations, and presence of elemental sulfur in the water. Results from the Nevada and Florida investigations suggest that 210Po contamination may be more widespread than previously recognized, occurring in groundwater near uranium-mine operations and other uranium containing sediments when sulfate-reducing conditions develop in the subsurface. Possible linkage of anaerobic S cycle, Mn reduction, and Po mobilization

  3. The inflow of polonium (210)Po from Vistula river catchments area.

    Science.gov (United States)

    Skwarzec, Bogdan; Jahnz, Anna

    2007-12-01

    The activities of polonium (210)Po in Vistula unfiltered water samples, collected from November 2002 to November 2003, were measured using the alpha spectrometry. In winter, the highest concentration of (210)Po was in Vistula river water from Torun (2.72 +/- 0.04 Bq x m(-3)) and from the Wieprz river (5.46 +/- 0.07 Bq x m(-3) [Bequerel per cubic metre]), and the lowest was in water from Nida river (0.59 +/- 0.02 Bq x m(-3)). During spring, the highest concentration of (210)Po was observed in Vistula water collected in Deblin (5.98 +/- 0.03 Bq x m(-3)) and the lowest in water from the Narew river (1.20 +/- 0.12 Bq x m(-3)). In summer, the highest concentration of (210)Po was in Nogat river water collected in Malbork (3.18 +/- 0.04 Bq x m(-3)) and the Bzura river (5.30 +/- 0.02 Bq x m(-3)), the lowest in Wieprz river (0.49 +/- 0.09 Bq x m(-3)) and Vistula river water from Kraków (1.44 +/- 0.05 Bq x m(-3)). In autumn, the highest (210)Po concentration was in Bzura river (8.93 +/- 0.03 Bq x m(-3)), the lowest in Vistula water from Grudziadz (1.51 +/- 0.04 Bq x m(-3)), and Toruń (1.89 +/- 0.05 Bq x m(-3)). The highest quantity of (210)Po was transported from Vistula catchments area to the Baltic Sea in spring and the lowest in summer. Annually, the southern Baltic Sea is enriched by about 73.7 GBq (210)Po (with Leniwka and Nogat rivers), with 71.6 GBq going to Gdańsk Bay and 2.1 GBq to Vistula Lagoon. The highest surface (210)Po runoff was observed in spring (to 1370 kBq x km(-2) x quarter(-1) for Dunajec catchment's area), the lowest in summer (for Nida catchment's area to 100 kBq x km(-2) x quarter(-1)).

  4. Hippocrates法复位治疗肩关节脱位210

    Institute of Scientific and Technical Information of China (English)

    魏璟璟; 谭宗奎

    2012-01-01

    目的:为评价Hippocrates法治疗肩关节脱位的临床效果.方法:回顾性分析了采用该法治疗的210例肩关节脱位的临床资料.结果:210例中189例原发性脱位均一次复位成功;习惯性脱位21例中有9例手法失败后经手术复位成功.结论:Hippocrates法是治疗新鲜肩关节脱位有效疗法.

  5. Speech Quality Measurement of GSM Infrastructure Built on USRP N210 and OpenBTS Project

    Directory of Open Access Journals (Sweden)

    Marcel Fajkus

    2014-01-01

    Full Text Available The paper deals with the methodology for speech quality measuring in GSM networks using Perceptual Evaluation of Speech Quality (PESQ. The paper brings results of practical measurement of own GSM network build on the Universal Software Radio Peripheral (USRP N210 hardware and OpenBTS software. This OpenBTS station was installed in open terrain, and the speech quality was measured from different distances from the transmitter. The limit parameters of OpenBTS station with USRP N210 were obtained.

  6. ADSORPTION OF H2 ON FRAGMENTS OF MOF-210: A DFT INVESTIGATION

    OpenAIRE

    Liu, Z.

    2014-01-01

    Molecular hydrogen adsorption on MOF-210 was evaluated at the density functional theory level. The most stable H2 adsorption occurs near the acetenyls in the organic linker, but its binding energy (0.113 eV) is not sufficient to satisfy the minimum value (0.24 eV) required for practical applications. Meanwhile, Li cation-decorated MOF-210 has the average hydrogen adsorption energies of 0.28 eV, and its saturated hydrogen storage capacity reaches 5.35 wt.%.

  7. Adsorption of H2 on Fragments of MOF-210: a DFT Investigation

    Science.gov (United States)

    Liu, Z.

    2014-12-01

    Molecular hydrogen adsorption on MOF-210 was evaluated at the density functional theory level. The most stable H2 adsorption occurs near the acetenyls in the organic linker, but its binding energy (0.113 eV) is not sufficient to satisfy the minimum value (0.24 eV) required for practical applications. Meanwhile, Li cation-decorated MOF-210 has the average hydrogen adsorption energies of 0.28 eV, and its saturated hydrogen storage capacity reaches 5.35 wt.%.

  8. Neuroprotective effects of the cannabinoid agonist HU210 on retinal degeneration

    OpenAIRE

    Lax Zapata, Pedro; Esquiva Sobrino, Gema; Altavilla, Cesare; Cuenca Navarro, Nicolás

    2014-01-01

    Cannabinoids have been demonstrated to exert neuroprotective effects on different types of neuronal insults. Here we have addressed the therapeutic potential of the synthetic cannabinoid HU210 on photoreceptor degeneration, synaptic connectivity and functional activity of the retina in the transgenic P23H rat, an animal model for autosomal dominant retinitis pigmentosa (RP). In P23H rats administered with HU210 (100 μg/kg, i.p.) from P24 to P90, ERG recordings showed an amelioration of vision...

  9. Distributions of (137)Cs and (210)Pb in moss collected from Belarus and Slovakia.

    Science.gov (United States)

    Aleksiayenak, Yu V; Frontasyeva, M V; Florek, M; Sykora, I; Holy, K; Masarik, J; Brestakova, L; Jeskovsky, M; Steinnes, E; Faanhof, A; Ramatlhape, K I

    2013-03-01

    In the present work, moss samples collected in Slovakia and Belarus were assayed with respect to gamma-emitting radionuclides. The results for (137)Cs and (210)Pb are discussed. Moss was used for the first time in Belarus, as a biological indicator of radioactive environmental pollution in consequence of the Chernobyl accident in 1986. In Belarus, the maximum activity of (137)Cs was observed in the Gomel region near Mazyr (6830 Bq/kg) and the minimum activity in the Vitebsyevsk Region near Luzhki-Yazno (5 Bq/kg). "Hot spots" were also observed near the towns Borisow and Yuratsishki. The results of measurements of (137)Cs in moss samples collected in 2000, 2006 and 2009 in the same localities of Slovakia are presented and compared with the results of air monitoring of (137)Cs carried out in Slovakia from 1977 until 2010. Measurements of the (210)Pb concentration in moss samples collected over the territory of Slovakia showed, that the median value exceed 2.3 times median value of (210)Pb obtained for Belarus moss. For that reason, the inhalation dose for man from (210)Pb and (137)Cs in Slovakia is more than twice as high as in Belarus, in spite of the initially very high (137)Cs exposure in the latter country.

  10. 17 CFR 210.2-06 - Retention of audit and review records.

    Science.gov (United States)

    2010-04-01

    ... Accountants § 210.2-06 Retention of audit and review records. (a) For a period of seven years after an accountant concludes an audit or review of an issuer's financial statements to which section 10A(a) of the... accountant shall retain records relevant to the audit or review, including workpapers and other...

  11. Low-level gamma-ray spectrometry for the determination of 210Pb

    DEFF Research Database (Denmark)

    Markovic, Nikola; Roos, Per; Nielsen, Sven Poul

    2017-01-01

    A well High purity germanium (HPGe) gamma spectrometer with NaI(Tl) Compton anticoincidence shield recently installed at DTU Nutech and specially designed for low-level measurements was used for the 210Pb determination in environmental samples. The system is compared to standard stand-alone HPGe...

  12. 76 FR 33981 - Special Conditions: Pratt and Whitney Canada Model PW210S Turboshaft Engine

    Science.gov (United States)

    2011-06-10

    ... for the PW210S engine model was published on February 14, 2011 (76 FR 8321). One comment letter was... unit (APU) mode. The applicable airworthiness regulations do not contain adequate or appropriate safety... novel or unusual design feature, which is engine operation in auxiliary power unit (APU) mode....

  13. C2H4 adsorption on Cu(210), revisited: bonding nature and coverage effects.

    Science.gov (United States)

    Amino, Shuichi; Arguelles, Elvis; Agerico Diño, Wilson; Okada, Michio; Kasai, Hideaki

    2016-08-24

    With the aid of density functional theory (DFT)-based calculations, we investigate the adsorption of C2H4 on Cu(210). We found two C2H4 adsorption sites, viz., the top of the step-edge atom (S) and the long bridge between two step-edge atoms (SS) of Cu(210). The step-edge atoms on Cu(210) block the otherwise active terrace sites found on copper surfaces with longer step sizes. This results in the preference for π-bonded over di-σ-bonded C2H4. We also found two stable C2H4 adsorption orientations on the S- and SS-sites, viz., with the C2H4 C[double bond, length as m-dash]C bond parallel (fit) and perpendicular (cross) to [001]. Furthermore, we found that the three peaks observed in previous temperature programmed desorption (TPD) experiment [Surf. Sci., 2011, 605, 934-940] could be attributed to C2H4 in the S-fit or S-cross, S-fit and S-cross-fit (S-cross and S-fit configurations that both exist in the same unit cell) configurations on Cu(210).

  14. 42 CFR 408.210 - Termination of SMI premium surcharge agreement.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Termination of SMI premium surcharge agreement. 408... Insurance Premium Surcharge Agreements § 408.210 Termination of SMI premium surcharge agreement. (a... before it can request to enter into another SMI premium surcharge agreement....

  15. 17 CFR 210.3-05 - Financial statements of businesses acquired or to be acquired.

    Science.gov (United States)

    2010-04-01

    ... General Instructions As to Financial Statements § 210.3-05 Financial statements of businesses acquired or... financial statements of related businesses may be presented on a combined basis for any periods they are... registered to be offered to the security holders of the business to be acquired, the financial...

  16. 17 CFR 210.3-15 - Special provisions as to real estate investment trusts.

    Science.gov (United States)

    2010-04-01

    ... Financial Statements § 210.3-15 Special provisions as to real estate investment trusts. (a)(1) The income... real estate investment trust under applicable provisions of the Internal Revenue Code as amended shall... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Special provisions as to real...

  17. 17 CFR 210.12-24 - Real estate owned and rental income. 1

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Real estate owned and rental... § 210.12-24 Real estate owned and rental income. 1 Part 1—Real estate owned at end of period Column A... In a separate schedule classify by states in which the real estate owned is located the total amounts...

  18. 17 CFR 210.12-29 - Mortgage loans on real estate. 1

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Mortgage loans on real estate... § 210.12-29 Mortgage loans on real estate. 1 Column A—Description 2,3,4 Column B—Interest rate Column C... mortgage loans on real estate investments has been written down or reserved against, describe the item and...

  19. 17 CFR 210.6A-05 - What schedules are to be filed.

    Science.gov (United States)

    2010-04-01

    ... ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT... audited. Schedule I—Investments. A schedule substantially in form prescribed by § 210.12-12 shall be filed.... Schedule II—Allocation of plan assets and liabilities to investment program. If the plan provides...

  20. 17 CFR 210.7-05 - What schedules are to be filed.

    Science.gov (United States)

    2010-04-01

    ... ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT... shall be examined by the independent accountant. Schedule I—Summary of investments—other than investments in related parties. The schedule prescribed by § 210.12-15 shall be filed in support of caption...

  1. 17 CFR 210.9-06 - Condensed financial information of registrant.

    Science.gov (United States)

    2010-04-01

    ..., SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Bank Holding Companies § 210... recently completed fiscal year. The investment in and indebtedness of and to bank subsidiaries shall...

  2. 17 CFR 210.8-01 - Preliminary Notes to Article 8.

    Science.gov (United States)

    2010-04-01

    ... prepared in accordance with generally accepted accounting principles in the United States. Note 2 to § 210... gas producing activities shall follow the financial accounting and reporting standards specified in... AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES...

  3. 42 CFR 412.210 - Puerto Rico rates for Federal fiscal years 1989 through 2003.

    Science.gov (United States)

    2010-10-01

    ... (45 FR 956), and available from CMS, East High Rise Building, Room 132, 6325 Security Boulevard... § 412.210 Puerto Rico rates for Federal fiscal years 1989 through 2003. (a) General rule. (1) CMS... the discharge occurs. (c) Updating previous standardized amounts. CMS computes separate...

  4. 40 CFR 5.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Military and merchant marine... FINANCIAL ASSISTANCE Coverage § 5.210 Military and merchant marine educational institutions. These Title IX... for a military service of the United States or for the merchant marine....

  5. 6 CFR 17.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Military and merchant marine educational... Coverage § 17.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a...

  6. 10 CFR 5.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Military and merchant marine educational institutions. 5... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 5.210 Military and... institution whose primary purpose is the training of individuals for a military service of the United...

  7. 24 CFR 3.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Military and merchant marine... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 3.210 Military and merchant marine educational... the training of individuals for a military service of the United States or for the merchant marine....

  8. Distribution of Pb-210 in Spanish Soils: Study of the Atmospheric Contribution

    Science.gov (United States)

    Barrera, M.; Cartas, H. A.; Romero, M. L.; Herranz, M.; Valiño, F.; Idoeta, R.; Legarda, F.

    2008-08-01

    The vertical distribution of activity and inventories of atmospheric Pb-210 is being studied in Spanish soils, aiming to establish the reference levels in the zone, based on the type of soil and the annual rainfall. A homogeneous distribution grid (approx. 150×150 km each cell) has been established covering the peninsular land, trying to combine the varying soil types (remaining undisturbed for the last 50 years) and the closeness to meteorological stations. Sampling has been performed by extracting undisturbed soil cylinders of 6 cm diameter and 120 cm length, with an impact penetrometer, and the soil cores have been sectioned in slices of 3 cm thick. The analysis of Pb-210 has been performed using a gamma spectrometry system with coaxial HPGe detector sensitive at low energies (46.5 keV emission). The geometry of measured samples is thin enough (approx. 2 cm) to minimize self-absorption corrections. The work presents the results obtained so far. The Pb-210 activity profiles exhibit the characteristic decreasing shape with depth, showing maximum levels at the surface, and reaching the equilibrium activity with Ra-226 at a maximum depth depending on different environmental conditions. The unsupported Pb-210 inventory values are in the usual range (1000-5000 Bq/m2), showing a positive correlation with the averaged annual rainfall. These reference levels could be used in posterior studies of anthropogenic alteration of soils, evaluation of erosion and desertification processes.

  9. 21 CFR 111.210 - What must the master manufacturing record include?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What must the master manufacturing record include... SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING...: Requirements for the Master Manufacturing Record § 111.210 What must the master manufacturing record...

  10. 33 CFR 157.210 - Approved Dedicated Clean Ballast Tanks Operations Manual.

    Science.gov (United States)

    2010-07-01

    ... RELATING TO TANK VESSELS CARRYING OIL IN BULK Dedicated Clean Ballast Tanks on Tank Vessels General § 157.210 Approved Dedicated Clean Ballast Tanks Operations Manual. If the manuals submitted under § 157.206... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Approved Dedicated Clean...

  11. Availability of Po-210 present in phosphogypsum used in agriculture: precision and accuracy of the methodology

    Energy Technology Data Exchange (ETDEWEB)

    Groppo, Guilherme H.; Mazzilli, Barbara P.; Saueia, Catia H.R., E-mail: g.groppo@ipen.br, E-mail: mazzilli@ipen.br, E-mail: chsaueia@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Phosphogypsum (PG) is a NORM residue of the phosphate fertilizer industry, and is stored in stacks at a rate of 5.5 x 10{sup 6} tons annually. In Brazil, PG has been used for many years as a soil conditioner. The Brazilian regulatory agency has established a limit of 1000 Bq kg{sup -1} for Ra-226 and Ra-228 and below this limit its use in agriculture is exempted of regulatory control. This study aims to determine the availability of the radionuclide Po-210 in the use of PG in agriculture as a soil conditioner. The Po-210 was purified and concentrated using a Sr-Spec resin. The final activity concentration was determined by spontaneous deposition of Po-210 in a silver disk and measurement by alpha spectrometry. The accuracy and precision of the methodology was checked by using a standard reference material provided by International Atomic Energy Agency, IAEA 385 - Irish Sea Sediment, and a Po-210 standard solution provided by Instituto de Radioprotecao e Dosimetria (IRD), Rio de Janeiro, RJ. The precision and accuracy achieved varied from 2.2% to 7.6% and from 1.5% to 17.5%, respectively. (author)

  12. 17 CFR 210.3-20 - Currency for financial statements of foreign private issuers.

    Science.gov (United States)

    2010-04-01

    ... General Instructions As to Financial Statements § 210.3-20 Currency for financial statements of foreign... the financial statements of a foreign private issuer are stated in a currency of a country that has... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Currency for...

  13. 7 CFR 330.210a - Administrative instructions listing approved packing materials for plant pests.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Administrative instructions listing approved packing... Pests § 330.210a Administrative instructions listing approved packing materials for plant pests. (a) The following materials are approved as packing materials for use with any shipment of plant pests in...

  14. 13 CFR 108.210 - Minimum capital requirements for NMVC Companies.

    Science.gov (United States)

    2010-01-01

    ... NEW MARKETS VENTURE CAPITAL (âNMVCâ) PROGRAM Qualifications for the NMVC Program Capitalizing A Nmvc Company § 108.210 Minimum capital requirements for NMVC Companies. You must have Regulatory Capital of at... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Minimum capital requirements...

  15. 29 CFR 780.210 - The typical hatchery operations constitute “agriculture.”

    Science.gov (United States)

    2010-07-01

    ... EXEMPTIONS APPLICABLE TO AGRICULTURE, PROCESSING OF AGRICULTURAL COMMODITIES, AND RELATED SUBJECTS UNDER THE FAIR LABOR STANDARDS ACT Agriculture as It Relates to Specific Situations Hatchery Operations § 780.210 The typical hatchery operations constitute “agriculture.” As stated in § 780.127, the typical hatchery...

  16. Super(210) Pb based trace element fluxes in the nearshore and estuarine sediments off Bombay, India

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, P.; Borole, D; Zingde, M.D

    16 dpm/cm super(2), for the core from the southern area, to 187 dpm/cm super(2), for the northernmost core, which was much higher compared to the atmospheric fallout inventory of 40-50 dpm/cm super(2). The inner creek acted as a sink for super(210) Pb...

  17. Nuclear pore complex assembly and maintenance in POM121- and gp210-deficient cells

    DEFF Research Database (Denmark)

    Stavru, Fabrizia; Nautrup-Pedersen, Gitte; Cordes, Volker C

    2006-01-01

    So far, POM121 and gp210 are the only known anchoring sites of vertebrate nuclear pore complexes (NPCs) within the lipid bilayer of the nuclear envelope (NE) and, thus, are excellent candidates for initiating the NPC assembly process. Indeed, we demonstrate that POM121 can recruit several...

  18. Sedimentation rates in Atibaia River basin, Sao Paulo State, Brazil, using {sup 210}Pb as geochronometer

    Energy Technology Data Exchange (ETDEWEB)

    Sabaris, T.P.P. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), Av. 24-A, No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil); Bonotto, D.M., E-mail: danielbonotto@yahoo.com.b [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), Av. 24-A, No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)

    2011-01-15

    The constant initial concentration (CIC) of unsupported/excess {sup 210}Pb model was successfully used to assess {sup 210}Pb data of nine sediment cores from Atibaia River basin, Sao Paulo State, Brazil. The {sup 210}Pb-based apparent sediment mass accumulation rates ranged from 47.7 to 782.4 mg/cm{sup 2} yr, whereas the average linear sedimentation rates between 0.16 and 1.32 cm/yr, which are compatible with the calculated sediment mass fluxes, i.e. a higher sediment mass accumulation rate yielded a higher linear sedimentation rate. The higher long-term based accumulation rate tended to be found in topographically softer regions. This occurs because the sediments are preferentially transported in topographically steeper regions instead of being deposited. Anthropic activities like deforestation possibly interfered with the natural/normal sedimentation processes, which increased in accordance with modifications on the channel drainage. The radionuclide geochronology as described in this paper allows determination of sedimentation rates that are compatible with values estimated elsewhere. The adoption of an appropriate factor generated from previous laboratory experiments resulted in a successful correction for the {sup 222}Rn-loss from the sediments, bringing the estimate of the parent-supported (in-situ produced) {sup 210}Pb to reliable values required by the CIC model.

  19. Modeling 210Pb-derived mixing activity in ocean margin sediments: Diffusive versus nonlocal mixing

    NARCIS (Netherlands)

    Soetaert, K.E.R.; Herman, P.M.J.; Middelburg, J.J.; Heip, C.H.R.; De Stigter, H.; Van Weering, T.C.E.; Epping, E.; Helder, W.

    1996-01-01

    The influence of sediment mixing on activity versus depth profiles of the radionuclide (210)pb in the upper 20 cm of the sediments has been investigated along a depth transect (208 m- 4500 m, 17 stations) in the OMEX study area (Goban Spur, NE Atlantic Ocean). A hierarchical family of bioturbation/n

  20. 8 CFR 210.1 - Definition of terms used in this part.

    Science.gov (United States)

    2010-01-01

    ... section 210(h) of the Act as that term is defined in regulations by the Secretary of Agriculture at 7 CFR... aggregate of qualifying agricultural employment in the United States. (i) Legalization Office. Legalization... applications for legalization or special agricultural worker status, under the authority of the...

  1. 22 CFR 146.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-04-01

    ... § 146.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a military... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Military and merchant marine...

  2. 14 CFR 1253.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-01-01

    ... Coverage § 1253.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Military and merchant marine...

  3. 28 CFR 54.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-07-01

    ... Coverage § 54.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a military... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Military and merchant marine...

  4. 49 CFR 25.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-10-01

    ... Coverage § 25.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a military... 49 Transportation 1 2010-10-01 2010-10-01 false Military and merchant marine...

  5. 22 CFR 229.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-04-01

    ... Coverage § 229.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a military... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Military and merchant marine...

  6. 10 CFR 1042.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Military and merchant marine educational institutions....210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a...

  7. 43 CFR 41.210 - Military and merchant marine educational institutions.

    Science.gov (United States)

    2010-10-01

    ... Coverage § 41.210 Military and merchant marine educational institutions. These Title IX regulations do not apply to an educational institution whose primary purpose is the training of individuals for a military... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Military and merchant marine...

  8. 20 CFR 404.210 - Average-indexed-monthly-earnings method.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Average-indexed-monthly-earnings method. 404... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Average-Indexed-Monthly-Earnings Method of Computing Primary Insurance Amounts § 404.210 Average-indexed-monthly-earnings method. (a) Who is...

  9. {sup 137}Cs and {sup 210}Pb inventories in soils and sediments from Chapala Lake (Mexico)

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz-Fernandez, A.C.; Perez-Bernal, L.H. [Unidad Academica Mazatlan, Instituto de Ciencias del Mar y Limnologia, Universidad Nacional Autonoma de Mexico (Mexico); Sanchez-Cabeza, J.A. [Unidad Academica de Procesos Oceanicos y Costeros, Instituto de Ciencias del Mar y Limnologia, Universidad Nacional Autonoma de Mexico (Mexico); Ontiveros-Cuadras, J.F. [Posgrado en Ciencias del Mar y Limnologia, Instituto de Ciencias del Mar y Limnologia, Universidad Nacional Autonoma de Mexico (Mexico)

    2014-07-01

    Chapala Lake is the largest natural freshwater reservoir in Mexico and it is located in Central Mexico, at 1524 m above sea level. The lake is considered to be fairly anthropized and it has experienced periods of extremely low water level as a result of recent climate change and water extraction. The study of recent manifestations of global change in Chapala Lake requires accurate {sup 210}Pb chronological reconstructions, taking into account the expected variability of sediment accumulation rates by using the Constant Flux model. For a reliable application of this dating model, it is important that {sup 210}Pb flux values in the lacustrine sedimentary record are in correspondence with the local atmospheric fluxes. With the aim to estimate the fluxes of the fallout radionuclides {sup 210}Pb and {sup 137}Cs in the region, sediment and soil cores were collected in the Chapala Lake. Sediment profiles were evaluated and estimated fluxes in sediments and soils were compared. Some geochemical properties (e.g. grain size distribution, organic matter concentration, XRF-derived elemental composition and magnetic susceptibility) were also evaluated to understand how diagenesis changes and sediment provenance can affect the {sup 210}Pb and {sup 137}Cs depth profiles and inventories. Document available in abstract form only. (authors)

  10. 40 CFR 600.210-08 - Calculation of fuel economy values for labeling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Calculation of fuel economy values for... (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.210...

  11. 21 CFR 210.2 - Applicability of current good manufacturing practice regulations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Applicability of current good manufacturing... AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PROCESSING, PACKING, OR HOLDING OF DRUGS; GENERAL § 210.2 Applicability of current good...

  12. 21 CFR 210.1 - Status of current good manufacturing practice regulations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Status of current good manufacturing practice... SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PROCESSING, PACKING, OR HOLDING OF DRUGS; GENERAL § 210.1 Status of current good manufacturing practice...

  13. 29 CFR 779.210 - Other activities which may be part of the enterprise.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Other activities which may be part of the enterprise. 779...; Enterprise Coverage Related Activities § 779.210 Other activities which may be part of the enterprise. (a) An enterprise may perform certain activities that appear entirely foreign to its principal business but which...

  14. Approaching complete low-spin spectroscopy of 210Bi with a cold-neutron capture reaction

    Science.gov (United States)

    Cieplicka-Oryńczak, N.; Fornal, B.; Leoni, S.; Bazzacco, D.; Blanc, A.; Bocchi, G.; Bottoni, S.; de France, G.; Jentschel, M.; Köster, U.; Mutti, P.; Simpson, G.; Soldner, T.; Szpak, B.; Ur, C.; Urban, W.

    2016-05-01

    The low-spin structure of the 210Bi nucleus was investigated in the neutron capture experiment 209Bi(n ,γ )210Bi performed at ILL Grenoble at the PF1B cold-neutron facility. By using the EXILL multidetector array, consisting of 46 high-purity germanium crystals, and γ γ -coincidence technique, 64 primary γ rays were observed (40 new) and a total number of 70 discrete states (33 new) were located below the neutron binding energy in 210Bi. The analysis of the angular correlations of γ rays provided information about transitions multipolarities, which made it possible to confirm most of the previously known spin-parity assignments and helped establish new ones. The obtained experimental results were compared to shell-model calculations involving one-valence-proton, one-valence-neutron excitations outside the 208Pb core. It has been found that while up to the energy of ˜2 MeV each state observed in 210Bi has its calculated counterpart; at higher excitation energies some levels cannot be described by the valence particle couplings. These states may arise from couplings of valence particles to the 3- octupole phonon of the doubly magic 208Pb core and may serve as a testing ground for models which describe single particle-phonon excitations.

  15. 17 CFR 210.6-10 - What schedules are to be filed.

    Science.gov (United States)

    2010-04-01

    ... AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Registered Investment Companies § 210...

  16. Ingestion of polonium ((210)Po) via dietary sources in high background radiation areas of south India.

    Science.gov (United States)

    Arunachalam, Kantha Deivi; Baskaran, Kamesh Viswanathan; Rao, D D; Sathyapriya, R; Annamalai, Sathesh Kumar; Kuruva, Jaya Krishna; Hari, Shanmugamsundaram

    2014-10-01

    To study the distribution of Polonium ((210)Po) activity in dietary sources in the high background radiation zone of Puttetti in southern Tamil Nadu. (210)Po was analyzed in the food materials consumed by the male and female individual representatives living in the high background areas by 24-h Duplicate Diet Study (DDS) and Market Basket Study (MBS). The MBS was performed by collecting the food samples such as, cereals, fruits, leafy vegetables, roots and tubers, other vegetables, fish, meat and milk grown in the high background radiation zone of southern Tamil Nadu as a part of baseline study in this region. The DDS was done by collecting the food materials consumed including the beverages in 24 h from different age groups of male and female individuals living in the village of Puttetti. The intake and ingestion dose of the radionuclide (210)Po was estimated. The average concentration of (210)Po in DDS (n = 33) was found to be 74 mBq.kg(- 1) of fresh weight. The MBS was collected based on food consumption representing more than 85-95% of annual supply, and were divided into eight food groups. The average concentration of (210)Po in the eight food groups namely leafy vegetables was 2176 mBq.kg(- 1) (n = 3), vegetables 55 mBq.kg(- 1) (n = 10), roots and tubers 251 mBq.kg(- 1) (n = 4), fruits 65 mBq.kg(- 1) (n = 5), fish 345 mBq.kg(- 1) (n = 2), meat food 117 mBq.kg(- 1) (n = 3), milk 20 mBq.kg(- 1) (n = 1) and cereal 290 (n = 1) mBq.kg(- 1) of fresh weight, respectively. The annual intake and ingestion dose due to (210)Po was estimated by DDS and MBS in adults, adolescents and children. The overall results showed that the MBS was moderately higher than the DDS in all age groups. Moreover, a DDS approach may even be more realistic, as cooked foodstuffs are used for dietary exposure assessment. The study confirms that the current levels of (210)Po do not pose a significant radiological risk to the local inhabitants.

  17. 42 CFR 421.210 - Designations of regional carriers to process claims for durable medical equipment, prosthetics...

    Science.gov (United States)

    2010-10-01

    ... for durable medical equipment, prosthetics, orthotics and supplies. 421.210 Section 421.210 Public... claims for durable medical equipment, prosthetics, orthotics and supplies. (a) Basis. This section is..., prosthetics, orthotics, and other supplies (DMEPOS). This authority has been delegated to CMS. (b) Types...

  18. 20 CFR 667.210 - What administrative cost limits apply to Workforce Investment Act title I grants?

    Science.gov (United States)

    2010-04-01

    ... Workforce Investment Act title I grants? 667.210 Section 667.210 Employees' Benefits EMPLOYMENT AND TRAINING... reserved for local administrative costs needs to be allocated back to the individual funding streams. (b) Limits on administrative costs for programs operated under subtitle D of title I will be identified...

  19. Health Risk Evaluations for Ingestion Exposure of Humans to Polonium-210

    Science.gov (United States)

    Scott, Bobby R.

    2007-01-01

    The incident in London during November 2006 involving a lethal intake by Mr. Alexander Litvinenko of the highly-radioactive, alpha-particles-emitting polonium-210 (Po-210) isotope, presumably via ingestion, sparked renewed interest in the area of Po-210 toxicity to humans. This paper is the result of assembling and interpreting existing Po-210 data within the context of what is considered a reliable risk model (hazard-function [HF] model) for characterizing the risk of death from deterministic effects of high alpha radiation doses and dose rates to body organs. The HF model was developed to address radiation exposure scenarios involving combined exposures to alpha, beta, and gamma radiations and can be used in circumstances where only one type of radiation is involved. Under a plausible but not yet validated set of assumptions and using available megabecquerel (Po-210) to gray dose-conversion factors, acute lethality risk vs. dose curves were developed for circumstances of ingestion exposure to Po-210 by humans. Initial risk calculations were carried out for a reference adult male human (a hypothetical 70-kg person). Results were then modified for application to all ages (except the in utero child) via the use of systemic Po-210 burden. Because of the unavailability of acute lethality data derived from human ingestions of high levels of Po-210, plausibility of risk calculations were evaluated based on data from studies of Po-210 injections in animals. The animal data, although limited, were found to be consistent with the theoretical risk calculations. Key findings are as follows: (1) ingestion (or inhalation) of a few tents of a milligram of Po-210 will likely be fatal to all exposed persons. (2) Lethal intakes are expected to involve fatal damage to the bone marrow which is likely to be compounded by damage caused by higher doses to other organs including the kidneys and liver. (3) Lethal intakes are expected to cause severe damage to the kidney, spleen, stomach

  20. (210)Pb as a tracer of soil erosion, sediment source area identification and particle transport in the terrestrial environment.

    Science.gov (United States)

    Matisoff, Gerald

    2014-12-01

    Although (137)Cs has been used extensively to study soil erosion and particle transport in the terrestrial environment, there has been much less work using excess or unsupported (210)Pb ((210)Pbxs) to study the same processes. Furthermore, since (137)Cs activities in soils are decreasing because of radioactive decay, some locations have an added complication due to the addition of Chernobyl-derived (137)Cs, and the activities of (137)Cs in the southern hemisphere are low, there is a need to develop techniques that use (210)Pbxs to provide estimates of rates of soil erosion and particle transport. This paper reviews the current status of (210)Pbxs methods to quantify soil erosion rates, to identify and partition suspended sediment source areas, and to determine the transport rates of particles in the terrestrial landscape. Soil erosion rates determined using (210)Pbxs are based on the unsupported (210)Pb ((210)Pbxs) inventory in the soil, the depth distribution of (210)Pbxs, and a mass balance calibration ('conversion model') that relates the soil inventory to the erosion rate using a 'reference site' at which neither soil erosion nor soil deposition has occurred. In this paper several different models are presented to illustrate the effects of different model assumptions such as the timing, depth and rates of the surface soil mixing on the calculated erosion rates. The suitability of model assumptions, including estimates of the depositional flux of (210)Pbxs to the soil surface and the post-depositional mobility of (210)Pb are also discussed. (210)Pb can be used as one tracer to permit sediment source area identification. This sediment 'fingerprinting' has been extended far beyond using (210)Pb as a single radioisotope to include numerous radioactive and stable tracers and has been applied to identifying the source areas of suspended sediment based on underlying rock type, land use (roads, stream banks, channel beds, cultivated or uncultivated lands, pasture lands

  1. 210Pb mass accumulation rates in the depositional area of the Magra River (Mediterranean Sea, Italy)

    Science.gov (United States)

    Delbono, I.; Barsanti, M.; Schirone, A.; Conte, F.; Delfanti, R.

    2016-08-01

    Nine sediment cores were collected between 2009 and 2012 in the inner continental shelf (Mediterranean Sea, Italy) mainly influenced by the Magra River, at water depths ranging from 11 to 64 m. Mass Accumulation Rates (MARs) were calculated through 210Pb analysed by Gamma spectrometry. Three different dating models (single and two-layer CF-CS, CRS) were applied to clay normalised 210Pbxs profiles and 137Cs was used to validate the 210Pb geochronology. The maximum MAR values (>2 g cm-2 yr-1) were found in the region adjacent to the Magra River mouth and outside the Gulf of La Spezia (0.9±0.1 g cm-2 yr-1 at St. 3-C6 and 4-C4). Results from 137Cs/210Pbxs ratios calculated in Surface Mixed Layers (SMLs) evidenced the coastal boundaries of the Magra River depositional area, which is very limited towards south. Differently, in the north-west sector, fine sediments are generally driven by the Ligurian Current and move towards north-west: at the deepest and most distant station from the River mouth, the MAR value is the lowest one in the study area. Few major Magra River floods occurred during the sediment core sampling period. By using the short-lived radioisotope 7Be as a tracer of river floods, a clear 7Be signature of 2009 flood is present at St. 1-SA1C. Finally, by analyzing the clay normalised 210Pbxs profiles, a decrease of its activity dating the years 1999 and 2000 is observed in four cores, corresponding to two major Magra River floods occurring in those years.

  2. Epidemiology of internal contamination with polonium-210 in the London incident, 2006.

    Science.gov (United States)

    Fraser, G; Giraudon, I; Cohuet, S; Bishop, L; Maguire, H; Thomas, H L; Mandal, S; Anders, K; Sanchez-Padilla, E; Charlett, A; Evans, B; Gross, R

    2012-02-01

    More than 700 UK residents were tested for possible contamination with polonium-210 ((210)Po) following the alleged poisoning of Mr Alexander Litvinenko in London in November 2006. This paper describes the epidemiology of internal contamination with the radionuclide in this group. 11 locations in London had been identified as sufficiently environmentally contaminated with (210)Po to present a health risk to people associated with them. Public health consultant teams identified individuals at risk and offered 24-h urine testing for (210)Po excretion. Prevalence of internal contamination was estimated, and a retrospective cohort analysis was completed for each location. Overall 139 individuals (prevalence 0.19 (95% CI 0.13 to 0.27)) showed evidence of internal contamination with (210)Po, although none with uptakes likely to cause adverse health effects. Substantial prevalence was seen among specific hotel service staff, customers, staff and other users of a hotel bar, office and hospital staff, staff of one restaurant and residents of and visitors to the family home. Increased risks of contamination were seen for a hotel bar in association with occupational, behavioural and temporal factors. Occupational and guest exposure to contaminated areas of hotels were also associated with increased contamination risk. Nurses were more likely to become contaminated than other staff involved in direct patient care. Uptake of trace amounts of radionuclide in this incident was frequent. Occupational, behavioural and temporal gradients in contamination risk were mostly consistent with a priori site risk assessments. Utility of the investigation methods and findings for future accidental or deliberate environmental contamination incidents are discussed.

  3. Aerosol deposition and origin in French mountains estimated with soil inventories of 210Pb and artificial radionuclides

    Science.gov (United States)

    Le Roux, Gaël; Pourcelot, Laurent; Masson, Olivier; Duffa, Céline; Vray, Françoise; Renaud, Philippe

    Radionuclide inventories were measured in soils from different French mountainous areas: Chaîne des Puys (Massif Central), Eastern Corsica, Jura, Montagne Noire, Savoie, Vosges and Rhine Valley. 210Pb soil inventories were used to estimate long-term (>75 yr) deposition of submicron aerosols. Whereas 210Pb total deposition is explained partly by wet deposition, as demonstrated by increase of 210Pb inventory with annual rainfall; a part of 210Pb in the soils of higher altitude is caused by orographic depositions. Using measurements of radionuclides coming from nuclear aerial weapon tests ( 137Cs and Pu isotopes), we were able to estimate the origin of aerosols deposited in high-altitude sites and to confirm the importance of occult deposition and feeder-seeder mechanism. Using a simple mass balance model, we estimate that occult deposition and feeder-seeder mechanisms account to more than 50% of total deposition of 210Pb and associated submicron aerosols in French altitude sites.

  4. 210Pb-derived ages for the reconstruction of terrestrial contaminant history into the Mexican Pacific coast: potential and limitations.

    Science.gov (United States)

    Ruiz-Fernández, A C; Hillaire-Marcel, C

    2009-01-01

    (210)Pb is widely used for dating recent sediments in the aquatic environment; however, our experiences working in shallow coastal environments in the Pacific coast of Mexico have demonstrated that the potential of (210)Pb for reliable historical reconstructions might be limited by the low (210)Pb atmospheric fallout, sediment mixing, abundance of coarse sediments and the lack of (137)Cs signal for (210)Pb corroboration. This work discusses the difficulties in obtaining adequate sedimentary records for geochronological reconstruction in such active and complex settings, including examples of (210)Pb geochronologies based on sediment profiles collected in two contrasting areas coastal areas (mudflats associated to coastal lagoons of Sinaloa State and the continental shelf of the Gulf of Tehuantepec), in which geochemical data was used to support the temporal frame established and the changes in sediment supply recorded in the sediment cores which were related to the development of land-based activities during the last century.

  5. Measurement of 210Pb and its Application to Evaluate Contamination in an Area Affected by NORM Releases

    Science.gov (United States)

    Mosqueda, F.; Villa, M.; Hurtado, S.; Absi, A.; Manjón, G.; Vaca, F.; García-Tenorio, R.

    2008-08-01

    Liquid scintillation counting (LSC) is an easy and straightforward technique, and combined with its low limit of detection, makes it a powerful tool for both routine and low level measurements that can be applied to 210Pb low level counting in environmental samples. 210Pb can be easily measured following a sulphate co-precipitation method; the addition of a carrier and the weighing of the recovered amount is a widespread technique to evaluate radiochemical yield, however, this evaluation of the recovery is sometimes questioned. The samples employed in this work were recollected in 1999 and 2005 from the estuary of the Odiel and Tinto rivers (SW of Spain), which were affected by phosphogypsum (pg.) discharges until 1998. Phosphogypsum contains most of the 210Pb from the treated raw material, for that reason analysed riverbed sediments have enhanced 210Pb activity concentrations and hence, enhanced activity concentration of its daughter 210Po, both in secular equilibrium after two years.

  6. Variations of 210Po activity in mussel (Perna viridis) of Samut Sakhon and its contribution to dose assessment

    Science.gov (United States)

    Porntepkasemsan, B.; Srisuksawad, K.; Kulsawat, W.

    2015-05-01

    The activities of 210Po and its effective dose in green mussel (Perna viridis) collected from a mussel farming area in Samut Sakhon province during the period of 20122013 are presented. Several parameters including maximum shell length and the physiological performance of mussels using condition index and physical properties of seawater (pH, salinity, conductivity, TDS, DO and cation-anion elements) were measured. Each individual mussel was measured for its maximum shell length which was adopted as size class. The activity concentration of 210Po was determined spectroscopically through its 5.30 MeV alpha particle emission, using 209Po as an internal tracer. The 210Po activity concentration in mussels was found to vary between 1.044 and 6.951 Bq/kg wet weight. The 210Po concentration was higher in smaller-sized (≤35 mm) and lower in larger ones (40-70 mm). This confirmed that larger mussels have lower 210Po activities on a weight basis. The 210Po body burden (activity per mussel) ranged from 1.035 to 17.183 mBq. Contrary to the 210Po concentrations, results of the body burden revealed the lower activities in smaller-sized mussels (≤35 mm) and the higher in larger-sized ones (40-70 mm). The type of fluctuations observed with 210Po concentrations were interpreted as a seasonal effect. Total annual effective 210Po dose due to mussel consumption was calculated to be in the range of 3.081 to 16.401 pSv. Based on the international guideline, the average dose calculated due to 210Po in mussels of Samut Sakhon would not pose any significant radiological impact on human health and the mussels are considered to be safe for consumption.

  7. Radioactivity of cigarettes and the importance of (210)Po and thorium isotopes for radiation dose assessment due to smoking.

    Science.gov (United States)

    Kubalek, Davor; Serša, Gregor; Štrok, Marko; Benedik, Ljudmila; Jeran, Zvonka

    2016-05-01

    Tobacco and tobacco smoke are very complex mixtures. In addition to various chemical and organic compounds they also contain natural radioactive elements (radionuclides). In this work, the natural radionuclide activity concentrations ((234)U, (238)U, (228)Th, (230)Th, (232)Th, (226)Ra, (210)Pb and (210)Po) of nine different cigarette samples available on the Slovenian market are reported. In addition to (210)Po, the transfer of thorium isotopes from a cigarette to a smoker's body and lungs have been determined for the first time. Cigarette smoke and exhaled air from smokers' lungs were collected from volunteer smokers (C-4 brand) to determinate what quantity of (210)Po and thorium isotopes is transferred from the tobacco to the smoker's lungs. Cigarette ash and smoked filters were also collected and analysed. Among the determined isotopes, (210)Pb and (210)Po showed the highest activity concentrations. During the smoking of one cigarette approximately 22% of (210)Po (and presumably its predecessor (210)Pb), 0.6% of (228)Th, 24% of (230)Th, and 31% of (232)Th are transferred from the cigarette and retained in the smoker's body. The estimated annual effective dose for smokers is 61 μSv/year from (210)Po; 9 μSv/year from (210)Pb; 6 μSv/year from (228)Th; 47 μSv/year from (230)Th, and 37 μSv/year from (232)Th. These results show the importance of thorium isotopes in contributing to the annual effective dose for smoking. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Contribution to the study of the geophysical behaviour of lead-210 by application of alpha spectrometry; Contribution a l'etude du comportement geophysique du plomb 210 par application de la spectrometrie alpha

    Energy Technology Data Exchange (ETDEWEB)

    Nezami, M. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    A study of the changes in the lead-210 contents of rain-water and of water produced by melting polar ice has required the development of a method for dosing lead-210, an {alpha} emitter. This method is 40 times more sensitive than that which measures the lead-210 by bismuth-210, a ({beta} emitter. The first part of the report presents the study of a spectrometry using semiconductor detectors; a catalogue of a spectra shows the advantages of this method. In the second part will be found at first a new chemical separation method for polonium-210 and the results obtained with this method. The main results obtained on the geophysical behaviour of lead-210 are the following: - the monthly lead-210 and polonium-210 contents in rain water are approximately constant with time. - in the Gif-sur-Yvette region, the clean-up by 'dry fall-out' can attain 40 to 50 per cent of the total fall-out. - a study of Antarctic ice samples makes it possible to determine an annual accumulation rate equivalent to 13.8 cm of water and to show discrepancies in the periodic concentrations which correspond to the latest maxima of solar activity. - a balance is drawn up between the radon produced by the continents and the lead-210 fall-out. (author) [French] Une etude sur les variations de la teneur en plomb 210 des eaux de pluie et des eaux de fusion des glaces polaires a necessite la mise au point d'une methode de dosage du plomb 210 emetteur {alpha}. Cette methode permet d'obtenir une sensibilite quarante fois superieure a celle dosant le plomb 210 par le bismuth 210 emetteur {beta}. La premiere partie du travail presente l'etude de la spectrometrie {alpha} par detecteur a semiconducteurs, un catalogue de spectres {alpha} met en evidence les avantages de cette methode. Dans la deuxieme partie on trouvera en premier lieu une nouvelle methode chimique de separation du polonium 210 ainsi que les resultats obtenus grace a cette methode. Les principaux resultats sur le

  9. Temporal evolution of natural radionuclides distributions {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po in the Bransfield strait, Antarctica peninsula; Evolucao temporal das distribuicoes dos radionuclideos naturais {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po no estreito de Bransfiel, peninsula Antartica

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia Valverde

    2013-07-01

    Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. {sup 234}Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity {sup 238}U (t½ = 4.5 10{sup 9} years). Since {sup 234}Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium {sup 234}Th/{sup 238}U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO{sub 2} atmospheric concentrations. The radionuclides {sup 210}Pb (t½ = 22.3 years) and {sup 210}Po (t½ = 138 days) are also particle-reactive. The disequilibrium {sup 210}Po/{sup 210}Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, {sup 226}Ra (t½ = 1,600 years) and {sup 228}Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides {sup 238}U, {sup 234}Th, {sup 22}'6Ra, {sup 22}'8Ra, {sup 210}Pb and {sup 210}Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)

  10. {sup 210}Pb and {sup 210}Po in sediments and suspended matter in the Tagus estuary, Portugal: Local enhancement of natural levels by wastes from phosphate ore processing industry

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Fernando P. [International Atomic Energy Agency, Marine Environment Laboratory, Monaco (Monaco)

    1994-12-09

    Results of analyses of uranium series radionuclides in phosphate ore and in wastes released by the phosphate fertilizer industry confirm their potential for the enhancement of environmental radioactivity levels. Therefore, concentrations of {sup 210}Pb and {sup 210}Po were measured in bottom sediments and suspended matter in the Tagus estuary, Portugal, to assess the enhancement of radioactivity due to wastes from the phosphate industry. The concentration of {sup 210}Pb in surface sediments in the estuary increased inversely with sediment grain-size; conversely, increased percentage of sand has a dilution effect on the concentration of {sup 210}Pb measured in bulk sediment samples. By normalizing the data to the <63-{mu}m fraction, the naturally-occurring {sup 210}Pb in sediments was found to be 68 {+-} 19 Bq kg{sup -1} (dry wt.) in background sediments. Higher {sup 210}Pb levels, up to 1580 Bq kg{sup -1} (dry wt.), were measured in some bulk sediment samples. It was verified that this radionuclide has been introduced by the discharge of wastes from a phosphate fertilizer plant but enhanced concentrations are localized near the point of discharge. In other zones of the estuary, the concentrations of {sup 210}Pb in sediments and suspended matter were generally below those measured in the zone of phosphatic releases at the Barreiro Peninsula. Concentrations higher than the predicted average concentration of unsupported {sup 210}Pb from natural sources (atmospheric deposition, river input) were also measured in the upper estuary, both in bottom sediments and in suspended matter. It is suggested that these relatively elevated concentrations are due to the highly efficient scavenging of soluble naturally-occurring unsupported {sup 210}Pb onto suspended matter and to co-precipitation with iron-manganese hydroxides in the fresh water-salt water mixing zone.

  11. The use of Pb-210 to normalize fluxes and burdens of atmospheric contaminants in lake sediment cores

    Energy Technology Data Exchange (ETDEWEB)

    Brunskill, G.J.; Wilkinson, P.; Hunt, R.; Muir, D.; Billeck, B.; Lockhart, L. (Freshwater Inst., Winnipeg, Manitoba (Canada))

    1990-01-09

    It is possible to estimate the local annual atmospheric flux (Bq/m[sup 2] [sm bullet] yr) of Pb-210 to land and lake surfaces from measurements of the integral of excess Pb-210 in soil and peat profiles. If you compare this average Pb-210 flux to the soil surface, to the Pb-210 flux to deep lake sediments, you will usually find that the lake sediment flux is a factor of 2 to 6 greater. This is because most of the clay-sized and organic material added to the lake (and resuspended in the lake) each year is funneled into the deeper parts of the lake basin. The ratio of the deep lake Pb-210 sediment flux to the average terrestrial soil Pb-210 flux will be called the focusing factor, which can be used to crudely estimate whole lake sedimentation rates (g/m[sup 2] lake surface area [sm bullet] yr). Many industrial and agricultural contaminants are delivered to remote lakes by atmospheric deposition, and those contaminants that are strongly particle reactive will usually be resuspended and funneled into the deeper parts of the lake basin similar to Pb-210. Often a single sediment core history of deposition is used to estimate contaminant burdens and fluxes at the coring site in a lake basin. These deep basin contaminant burdens and fluxes can be divided by the focusing factor to estimate the burden per unit lake surface area and the atmospheric deposition rate to the lake surface area.

  12. Po-210 as an Indicator of Safe Radiation Levels in Cockles (Anadara granosa in Peninsular Malaysia

    Directory of Open Access Journals (Sweden)

    Nurhanisah Zakri

    2016-01-01

    Full Text Available Activities of Po-210 in cockles Anadara granosa around Peninsular Malaysia have been determined by Alpha Spectrometry using a radiochemical separation technique. The results showed that Po-210 activity distribution varies according to sampling sites. The range of activity was 2.61 ± 1.50 to 309 ± 26 Bq/kg. The lowest mean was recorded from Kuala Selangor and the highest mean was from Mersing. The activity pattern shown by this radionuclide was a decrease with an increase in cockles mass. The activity was higher in cockles of smaller sizes than the larger sized cockles, a pattern attributed to their digestion and metabolism system. The activity intake and effective dose was found to be less than international guidelines and seafood intake was considered safe for human consumption. These findings suggest that regular monitoring should be carried out to help reduce morbidity and mortality among humans as a result of occasional seafood consumption.

  13. Density functional study of Agn-1Y (n =2-10) clusters

    Institute of Scientific and Technical Information of China (English)

    Liu Xiao-Yong; Zhu Zheng-He; Sheng Yong

    2011-01-01

    properties of Agn-1Y (n =2-10) clusters in this paper.The structural optimization and the frequency analysis are performed at the B3LYP/LANL2DZ level.Meanwhile,the differences in geometry,stability and electronic properties between Agn and Agn-1Y (n =2-10) clusters are also studied.The results show that for the doping of the yttrium atoms,the structures and the average binding lengths of the Agn clusters are greatly changed. In addition,the thermodynamic stabilities of the Agn clusters are enhanced generally with the doping of the Y atoms.In addition,the chemical stabilities of the Agn- 1 Y clusters are still improved compared with that of the three-dimensional Agn clusters.

  14. [sup 210] Po as a long-term integrating radon indicator in the indoor environment

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    Exposure to radon (Rn-222) decay products in the indoor environment is suspected of being a significant lung cancer agent in many countries. But quantification of the contemporary lung cancer risk (i.e. probability) on an individual basis is not an easy task. Only past exposures are relevant and assessing individual exposures in retrospect is associated with large uncertainties, if possible at all. One way to extend the validity of contemporary measurements to past decades is to measure long-lived decay products of radon, the long-lived radon daughters. After our laboratory had exemplified the correlation between implanted Po-210 and the estimated radon exposures in six different dwellings, the US Department of Energy and the Swedish Radiation Protection Institute granted funds for a one-year study, [sup 210]Po as a Long-Term Integrating Radon Indicator in the Indoor Environment.'' In this report the work performed under these two contracts is reported.

  15. Systematic study of heavy cluster emission from {210-226}^Ra isotopes

    CERN Document Server

    Santhosh, K P; Priyanka, B; Unnikrishnan, M S

    2012-01-01

    The half lives for various clusters lying in the cold reaction valleys of {210-226}^Ra isotopes are computed using our Coulomb and proximity potential model (CPPM). The computed half lives of 4^He and 14^C clusters from {210-226}^Ra isotopes are in good agreement with experimental data. Half lives are also computed using the Universal formula for cluster decay (UNIV) of Poenaru et al., and are found to be in agreement with CPPM values. Our study reveals the role of doubly magic 208^Pb daughter in cluster decay process. Geiger - Nuttall plots for all clusters up to 62^Fe are studied and are found to be linear with different slopes and intercepts. {12,14}^C emission from 220^Ra; 14^C emission from {222,224}^Ra; 14^C and 20^O emission from 226^Ra are found to be most favourable for measurement and this observation will serve as a guide to the future experiments.

  16. Estimation of Kd of lead and (210)Po in 11 soils from India.

    Science.gov (United States)

    Maity, Sukanta; Pandit, G G

    2014-12-01

    The fate of contaminant transport is often estimated using the distribution (partition) coefficient, Kd. It is a measure of sorption of contaminants to soil. As Kd is element, soil type and ground water dependent, chemical characterization of soil and ground water of the particular site is essential. In this study, soil and ground water samples from different locations around India were collected. The soil samples were physically characterized and pH, CaCO3, cation exchange capacity (CEC), organic matter and organic carbon were determined. Equilibration time for lead and (210)Po were estimated with respect to contact time and were found to be 28 and 72 h respectively. The Kd of lead varied from 6700 to 31,000 L/kg with a geometric mean of 15,200 L/kg, and for (210)Po from 1400 to 8700 L/kg with a geometric mean of 3700 L/kg.

  17. Acute hypoxia induces upregulation of microRNA-210 expression in glioblastoma spheroids

    DEFF Research Database (Denmark)

    Rosenberg, Tine Agerbo; Thomassen, Mads; Jensen, Stine Skov;

    2015-01-01

    AIM: Tumor hypoxia and presence of tumor stem cells are related to therapeutic resistance and tumorigenicity in glioblastomas. The aim of the present study was therefore to identify microRNAs deregulated in acute hypoxia and to identify possible associated changes in stem cell markers. MATERIALS...... & METHODS: Glioblastoma spheroid cultures were grown in either 2 or 21% oxygen. Subsequently, miRNA profiling was performed and expression of ten stem cell markers was examined. RESULTS: MiRNA-210 was significantly upregulated in hypoxia in patient-derived spheroids. The stem cell markers displayed...... a complex regulatory pattern. CONCLUSION: MiRNA-210 appears to be upregulated in hypoxia in immature glioblastoma cells. This miRNA may represent a therapeutic target although it is not clear from the results whether this miRNA may be related to specific cancer stem cell functions....

  18. (210)Pb and compositional data of sediments from Rondonian lakes, Madeira River basin, Brazil.

    Science.gov (United States)

    Bonotto, Daniel Marcos; Vergotti, Marcelo

    2015-05-01

    Gold exploration has been intensive in Brazilian Amazon over the last 40 years, where the use of mercury as an amalgam has caused abnormal Hg concentrations in water bodies. Special attention has been directed to Madeira River due to fact it is a major tributary of Amazon River and that since 1986, gold exploration has been officially permitted along a 350km sector of the river. The (21)(0)Pb method has been used to date sediments taken from nine lakes situated in Madeira River basin, Rondônia State, and to verify where anthropogenic Hg might exist due to gold exploitation in Madeira River. Activity profiles of excess (21)(0)Pb determined in the sediment cores provided a means to evaluate the sedimentation rates using a Constant Flux: Constant Sedimentation (CF:CS) and Constant Rate of Supply (CRS) of unsupported/excess (21)(0)Pb models. A significant relationship was found between the CF:CS sedimentation rates and the mean values of the CRS sedimentation rates (Pearson correlation coefficient r=0.59). Chemical data were also determined in the sediments for identifying possible relationships with Hg occurring in the area. Significant values were found in statistical correlation tests realized among the Hg, major oxides and Total Organic Carbon (TOC) content in the sediments. The TOC increased in the sediment cores accompanied by a loss on ignition (LOI) increment, whereas silica decreased following a specific surface area raising associated to the TOC increase. The CRS model always provided ages within the permitted range of the (21)(0)Pb-method in the studied lakes, whereas the CF:CS model predicted two values above 140 years. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Retrospective assessment of indoor radon exposure by measurements of embedded 210Po activity in glass objects

    Science.gov (United States)

    Ramola, R. C.; Gusain, G. S.; Prasad, Ganesh

    In most of the epidemiological studies contemporary radon measurements have been used as surrogates for radon concentrations in past decades even though changes in radon levels and residence may have occurred. Short-lived radon progeny may deposit on available surfaces in dwellings thus giving rise over time to a build up of long-lived progeny. Airborne radon decay products can be deposited and implanted through alpha recoil into the glass surfaces. On glass surface, activities of 210Po may arise as a result of the decay of recoil implanted activity following the alpha decay of surface deposited 218Po or 214Po. Measurement of 210Po implanted on a household glass is a method that can be employed to retrospectively determine the historic level of radon in dwellings. This method is based on the assumption that levels of recoil implanted 210Po in the glass provide a measure of time integrated radon concentration in the environment in which the glass has been located. The surface deposited activity of the radon progenies, which then become implanted in the glass by alpha recoil, is believed to reflect past exposure to airborne activity. Such retrospective measurements on glass are valuable in estimating the human dose derived from radon during the time of exposure. In this paper an account is given of the principles and some field applications of a retrospective technique, using the alpha track detectors, CR-39 and LR-115, to measure 210Po implanted in glass surfaces (surface traps). By using this CR-LR difference technique, the cumulative radon exposure in a dwelling in past decades may be estimated. This method provides reliable radon exposure data as a support to epidemiological studies concerning the health effects of radon exposure in the living environment.

  20. 披上马甲 诺基亚Asha 210

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    当市场已经被售价160元的诺基亚105搅动之时,诺基亚乘胜追击,再度推出了新入门神器——Asha 210。乍眼一看,不少人会误以为Lumia系列开始走平民路线。

  1. Analysis of a groundwater inrush at -210 m north main tunnel in Guojiazhuang coal Mine

    Energy Technology Data Exchange (ETDEWEB)

    Bu, C.; Liang, M.; Qu, X. [Feicheng Mining Corporation, Feicheng (China). Guojiazhuang Coal Mine

    2001-10-01

    A groundwater inrush occurred with water amount reaching 32970 m{sup 3}/h at -210 m in the north main tunnel in Guojiazhuang Coal Mine of Feicheng Mining Area. The geologic structures near the water inrush point are complex, and different aquifers are in contact with each other. The severe inrush is a result of confined water gushing into the tunnel through weaknesses in the fractures. 1 fig., 1 tab.

  2. Properties of epitaxial (210) iron garnet films exhibiting the magnetoelectric effect

    Energy Technology Data Exchange (ETDEWEB)

    Arzamastseva, G. V. [Russian Academy of Sciences, Kotelnikov Institute of Radio Engineering and Electronics, Fryazino Branch (Russian Federation); Balbashov, A. M. [Moscow Power Institute (Russian Federation); Lisovskii, F. V., E-mail: lisf@rambler.ru; Mansvetova, E. G.; Temiryazev, A. G.; Temiryazeva, M. P. [Russian Academy of Sciences, Kotelnikov Institute of Radio Engineering and Electronics, Fryazino Branch (Russian Federation)

    2015-04-15

    The properties of epitaxial magnetic (LuBi){sub 3}(FeGa){sub 5}O{sub 12} iron garnet films grown on (210) substrates, which exhibit the magnetoelectric effect, are experimentally studied. The induced anisotropy and the behavior of the domain structure in the films are investigated in uniform and nonuniform external fields. The existing hypotheses about the nature of the magnetoelectric coupling in such films are critically analyzed.

  3. Properties of epitaxial (210) iron garnet films exhibiting the magnetoelectric effect

    Science.gov (United States)

    Arzamastseva, G. V.; Balbashov, A. M.; Lisovskii, F. V.; Mansvetova, E. G.; Temiryazev, A. G.; Temiryazeva, M. P.

    2015-04-01

    The properties of epitaxial magnetic (LuBi)3(FeGa)5O12 iron garnet films grown on (210) substrates, which exhibit the magnetoelectric effect, are experimentally studied. The induced anisotropy and the behavior of the domain structure in the films are investigated in uniform and nonuniform external fields. The existing hypotheses about the nature of the magnetoelectric coupling in such films are critically analyzed.

  4. Waking a sleeping giant: the tobacco industry's response to the polonium-210 issue.

    Science.gov (United States)

    Muggli, Monique E; Ebbert, Jon O; Robertson, Channing; Hurt, Richard D

    2008-09-01

    The major tobacco manufacturers discovered that polonium was part of tobacco and tobacco smoke more than 40 years ago and attempted, but failed, to remove this radioactive substance from their products. Internal tobacco industry documents reveal that the companies suppressed publication of their own internal research to avoid heightening the public's awareness of radioactivity in cigarettes. Tobacco companies continue to minimize their knowledge about polonium-210 in cigarettes in smoking and health litigation. Cigarette packs should carry a radiation-exposure warning label.

  5. 210 year anniversary of the Botanical Garden of the University of Tartu

    Directory of Open Access Journals (Sweden)

    Politsinski Zanna

    2014-03-01

    Full Text Available June 28, 2013 Botanic Garden of the University of Tartu has celebrated its 210th anniversary. To mark the occasion four significant events were presented: the first electric car trip, opening of the sculpture in honor of the gardeners of Estonia, the opening of "Moss garden" and a concert at the summer stage in the rock, which was held on June 29.

  6. Hypoxia induces miR-210, leading to anti-apoptosis in ovarian follicular cells of marine medaka Oryzias melastigma

    Energy Technology Data Exchange (ETDEWEB)

    Tse, Anna Chung-Kwan [School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR (China); State Key Laboratory in Marine Pollution, Hong Kong SAR (China); Li, Jing-Woei; Chan, Ting-Fung [School of Life Sciences, Hong Kong Bioinformatics Centre, The Chinese University of Hong Kong, Hong Kong SAR (China); Wu, Rudolf Shiu-Sun [School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR (China); State Key Laboratory in Marine Pollution, Hong Kong SAR (China); Lai, Keng-Po, E-mail: balllai@hku.hk [School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR (China); State Key Laboratory in Marine Pollution, Hong Kong SAR (China)

    2015-08-15

    Highlights: • We demonstrate hypoxia induced miR-210 in ovarian follicular cells. • We show anti-apoptotic roles of miR-210 in ovarian follicular cells under hypoxia. • Apoptotic genes (DLC1, SLK, TNFRSF10B, RBM25, and USP7) are target of miR-210. • MiR-210 is vital for ovarian follicular cells proliferation in response to hypoxia. - Abstract: Hypoxia is a major global problem that impairs reproductive functions and reduces the quality and quantity of gametes and the fertilization success of marine fish. Nevertheless, the detailed molecular mechanism underlying hypoxia-induced female reproductive impairment remains largely unknown. There is increasing evidence that miRNA is vital in regulating ovarian functions and is closely associated with female fertility in humans. Certain miRNAs that regulate apoptotic genes can be induced by hypoxia, resulting in cell apoptosis. Using primary ovarian follicular cells of the marine medaka, Oryzias melastigma, as a model, we investigated the response of miR-210 to hypoxic stress in ovarian tissues to see if it would interrupt reproductive functions. A significant induction of miR-210 was found in primary ovarian follicular cells exposed to hypoxia, and gene ontology analysis further highlighted the potential roles of miR-210 in cell proliferation, cell differentiation, and cell apoptosis. A number of miR-210 target apoptotic genes, including Deleted in liver cancer 1 protein (DLC1), STE20-like serine/threonine-protein kinase (SLK), tumor necrosis factor receptor superfamily member 10b (TNFRSF10B), RNA binding motif protein 25 (RBM25), and Ubiquitin-specific-processing protease 7 (USP7), were identified. We further showed that ectopic expression of miR-210 would result in down-regulation of these apoptotic genes. On the other hand, the inhibition of miR-210 promoted apoptotic cell death and the expression of apoptotic marker – caspase 3 in follicular cells under hypoxic treatment, supporting the regulatory role of mi

  7. An actively accreting massive black hole in the dwarf starburst galaxy Henize 2-10.

    Science.gov (United States)

    Reines, Amy E; Sivakoff, Gregory R; Johnson, Kelsey E; Brogan, Crystal L

    2011-02-03

    Supermassive black holes are now thought to lie at the heart of every giant galaxy with a spheroidal component, including our own Milky Way. The birth and growth of the first 'seed' black holes in the earlier Universe, however, is observationally unconstrained and we are only beginning to piece together a scenario for their subsequent evolution. Here we report that the nearby dwarf starburst galaxy Henize 2-10 (refs 5 and 6) contains a compact radio source at the dynamical centre of the galaxy that is spatially coincident with a hard X-ray source. From these observations, we conclude that Henize 2-10 harbours an actively accreting central black hole with a mass of approximately one million solar masses. This nearby dwarf galaxy, simultaneously hosting a massive black hole and an extreme burst of star formation, is analogous in many ways to galaxies in the infant Universe during the early stages of black-hole growth and galaxy mass assembly. Our results confirm that nearby star-forming dwarf galaxies can indeed form massive black holes, and that by implication so can their primordial counterparts. Moreover, the lack of a substantial spheroidal component in Henize 2-10 indicates that supermassive black-hole growth may precede the build-up of galaxy spheroids.

  8. (137)Cs, (40)K and (210)Po in marine mammals from the southern Baltic Sea.

    Science.gov (United States)

    Ciesielski, Tomasz; Góral, Marta; Szefer, Piotr; Jenssen, Bjørn Munro; Bojanowski, Ryszard

    2015-12-15

    This study provides information on baseline concentrations of the radionuclides Cesium-137, Potassium-40 and Polonium-210 in sea mammals from the Baltic Sea. The radionuclides were analyzed in the liver, kidney and muscle of harbor porpoises, striped dolphins, and gray and ringed seals from the Polish coast by γ- and α-spectrometry. Median (137)Cs activities were 14.8, 13.2 and 23.2 Bq kg(-1) w.w. in the liver, kidney and muscles, respectively. Activities of (40)K and (210)Po in the respective tissues were found to be 79.1, 79.8 and 111 Bq kg(-1) for (40)K and 58.1, 59.2 and 32.9 Bq kg(-1) for (210)Po. The measured (137)Cs concentrations were extraordinarily high in comparison to those reported in sea mammals from other locations. However, dose assessments did not imply health effects from (137)Cs exposure in Baltic Sea mammals. Correlations between (137)Cs tissue activities and reported sea water concentrations highlight the potential use of marine mammals for biomonitoring purposes.

  9. Temporal changes of beryllium-7 and lead-210 in ground level air in Serbia

    Directory of Open Access Journals (Sweden)

    Janković Marija M.

    2014-01-01

    Full Text Available 7Be, 210Pb and 137Cs activity concentrations in ground level air at five monitoring stations (MS Vinča, Zeleno Brdo, Zaječar, Vranje and Zlatibor in Serbia were determined during the period from May 2011. to September 2012., as part of the project monitoring of Serbia. Activity of the radionuclides in air was determined on an HPGe detector (Canberra, relative efficiency 20 % by standard gamma spectrometry. Concentrations of cosmogenic 7Be, ranged from 1.5 to 8.8 mBq m-3 and exhibit maxima in the spring/summer period. The maximum concentrations for 210Pb were generally obtained in the fall for all investigated locations, and concentrations were in range 3.6 - 30 × 10-4 Bq m-3. The activity concentrations of anthropogenic 137Cs in ground level air, during the observed period, were at level 0.3 - 8 μBq m-3. The variations in 7Be/210Pb activity ratio for the investigated stations are also presented. [Projekat Ministarstva nauke Republike Srbije, br. III43009

  10. An ALMA Constraint on the GSC 6214-210 B Circum-Substellar Accretion Disk Mass

    CERN Document Server

    Bowler, Brendan P; Kraus, Adam L; Ireland, Michael J; Herczeg, Gregory; Ricci, Luca; Carpenter, John; Brown, Michael E

    2015-01-01

    We present Atacama Large Millimeter/submillimeter Array (ALMA) observations of GSC 6214-210 A and B, a solar-mass member of the 5-10 Myr Upper Scorpius association with a 15 $\\pm$ 2 Mjup companion orbiting at $\\approx$330 AU (2.2"). Previous photometry and spectroscopy spanning 0.3-5 $\\mu$m revealed optical and thermal excess as well as strong H$\\alpha$ and Pa~$\\beta$ emission originating from a circum-substellar accretion disk around GSC 6214-210 B, making it the lowest mass companion with unambiguous evidence of a subdisk. Despite ALMA's unprecedented sensitivity and angular resolution, neither component was detected in our 880 $\\mu$m (341 GHz) continuum observations down to a 3-$\\sigma$ limit of 0.22 mJy/beam. The corresponding constraints on the dust mass and total mass are <0.15 Mearth and <0.05 Mjup, respectively, or <0.003% and <0.3% of the mass of GSC 6214-210 B itself assuming a 100:1 gas-to-dust ratio and characteristic dust temperature of 10-20 K. If the host star possesses a putative c...

  11. Determination of (210)Po and uranium in high salinity water samples.

    Science.gov (United States)

    Grabowski, Paweł; Bem, Henryk

    A method for the determination of uranium and (210)Po in high salinity water samples has been elaborated. Both radionuclides are preconcentrated from 0.5 dm(3) saline media by co-precipitation with hydrated manganese dioxide, followed by dissolution of the precipitate in 200 mL of 1 M HCl. Uranium isotopes (235)U and (238)U can be directly determined by ICP MS method with a detection limit of 0.01 ppb for (238)U. Prior to a selective determination of (210)Po, the majority of other naturally occurring α-emitting radionuclides (uranium, thorium and protactinium) can be stripped from this solution by their extraction with a 50% solution of HDEHP in toluene. Finally, (210)Po is simply separated by direct transfer to an extractive scintillator containing 5% of trioctylphosphine oxide in Ultima Gold F cocktail and determined by an α/β separation liquid scintillation technique with detection limit below 0.1 mBq/dm(3).

  12. Intraperirhinal cortex administration of the synthetic cannabinoid, HU210, disrupts object recognition memory in rats.

    Science.gov (United States)

    Sticht, Martin A; Jacklin, Derek L; Mechoulam, Raphael; Parker, Linda A; Winters, Boyer D

    2015-03-25

    Cannabinoids disrupt learning and memory in human and nonhuman participants. Object recognition memory, which is particularly susceptible to the impairing effects of cannabinoids, relies critically on the perirhinal cortex (PRh); however, to date, the effects of cannabinoids within PRh have not been assessed. In the present study, we evaluated the effects of localized administration of the synthetic cannabinoid, HU210 (0.01, 1.0 μg/hemisphere), into PRh on spontaneous object recognition in Long-Evans rats. Animals received intra-PRh infusions of HU210 before the sample phase, and object recognition memory was assessed at various delays in a subsequent retention test. We found that presample intra-PRh HU210 dose dependently (1.0 μg but not 0.01 μg) interfered with spontaneous object recognition performance, exerting an apparently more pronounced effect when memory demands were increased. These novel findings show that cannabinoid agonists in PRh disrupt object recognition memory.

  13. Rapid measurement of 210Po in seafood with large area grid ionization chamber α spectrometry

    Institute of Scientific and Technical Information of China (English)

    Li Yucheng; Yin Liangliang; Chen Fei; Shao Xianzhang; Shen Baoming; Kong Xiangyin; Ji Yanqin

    2015-01-01

    Objective To develop a rapid and reliable method for determination of 210Po using large-area grid ionization chamber α spectrometry.Methods Samples were digested using a microwave digestion system.After preparation of sample source,the concentration of 210Po in clam was detected by large-area grid ionization chamber (φ 25 cm).209Po tracer was used to obtain the recovery.Results Large-area grid ionization chamber could achieve better counting and α spectrum resolution when the optimized thickness was 250 μg/cm2.By spiking 209Po tracer in clam,the minimum detectable activity was 9.870 × 10 4 Bq and the recovery of 210Po was 98%.Conclusions Compared with the traditional method,the developed method can avoid separation process,using less quantity of sample (0.2-0.5 g dry) and simplify the measurement process.This method may be has broad application prospects.

  14. Cannabinoids & Stress: impact of HU-210 on behavioral tests of anxiety in acutely stressed mice.

    Science.gov (United States)

    Kinden, Renee; Zhang, Xia

    2015-05-01

    Anxiety disorders are one of the most prevalent classes of mental disorders affecting the general population, but current treatment strategies are restricted by their limited efficacy and side effect profiles. Although the cannabinoid system is speculated to be a key player in the modulation of stress responses and emotionality, the vast majority of current research initiatives had not incorporated stress exposure into their experimental designs. This study was the first to investigate the impact of exogenous cannabinoid administration in an acutely stressed mouse model, where CD1 mice were pre-treated with HU-210, a potent CB1R agonist, prior to acute stress exposure and subsequent behavioral testing. Exogenous cannabinoid administration induced distinct behavioral phenotypes in stressed and unstressed mice. While low doses of HU-210 were anxiolytic in unstressed subjects, this effect was abolished when mice were exposed to an acute stressor. The administration of higher HU-210 doses in combination with acute stress exposure led to severe locomotor deficits that were not previously observed at the same dose in unstressed subjects. These findings suggest that exogenous cannabinoids and acute stress act synergistically in an anxiogenic manner. This study underlies the importance of including stress exposure into future anxiety-cannabinoid research due to the differential impact of cannabinoid administration on stressed and unstressed subjects.

  15. Suspected radioactive contamination: evaluation of 45 Israeli citizens potentially exposed to polonium-210 in London.

    Science.gov (United States)

    Brosh-Nissimov, Tal; Havkin, Ofra; Davidovitch, Nadav; Poles, Lion; Shapira, Chen

    2008-02-01

    The lethal poisoning of Alexander Litvinenco with the radioactive element polonium-210, and the risk that many civilians (including Israeli citizens) who were in the same location in London at the same time were exposed to radiation, was an unprecedented event in the western world. This was only the second known death due to 210Po, a natural alpha radiation-emitting element. A task team was created to handle the event. The team comprised representatives from the Ministry of Health's advisory committee for radiological events (which includes the Israel Defense Force, the Israeli Atomic Energy Commission and the Ministry of Environmental Protection), the Public Health Services Central District, and a public relations expert. Forty-seven people were located and underwent an epidemiological inquiry, and urine samples for detection of 210Po were sent abroad to a specialized laboratory. The radiotoxicological results were analyzed and evaluated by the expert team and follow-up recommendations were made. This unfamiliar and potentially stressful scenario was handled successfully by a multi-organizational multidisciplinary task team. The joint work of the task team was a real-life "exercise" simulating a radiological event in Israel. This team has recommended further evaluation of various vital missions in the event of any possible future radiological event, with special emphasis on a proactive communication approach to the media and the public.

  16. Dating human skeletal remains using 90Sr and 210Pb: case studies.

    Science.gov (United States)

    Schrag, Bettina; Uldin, Tanya; Mangin, Patrice; Bochud, François; Froidevaux, Pascal

    2014-01-01

    In legal medicine, the post mortem interval (PMI) of interest covers the last 50 years. When only human skeletal remains are found, determining the PMI currently relies mostly on the experience of the forensic anthropologist, with few techniques available to help. Recently, several radiometric methods have been proposed to reveal PMI. For instance, (14)C and (90)Sr bomb pulse dating covers the last 60 years and give reliable PMI when teeth or bones are available. (232)Th series dating has also been proposed but requires a large amount of bones. In addition, (210)Pb dating is promising but is submitted to diagenesis and individual habits like smoking that must be handled carefully. Here we determine PMI on 29 cases of forensic interest using (90)Sr bomb pulse. In 12 cases, (210)Pb dating was added to narrow the PMI interval. In addition, anthropological investigations were carried out on 15 cases to confront anthropological expertise to the radiometric method. Results show that 10 of the 29 cases can be discarded as having no forensic interest (PMI>50 years) based only on the (90)Sr bomb pulse dating. For 10 other cases, the additional (210)Pb dating restricts the PMI uncertainty to a few years. In 15 cases, anthropological investigations corroborate the radiometric PMI. This study also shows that diagenesis and inter-individual difference in radionuclide uptake represent the main sources of uncertainty in the PMI determination using radiometric methods.

  17. Optimization of {sup 210}Po estimation in environmental samples using an improved deposition unit

    Energy Technology Data Exchange (ETDEWEB)

    Dubey, Jay Singh; Sahoo, Sunil Kumar; Mohapatra, Swagatika; Lenka, Pradyumna; Patra, Aditi Chakravarty; Thakur, Virender Kumar; Ravi, Pazhayath Mana; Tripathi, Raj Mangal [Bhabha Atomic Research Centre, Trombay, Mumbai (India). Health Physics Div.

    2015-06-01

    Measurement of {sup 210}Po in environmental matrices is important due to its very high specific activity, present in every compartment of the environment due to a daughter product of uranium ({sup 238}U), accumulative and highly toxic in nature. Conventional method for {sup 210}Po estimation is by auto-deposition onto both sides of a silver disc followed by alpha spectrometry of both the sides. A new deposition unit having the facility to hold the silver disc and magnetic stirring bar has designed and fabricated for {sup 210}Po estimation in which only one side is counted. In the conventional method, the total activity is distributed to the both sides of the silver disc and more counting time is required whereas in the improved deposition unit, only one side contain all the activity so that one time counting is required with better statistical significance. The same has been observed in spike recovery and water sample assessment. The tracer recovery in the conventional method was 72%-88% and 70%-85% whereas for the new deposition the recovery is 87%-99% and 78%-94% for spike recovery study and environmental samples, respectively. Certified tracers were analysed for the assurance of the reliability of the method and the results were in good agreement with the recommended value with a relative error <20%. The MDA of the method is 1.5 mBq for the estimation of {sup 210}Po at 3σ confidence level, 86400 s. counting time and 100 ml of water sample, taking the detector efficiency and chemical yield into consideration. The results obtained from both the methods were compared statistically. χ{sup 2} test, repeatability parameters, relative bias measurement and linearity test was performed for both the methods. The % difference between the two methods in terms of linearity is 0.2%. From the χ{sup 2} test it can be concluded that the measured data by two methods falls within 99% confidence interval. The modified deposition unit enhance the statistical significance, reduce

  18. Pb-210 and fly ash particles in ombrotrophic peat bogs as indicators of industrial emissions.

    Science.gov (United States)

    Vaasma, Taavi; Karu, Helen; Kiisk, Madis; Pensa, Margus; Isakar, Kadri; Realo, Enn; Alliksaar, Tiiu; Tkaczyk, Alan Henry

    2017-08-01

    Peat cores were collected from a Sphagnum-dominated Selisoo bog, which is located about 40 km from the large oil shale-fired power plants (PPs) in Estonia. These PPs have been operational from the 1960's and had the largest negative impact on the surrounding environment during the 1970's and 1980's. Nearby ombrotrophic peatlands are good indicators of atmospheric pollution due to their properties of effectively adsorbing mineral matter and pollutants. Collected peat cores (S1 and S2) from Selisoo peat bog were sliced into 1 cm thick layers and measured gamma spectrometrically. In addition, spherical fly ash particles (SFAP) originating from the combustion of the PPs were counted. The maximum concentrations (particles per cm(3)) of the SFAP remained between 7 and 12 cm for core S1 and between 11 and 17 cm for core S2. The concentration profiles of the SFAP reflect the combustion and emission history of the PPs. Pb-210 activity concentrations have the maximum values up to 500 Bq kg(-1) and 413 Bq m(-2) for S1 and for the S2 the values are 441 Bq kg(-1) and 535 Bq m(-2) (dry weight). The unsupported (210)Pb inventory is around 4250 Bq m(-2). This represents a (210)Pb deposition flux of 133 Bq m(-2) y(-1). The estimated (210)Pb deposition via fly ash from the PPs at Selisoo area remains between 0.2 and 2.2 Bq m(-2) y(-1). Considering the annual (210)Pb deposition from the atmosphere (with a precipitation rate of 600 mm y(-1)) between 92 and 133 Bq m(-2), which is regarded as the natural background value, we show that the radiological burden due to the power plants at these distances is negligible. As the peat cores exhibit noticeable differences from each other (in terms of radionuclide concentration distribution), the SFAP can provide a good additional parameter to improve the validity of results obtained only from radiometric methods in the chronological studies. SFAP can also act as a possible tool to estimate the radionuclide deposition rate

  19. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  20. Modeling the vertical soil organic matter profile using 210Pbex measurements and Bayesian inversion

    Directory of Open Access Journals (Sweden)

    B. Kruijt

    2011-07-01

    Full Text Available In view of its potential significance for soil organic matter (SOM cycling, the vertical SOM distribution in the profile should be considered in models. To mechanistically predict the SOM profile, three additional processes should be represented compared to bulk SOM models: (vertically distributed rhizodeposition, mixing due to bioturbation, and movement with the liquid phase as dissolved organic matter. However, the convolution of these processes complicates parameter estimation based on the vertical SOM distribution alone. Measurements of the atmospherically produced isotope 210Pbex may provide the additional information needed to constrain the processes. Since 210Pbex enters the soil at the surface and bind strongly to organic matter it is an effective tracer for SOM transport. In order to study the importance of root input, bioturbation, and liquid phase transport for SOM profile formation we performed Bayesian parameter estimation of the previously developed mechanistic SOM profile model SOMPROF. 13 parameters, related to decomposition and transport of organic matter, were estimated for the soils of two temperate forests with strongly contrasting SOM profiles: Loobos (the Netherlands and Hainich (Germany. Measurements of organic carbon stocks and concentrations, decomposition rates, and 210Pbex profiles were used in the optimization. For both sites, 3 optimizations were performed in which stepwise 210Pbex data and prior knowledge were added. The optimizations yielded posterior distributions with several cases (modes which were characterized by the dominant organic matter (OM pool: non-leachable slow OM, leachable slow OM, or root litter. For Loobos, the addition of 210Pbex data to the optimization clearly indicated which case was most likely. For Hainich, there is more uncertainty, but the most likely case produced by the optimization agrees well with other measurements. For both sites the most likely case of the final optimization was one

  1. Atmospheric fluxes and geochemistries of stable Pb, Pb-210, and Po-210 in Crystal Lake, Wisconsin: Wisconsin power plant impact study

    Energy Technology Data Exchange (ETDEWEB)

    Talbot, R.W.; Andren, A.W.

    1984-01-01

    In a lake system where atmospheric input greatly exceeds other source inputs, the atmospheric supply, water column transport, and sediment accumulation should be coupled. This research examined the exchange of lead between these compartments. The approach was to use Pb-210 as a natural tracer to provide experimental evidence concerning the movement of lead between various compartments, thereby linking the geochemical regime of lead in an integrated lake system. The investigation was conducted in Crystal Lake, Wisconsin, an oligotrophic, non-calcareous, seepage lake located in a semi-remote, heavily forested area of north-central Wisconsin. The atmosphere serves as the principal route for transport of material to the lake. Stable Pb concentrations in the water column are of the order of 200 ng/kg.

  2. Prognostic value of circulating microRNA-210 levels in patients with moderate to severe aortic stenosis.

    Directory of Open Access Journals (Sweden)

    Helge Røsjø

    Full Text Available Circulating micro-RNAs have been proposed as a novel class of cardiovascular (CV biomarkers, but whether they meet analytical requirements and provide additional information to establish risk indices have not been established. miR-210 levels are increased in subjects with low VO2 max, which is a recognized risk factor in patients with aortic stenosis (AS, and we hypothesized that circulating miR-210 levels may be increased in patients with AS and associated with a poor prognosis.We measured circulating miR-210 levels by real-time PCR in 57 patients with moderate to severe AS and in 10 age- and gender-matched healthy controls. The merit of miR-210 as a biomarker was assessed according to established criteria, including by comparing miR-210 levels with NT-proBNP and miR-22 levels, which is another miRNA biomarker candidate.All patients and control subjects had miR-210 levels within the range of detection (Cq<35 and the analytical variability was low. Circulating miR-210 levels were 2.0±0.2 [mean±SEM] fold increased in AS patients compared to controls (p = 0.002, whereas miR-22 levels were not differently expressed in the AS patients (0.12±0.06 fold increase, p = 0.45. The increase in miR-210 levels in AS patients was comparable to the increment in NT-proBNP levels: [AUC] 0.82 (95% CI 0.70-0.90 vs. 0.85 (0.75-0.93, respectively, p = 0.71. During a median follow-up of 1287 days, 15 patients (26% died. There was a significant association between higher circulating levels of miR-210 and increased mortality during follow-up: hazard ratio [supra- vs. inframedian levels] 3.3 (95% CI 1.1-10.5, p = 0.039. Adjusting for other risk indices in multivariate analysis did not attenuate the prognostic merit of circulating miR-210 levels.Circulating miR-210 levels are increased in patients with AS and provide independent prognostic information to established risk indices. Analytical characteristics were also excellent supporting the potential of

  3. 210例小儿急诊惊厥病因分析%Pathogeny analysis of 210 pediatric convulsions cases in emergency treatment

    Institute of Scientific and Technical Information of China (English)

    赵永强; 苏艳琦

    2016-01-01

    目的 探讨小儿急诊惊厥的病因,为急诊儿科提供诊断思路.方法 采用回顾性分析法,收集210例惊厥患儿的临床资料,并根据病史、性别、初发年龄、脑脊液、脑电图、体温、影像学检查等进行分析.结果 210例患儿中,不伴发热48例(22.86%),伴发热162例(77.14%);伴咳嗽、流涕137例(65.24%),伴腹泻、呕吐26例(12.38%),意识障碍或昏迷12例(5.71%),反复惊厥发作并智力发育迟缓7例(3.33%),惊厥持续状态4例(1.90%),既往已确诊癫痫3例(1.43%).体格检查神经系统阳性体征51例(24.29%).对27例伴有意识障碍疑似颅内感染的患儿进行脑脊液检查,发现其中有8例出现异常;对55例白细胞明显增加的患儿进行血培养检查,发现其中有9例出现细菌生长;对113例患儿进行脑电图检查,发现有61例患儿出现异常.64例患儿行头颅CT检查,9例异常,分别为颅内出血6例、脑干多发低密度灶1例、脑室增宽1例、颅内占位病变1例.210例患儿中最常见症状为热性惊厥、癫痫和颅内感染.其中,1~28 d新生儿惊厥多为颅内出血所致;28 d~3岁婴幼儿期惊厥病因主要为热性惊厥,其次为癫痫和颅内感染;3~6岁学龄前儿童的惊厥仍以热性惊厥为主;>6岁后,病因则以癫痫为主.结论 因儿童发生惊厥的病因呈多样化、复杂化,在对患儿的惊厥病因进行确诊时,不仅需根据患儿的过往病史、年龄段等进行辅助分析,更需要应用诸如头颅CT、脑电图等辅助检查工具,以达到快速确诊、及早治疗、预防复发和减轻患儿脑损伤、杜绝患儿后遗症发生的效果.%Objective To investigate pathogeny of pediatric convulsions in emergency treatment, and to provide diagnosis basis for pediatric emergency treatment.Methods A retrospective analysis was made on clinical data of 210 children with convulsions, along with their medical history, gender, onset age, cerebrospinal fluid, electroencephalogram, body

  4. 美国格里森公司:GENESIS系列210H立式滚齿机

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    格里森(Gleason)公司GENESIS系列210H立式滚齿机的设计可以获得最佳的干切削加工功能,机床显著地减小了占地面积和空间,并极大地降低了循环时间,可加工外径达210mm的直齿和斜齿圆柱齿轮。

  5. The self-absorption correction factors for (210)Pb concentration in mining waste and influence on environmental radiation risk assessment.

    Science.gov (United States)

    Bonczyk, Michal; Michalik, Boguslaw; Chmielewska, Izabela

    2017-03-01

    The radioactive lead isotope (210)Pb occurs in waste originating from metal smelting and refining industry, gas and oil extraction and sometimes from underground coal mines, which are deposited in natural environment very often. Radiation risk assessment requires accurate knowledge about the concentration of (210)Pb in such materials. Laboratory measurements seem to be the only reliable method applicable in environmental (210)Pb monitoring. One of the methods is gamma-ray spectrometry, which is a very fast and cost-effective method to determine (210)Pb concentration. On the other hand, the self-attenuation of gamma ray from (210)Pb (46.5 keV) in a sample is significant as it does not depend only on sample density but also on sample chemical composition (sample matrix). This phenomenon is responsible for the under-estimation of the (210)Pb activity concentration level often when gamma spectrometry is applied with no regard to relevant corrections. Finally, the corresponding radiation risk can be also improperly evaluated. Sixty samples of coal mining solid tailings (sediments created from underground mining water) were analysed. Slightly modified and adapted to the existing laboratory condition, a transmission method has been applied for the accurate measurement of (210)Pb concentration . The observed concentrations of (210)Pb range between 42.2 ÷ 11,700 Bq·kg(-1) of dry mass. Experimentally obtained correction factors related to a sample density and elemental composition range between 1.11 and 6.97. Neglecting this factor can cause a significant error or underestimations in radiological risk assessment. The obtained results have been used for environmental radiation risk assessment performed by use of the ERICA tool assuming exposure conditions typical for the final destination of such kind of waste.

  6. Low 210Pb in the upper thermocline in the Canadian Basin:scavenge process over the Chukchi Sea

    Institute of Scientific and Technical Information of China (English)

    HU Wangjiang; CHEN Min; YANG Weifeng; ZHANG Run; QIU Yusheng; ZHENG Minfang

    2014-01-01

    210Pb was measured during the 3rd Chinese National Arctic Research Expedition cruise to investigate its spa-tial pattern in the western Arctic Ocean, as well as its relation with the thermocline in the Canadian Basin. The specific activities varied from 0.04 to 2.72,<0.013 to 4.37, and 0.1 to 4.85 Bq/m3 for dissolved, particu-late, and bulk 210Pb, respectively, corresponding to respective averages of 0.65, 0.43, and 1.08 Bq/m3. In the Canadian Basin, the minimum 210Pb activities occurred in the thermocline, which was characterized by low temperature of-1.52°C and salinity of 33.1. Combining the spatial distribution of 210Pb and hydrographical characteristics in the western Arctic Ocean, this scenario was ascribed to the effective scavenging of 210Pb when the Pacific water flowed across the Chukchi Shelf. Quantitatively, this interpretation was supported by both the shorter residence times and higher scavenging efficiencies (SE) of dissolved 210Pb over the Chukchi Shelf. The highest SE values were observed in the Herald Shoal and bottom waters over the slope.

  7. Seasonal export fluxes of size-fractionated particulate derived from polonium-210: A case study in Xiamen Bay

    Science.gov (United States)

    Yang, Weifeng; Huang, Yipu; Chen, Min; Qiu, Yusheng

    2010-03-01

    Size-fractionated 210Po and 210Pb, in the size fractions >0.4 μm, >2 μm and >10 μm, were examined to determine the seasonal variability of particulate fluxes in Xiamen Bay. Good correlations between 210Po and particulate organic carbon (POC) or non-Particulate Organic Matter (nPOM) suggested that 210Po can be used to trace the export fluxes of POC and nPOM. Both steady-state (SS) model and nSS model were used to evaluate fluxes of size-fractionated 210Po, results showed that nSS model was better than the SS model in coastal areas. Based on the nSS model, size-fractionated POC fluxes decreased with increasing particle size. For the particle size studied, maximum POC fluxes occurred in autumn, followed by spring, winter, and summer. Fluxes of nPOM were an order of magnitude higher than the corresponding size-fractionated POC fluxes. Differences between size-fractionated nPOM fluxes indicated that hydrodynamic conditions were the main factor regulating transportation of particulate out of the inner Bay. In winter most particulates, including >10 μm particles, were transported under the strongest hydrodynamic conditions. In contrast, only a fraction of the <2 μm particulates were transported from the inner Bay in spring. This study suggested that 210Po is a powerful tracer of seasonal particulate export in coastal seas.

  8. Dating human skeletal remains using a radiometric method: biogenic versus diagenetic 90Sr and 210Pb in vertebrae.

    Science.gov (United States)

    Schrag, Bettina; Uldin, Tanya; Mangin, Patrice; Froidevaux, Pascal

    2012-07-10

    In forensic science, there is a strong interest in determining the post-mortem interval (PMI) of human skeletal remains up to 50 years after death. Currently, there are no reliable methods to resolve PMI, the determination of which relies almost exclusively on the experience of the investigating expert. Here we measured (90)Sr and (210)Pb ((210)Po) incorporated into bones through a biogenic process as indicators of the time elapsed since death. We hypothesised that the activity of radionuclides incorporated into trabecular bone will more accurately match the activity in the environment and the food chain at the time of death than the activity in cortical bone because of a higher remodelling rate. We found that determining (90)Sr can yield reliable PMI estimates as long as a calibration curve exists for (90)Sr covering the studied area and the last 50 years. We also found that adding the activity of (210)Po, a proxy for naturally occurring (210)Pb incorporated through ingestion, to the (90)Sr dating increases the reliability of the PMI value. Our results also show that trabecular bone is subject to both (90)Sr and (210)Po diagenesis. Accordingly, we used a solubility profile method to determine the biogenic radionuclide only, and we are proposing a new method of bone decontamination to be used prior to (90)Sr and (210)Pb dating.

  9. The particulate 7Be/210Pbxs and 234Th/210Pbxs activity ratios as tracers for tidal-to-seasonal particle dynamics in the Gironde estuary (France): implications for the budget of particle-associated contaminants.

    Science.gov (United States)

    Saari, Hanna-Kaïsa; Schmidt, Sabine; Castaing, Patrice; Blanc, Gérard; Sautour, Benoît; Masson, Olivier; Cochran, J Kirk

    2010-09-15

    The short-lived natural radionuclides (7)Be (T(1/2)=53 days), (234)Th(xs) (T(1/2)=24.1 days) and (210)Pb(xs) (T(1/2)=22.3 years), i.e. (234)Th and (210)Pb in excesses of that supported within particles by the decay of their parent isotopes, were analysed in suspended particulate matter (SPM) to study the particle dynamics in the Gironde fluvial estuarine system (France), strongly impacted by heavy metal pollution. From surveys of this land-ocean interface in 2006 and 2007, we established a times series of these radioisotopes and of their activity ratios ((7)Be/(210)Pb(xs) and (234)Th/(210)Pb(xs) ARs) in particles sampled under different hydrological conditions. The particulate (7)Be/(210)Pb(xs) AR varies along the fluvial estuarine system mainly due to variations in (7)Be activities, controlled by riverine, oceanic and atmospheric inputs and by resuspension of old (7)Be-deficient sediments. These processes vary with river discharge, tidal cycle and season. Therefore, seasonal particle transport processes can be described using variations of the SPM (7)Be/(210)Pb(xs) ARs. During high river discharge, the SPM (7)Be/(210)Pb(x) ARs decrease from river to the ocean. The turbidity maximum zone (TMZ) is dispersed and the particles, and the associated contaminants, are rapidly transported from river to coastal waters, without significant retention within the TMZ. During low river discharge, the TMZ intrudes into the fluvial estuary, and the lowest (7)Be/(210)Pb(x) ARs are observed there due to resuspension of (7)Be-deficient sediments. Away from the TMZ, from the middle to lower estuary, SPM (7)Be/(210)Pb(x) ARs increase, indicating that the particles have been recently tagged with (7)Be. We explain this trend as being caused by marine input of dissolved radionuclides, as traced by SPM (234)Th/(210)Pb(xs) ARs, followed by scavenging in the estuary. This result indicates that particle transport models based on (7)Be and trace-metal budgets must consider oceanic dissolved

  10. The polonium 210 in aerosols: contribution to the study of savannah fires and volcano emissions; Le polonium 210 dans les aerosols: contribution a l`etude des feux de savanes et des emissions volcaniques

    Energy Technology Data Exchange (ETDEWEB)

    Nho-Kim, E.Y

    1996-06-27

    Natural sources plan a fundamental role on the emission of the species causing climatic variations. The aim of this study is, on the one hand, to estimate fluxes of different components emitted by biomass burning and volcanoes, and on the other hand, to trace these components in time and space. We used {sup 210}Po, last decay product in the {sup 238}U series, as a tracer, as it is one of the characteristic species emitted by these sources: it is highly enriched in these plumes compared to the usual atmosphere and the {sup 210}Po radioactivity is not affected by chemical transformation. We have shown that the contribution of biomass burning on the {sup 210}Po concentration in local background atmosphere is minor during the dry season, compared to that of Saharan soil dusts despite of the importance of this source in the global budget of {sup 210}Po (10%). However, the good correlation observed between the {sup 210}Po concentration and that of carbonaceous aerosols and of CO{sub 2} in biomass burning plumes reveals that {sup 210}Po can be used as a reference of the components emitted by biomass burning. We have estimated the contribution of the Indonesian volcanoes which represent about 5 to 30 % of the global volcanic budget of trace metals. Atmospheric transport of these volcanic plumes was simulated using the {sup 210}Po as a tracer. Due to the characteristic atmospheric circulation in this region, vertical transport is predominant over meridian dispersion, which is moderated by the convergence of the trade winds. The impact of these volcanic emissions on the atmospheric concentration of the trace metals remains a local effect when the volcanic activity is out of cataclysmal eruptions. (author)

  11. Assessment of {sup 210}Pb concentration in Nicotiana tabacum L., burley variety, cultivated in Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Rique J.F.X.; Silva, Carolina F.; Frujuele, Jonatan V.; Bovolini, Raquel R.; Damatto, Sandra R., E-mail: rjrocha@ipen.br, E-mail: cfsilva@ipen.br, E-mail: jonatanfrujuele@hotmail.com, E-mail: ra_bovolini@yahoo.com.br, E-mail: damatto@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Lab. de Radiometria Ambiental

    2013-07-01

    Tobacco products are extensively used throughout the world and the most consumed are cigarettes, cigars and narghile. The damaging effects that these products cause to human health are discussed worldwide and many researches are performed with the aim of relating the use of these products with various diseases. Brazil is the largest exporter and second largest producer of tobacco worldwide, according to the crop year 2009/2010 production. The tobacco plant (Nicotiana tabacum L.) is used to manufacture all derivatives and the chemical composition of the resulting tobacco varies with the type of tobacco leaves, how they are grown, the region where they are cultivated, the characteristics of preparation and the temperature variations resulting from the tobacco incomplete combustion. There is lack of information about the chemical and radiological characterization of the tobacco plant both in international and Brazilian literature. Thus a project was established with the objectives of characterizing chemically and radiologically the three varieties most cultivated in Brazil of Nicotiana tobacum L., Virginia, Burley and Common; this paper presents the preliminary results of {sup 210}Pb concentrations for the Burley variety. Plants from this variety were cultivated in pots with organic substrate and fertilizer and in a small farm in natural conditions. The entire plant was analyzed, the organic substrates, the fertilizers and the soil. The results obtained presented higher values for {sup 210}Pb in leaves when compared with the other parts of the plant. Comparing the three study areas the highest results of {sup 210}Pb concentration were obtained in the plants cultivated in the urban area probably due to its atmospheric deposition. (author)

  12. In vivo measurements of lead-210 for assessing cumulative radon exposure in uranium miners

    Energy Technology Data Exchange (ETDEWEB)

    Guilmette, R.A.; Laurer, G.R. [New York Univ. Inst. of Environmental Medicine, Tuxedo, NY (United States); Lambert, W.E.; Gilliland, F.D. [Univ. of New Mexico, Albuquerque, NM (United States)] [and others

    1995-12-01

    It has long been recognized that a major contributor to the uncertainty in risk analysis of lung cancer in uranium and other hard rock miners is the estimation of total radon progeny exposure of individual miners under study. These uncertainties arise from the fact that only a limited number of measurements of airborne {sup 222}Rn progeny concentrations were made in the mines during the times that the miners were being exposed, and that dosimeters capable of integrating the Rn progeny exposures of the miners did not exist. Historically, the cumulative exposures for individual uranium and other hard rock miners have been calculated by combining the employee`s work history, which may or may not have included time spent at different jobs within the mines and at different locations within the mines, with whatever periodic measurements of Rn and Rn progeny were available. The amount and quality of the measurement data varied enormously from mine to mine and from population to population. Because the quality of the exposure data collected during the period of active mining in the United STates cannot now be altered substantially, significant improvement in individual miner exposure estimates is only likely to be achieved if a new cumulative exposure metric is developed and implemented. The decay chain of Rn includes the production of {sup 210}Pb, which can accumulate in the skeleton in amounts proportional to the intake of Rn progeny. We hypothesize that the in vivo measurement of {sup 210}Pb in the skulls of miners will provide such a metric. In summary, the primary purpose of this pilot study to demonstrate the feasibility of measuring {sup 210}Pb in the heads of former uranium miners has been accomplished.

  13. Safety of Quadrivalent Meningococcal Conjugate Vaccine in Children 2-10 Years.

    Science.gov (United States)

    Tartof, Sara Y; Sy, Lina S; Ackerson, Bradley K; Hechter, Rulin C; Haag, Mendel; Slezak, Jeffrey M; Luo, Yi; Fischetti, Christine A; Takhar, Harp S; Miao, Yan; Solano, Zendi; Jacobsen, Steven J; Tseng, Hung-Fu

    2017-07-14

    Quadrivalent meningococcal conjugate vaccine is recommended for children, adolescents, and adults at increased risk of meningococcal disease. In 2011, MenACWY-CRM (Menveo, GSK) was approved for children aged 2-10 years in the U.S. Although no safety concerns arose from clinical trials, it remains important to monitor its safety in routine clinical settings. Kaiser Permanente Southern California members 2-10 years old who received MenACWY-CRM between September 2011 and September 2014 were included. Electronic health records were searched using a validated algorithm to identify 26 pre-specified events of interest (EOIs) and serious medically attended events (SMAEs) from inpatient or emergency settings up to one year following MenACWY-CRM vaccination. SMAEs were categorized by ICD-9 diagnostic categories. All events were reviewed to confirm the diagnosis and symptom onset date. The study was descriptive (NCT01452438); no statistical tests were performed. Among 387 vaccinated children, 327 with ≥6 months membership before vaccination were analyzed. Among EOIs, 9 asthma cases and one myasthenia gravis case underwent chart review which confirmed one incident asthma case occurring 237 days after concomitant vaccination with MenACWY-CRM and typhoid vaccine. Thirty-one children experienced SMAEs, most commonly due to unrelated injury and poisoning. The remaining events occurred sporadically after vaccination and most were unlikely related to vaccination based on medical record review. One incident EOI of asthma late in the 1-year observation period and sporadic distribution of SMAEs were observed. These data do not suggest safety concerns associated with MenACWY-CRM vaccination in children 2-10 years old.

  14. Sedimentation rate and {sup 210}Pb sediment dating at Apipucos reservoir, Recife, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Figueiredo, Marcela D.C. de; Silva, Danubia B. da; Cunha, Manuela S. da; Rodrigues, Kelia R.G.; Pedroza, Eryka H.; Melo, Roberto T. de; Oliveira, Aristides; Hazin, Clovis A.; Souza, Vivianne L.B. de, E-mail: rtmelo@cnen.gov.b, E-mail: chazin@cnen.gov.b, E-mail: vlsouza@cnen.gov.b [Centro Regional de Ciencias Nucleares (CRCN-NE/CNEN-PE), Recife, PE (Brazil)

    2011-07-01

    The Apipucos Reservoir is located in Recife, State of Pernambuco, and, several districts of the metropolitan area use this reservoir to dispose waste and sewage. Dating sediments uses {sup 210}Pb from the atmosphere which is formed as a result of {sup 222}Rn emanation from the soil. Atmospheric lead, carried by rain, is called non-supported {sup 21}'0Pb, to differentiate it from the one contained in the sediment, in balance with the {sup 226}Ra. The model chosen for dating sediments depends on certain conditions: in an environment where the amount of sediment influx can vary, the constant rate of supply model is adopted. On the other hand, in environments where the sedimentation rate is constant and the sediment can be considered to have a constant initial concentration of unsupported {sup 210}Pb and the (CIC) model is applied. A 70-cm long, 5-cm internal-diameter wide core was collected for sediment dating. Each core was sliced, into 5 or 10 cm intervals. Samples were dried at 105 deg C, and about 5 g dry material from each sample was dissolved with acids. The {sup 210}Pb and {sup 226}Ra contents were separated and determined by beta and alpha counting by using a gas-flow proportional counter. Sediment ages were calculated by the two models, and for the second and fourth sampling points, both models could be used. The results showed an increase in sedimentation rate over the last 50 - 60 years. We can conclude that the top sediment layer is dated from 30 years ago. We can also conclude that the CRS is the best applicable model to use in this area. (author)

  15. Extended Structure and Fate of the Nucleus in Henize 2-10

    Science.gov (United States)

    Nguyen, Dieu D.; Seth, Anil C.; Reines, Amy E.; den Brok, Mark; Sand, David; McLeod, Brian

    2014-10-01

    We investigate the structure and nuclear region of the black hole (BH) hosting galaxy Henize 2-10. Surface brightness profiles are analyzed using Magellan/Megacam g- and r-band images. Excluding the central starburst, we find a best-fit two-component Sérsic profile with n in ~ 0.6, r eff, in ~ 260 pc and n out ~ 1.8, r ~ 1 kpc. Integrating out to our outermost data point (100'' ~ 4.3 kpc), we calculate Mg = -19.2 and Mr = -19.8. The corresponding enclosed stellar mass is M sstarf ~ (10 ± 3) × 109 M ⊙, ~3 × larger than previous estimates. Apart from the central lsim500 pc, with blue colors and an irregular morphology, the galaxy appears to be an early-type system. The outer color is quite red, (g - r)0 = 0.75, suggesting a dominant old population. We study the nuclear region of the galaxy using archival Gemini/NIFS K-band adaptive optics spectroscopy and Hubble Space Telescope imaging. We place an upper limit on the BH mass of ~107 M ⊙ from the NIFS data, consistent with that from the M BH-radio-X-ray fundamental plane. No coronal lines are seen, but a Brγ source is located at the position of the BH with a luminosity consistent with the X-ray emission. The starburst at the center of Henize 2-10 has led to the formation of several super star clusters, which are within ~100 pc of the BH. We examine the fate of the nucleus by estimating the dynamical masses and dynamical friction timescales of the clusters. The most massive clusters (~106 M ⊙) have τdyn <~ 200 Myr, and thus Henize 2-10 may represent a rare snapshot of nuclear star cluster formation around a preexisting massive BH.

  16. Analysis of polonium-210 in food products and bioassay samples by isotope-dilution alpha spectrometry.

    Science.gov (United States)

    Lin, Zhichao; Wu, Zhongyu

    2009-05-01

    A rapid and reliable radiochemical method coupled with a simple and compact plating apparatus was developed, validated, and applied for the analysis of (210)Po in variety of food products and bioassay samples. The method performance characteristics, including accuracy, precision, robustness, and specificity, were evaluated along with a detailed measurement uncertainty analysis. With high Po recovery, improved energy resolution, and effective removal of interfering elements by chromatographic extraction, the overall method accuracy was determined to be better than 5% with measurement precision of 10%, at 95% confidence level.

  17. Waking a Sleeping Giant: The Tobacco Industry’s Response to the Polonium-210 Issue

    Science.gov (United States)

    Muggli, Monique E.; Ebbert, Jon O.; Robertson, Channing; Hurt, Richard D.

    2008-01-01

    The major tobacco manufacturers discovered that polonium was part of tobacco and tobacco smoke more than 40 years ago and attempted, but failed, to remove this radioactive substance from their products. Internal tobacco industry documents reveal that the companies suppressed publication of their own internal research to avoid heightening the public’s awareness of radioactivity in cigarettes. Tobacco companies continue to minimize their knowledge about polonium-210 in cigarettes in smoking and health litigation. Cigarette packs should carry a radiation-exposure warning label. PMID:18633078

  18. Age models for peat deposits on the basis of coupled lead-210 and radiocarbon data.

    Science.gov (United States)

    Piotrowska, Natalia; de Vleeschouwer, François; Sikorski, Jarosław; Sensuła, Barbara; Michczyński, Adam; Fiałkiewicz-Kozieł, Barbara; Palowski, Bernard

    2010-05-01

    The study presents three examples of age-model construction based on the results of 210Pb and 14C dating methods applied to peat deposits. The three sites are ombrotrophic peat bogs: the Misten (Belgium), Slowinskie Bloto (N Poland) and Puscizna Mala (S Poland). All sites have been subjected to multiproxy studies aimed at reconstructing paleoenvironment and human activity, covering the last 1500, 1300 and 1800 years, respectively (De Vleeschouwer et al. 2009A, 2009B, in prep., Fialkiewicz-Koziel, ongoing PhD). A detailed comparison between 210Pb and post-bomb 14C results in the Misten bog has also been carried out by Piotrowska et al. (2009). In all cores, the 210Pb activity was calculated using 210Po and 208Po activities after acid-extraction from bulk samples, subsequent deposition on silver discs and measurements by alpha spectrometry. Unsupported 210Pb was detected until 35cm in Slowinskie Bloto, 15cm in the Misten and 19cm in Puscizna Mala. Constant Rate of Supply (CRS) model was then applied to compute ages of each 1-cm core interval. For the Misten and Slowinskie Bloto, radiocarbon measurements were performed on selected aboveground plant macrofossils, mainly Sphagnum spp. or Calluna vulgaris, Erica tetralix, and Andromeda polyfolia. Radiocarbon ages were determined using accelerator mass spectrometry (AMS) after acid-alkali-acid wash, combustion, purification of carbon dioxide and graphitisation. For Puscizna Mala bulk samples were dated after chemical preparation of benzene for liquid scintillation counting (LSC) or CO2 for gas proportional counting (GPC). Radiocarbon calibration was undertaken using the Intcal04 calibration curve and OxCal 4 software. As a priori information the 210Pb-derived ages were used in a P_Sequence model (Bronk Ramsey, 2008). A number of dates characterized by low agreement with stratigraphical order had to be considered as outliers and rejected from the final age model. For building a continuous age models a non-linear approach

  19. The use of {sup 210}Pb and {sup 137}Cs in environmental studies

    Energy Technology Data Exchange (ETDEWEB)

    Heijnis, H. [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). Environmental Radiochemistry Group, Environment Division

    1999-11-01

    The use of natural radioactivity in environmental studies has proven a very powerful tool to determine the dynamics of both natural and antrophogenic processes in our environment. The use of {sup 14}C in archaeology and past climate studies has led to many scientific discoveries (the shroud of Turin and Utze {sup t}he ice-man from Austria are two examples). The use of the {sup 238}U-decay series is of at least equal value to studies in archaeology and of past climates. Some of the Isotopes studied supplement {sup 14}C (which is limited to 40,000 years) data and allow dating of samples formed up to 500,000 years ago (see McCullough, this book of abstracts, pages 19-23), others can be utilised to date very young sediments, which can`t be dated by {sup 14}C.The so-called {sup 210}Pb dating method has been used over the past 3 decades to date recent sediment. The method uses the disequilibrium in the {sup 238}U decay chain, caused by the escape of the intermediate daughter {sup 222}Rn, a noble gas, from the earth`s crust. In the atmosphere the {sup 222}Rn decays via short-lived daughter isotopes to {sup 210}Pb. This {sup 210}Pb with a very convenient half-life of 22,3 years decays to stable {sup 206}Pb. By measuring the surface activity of a sediment core and subsequent samples at regular intervals, a chronology for the sediment core can be established (relative to the surface). In addition to {sup 210}Pb dating one could analyse the samples for {sup l37}Cs to establish an independent chronology based on a pulse of radioactive Caesium. The pulse of {sup 137}Cs originates from the atmospheric atomic-bomb test of the early sixties. The maximum of Caesium activity found in a core should correspond to the height of the tests (approximately 1963 in the Northern hemisphere). A combination of the two dating methods often leads to more reliable results in the chronology. Another use of {sup 137}Cs is to test if the sediment has been subject to bio-turbation or other mixing. In

  20. Mixing characteristics of 210 tRH refining process%210 tRH精炼过程的混匀特性

    Institute of Scientific and Technical Information of China (English)

    刘洋; 崔衡; 李东侠

    2016-01-01

    To understand the characteristic of mixing in 210t RH vacuum refining process, a 1﹕4 water model was established to investigate the effects of gas flow rate, snorkel immersion depth ( SID) , vacuum chamber pressure and number of blockage blowing air holeon the RH mixing time. The results show that the RH mixing time presents a decreasing trend with the increase of gas blowing andthe decrease of the vacuum chamber pressure. Furthermore, the mixing time first decreases then increases with the increaseof the snorkel immersion depth (SID)and the number of blockage blowing air hole, and the optimum SID is 480mm. Using particle imageve-locimetryto measure the two-dimensional flow field of RH ladle in refining process, andthen compared to the results of numerical simu-lation, the resultsshowthat the fluid movement in the ladle is mainly the circulation flow from down-leg to up-leg andthe back-flow a-round the down-leg. In addition,the inactive region is mainly located in the range of SID under the steel-slag interface.%以某钢厂210tRH真空精炼装置为原型,根据相似原理建立1﹕4水模型,研究了吹气量、浸入深度、真空度以及气孔堵塞对混匀时间的影响。结果表明,RH混匀时间随着吹气量的增加而呈现减小的趋势;随着浸入深度的增加先减小后增大,并存在最佳浸入深度480 mm;随真空室压力的减小而减小;随着吹气孔堵塞个数的增加先减小后增加。利用粒子成像测速技术( particle image velocimetry,PIV)测量了RH精炼过程钢包内二维流场,与数值模拟结果对比,发现钢包内的流体运动主要是从下降管到上升管的循环流动以及下降管周围的回流运动,不活跃区主要集中在渣-钢界面以下浸渍管浸入深度范围内。

  1. Downregulation of miR-210 expression inhibits proliferation, induces apoptosis and enhances radiosensitivity in hypoxic human hepatoma cells in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Wei, E-mail: detachedy@yahoo.com.cn [Department of Radiobiology, School of Radiological Medicine and Protection, Soochow University, Suzhou (China); Sun, Ting [Brain and Nerve Research Laboratory, The First Affiliated Hospital, Soochow University, Suzhou (China); Cao, Jianping; Liu, Fenju [Department of Radiobiology, School of Radiological Medicine and Protection, Soochow University, Suzhou (China); Tian, Ye [Department of Radiotherapy and Oncology, The Second Affiliated Hospital, Soochow University, Suzhou (China); Zhu, Wei [Department of Radiobiology, School of Radiological Medicine and Protection, Soochow University, Suzhou (China)

    2012-05-01

    Hypoxia is a common feature of solid tumors and an important contributor to tumor radioresistance. miR-210 is the most consistently and robustly induced microRNA under hypoxia in different types of tumor cells and normal cells. In the present study, to explore the feasibility of miR-210 as an effective therapeutic target, lentiviral-mediated anti-sense miR-210 gene transfer technique was employed to downregulate miR-210 expression in hypoxic human hepatoma SMMC-7721, HepG2 and HuH7 cells, and phenotypic changes of which were analyzed. Hypoxia led to an increased hypoxia inducible factor-1{alpha} (HIF-1{alpha}) and miR-210 expression and cell arrest in the G{sub 0}/G{sub 1} phase in all cell lines. miR-210 downregulation significantly suppressed cell viability, induced cell arrest in the G{sub 0}/G{sub 1} phase, increased apoptotic rate and enhanced radiosensitivity in hypoxic human hepatoma cells. Moreover, apoptosis-inducing factor, mitochondrion-associated, 3 (AIFM3) was identified as a direct target gene of miR-210. AIFM3 downregulation by siRNA attenuated radiation induced apoptosis in miR-210 downregulated hypoxic human hepatoma cells. Taken together, these data suggest that miR-210 might be a potential therapeutic target and specific inhibition of miR-210 expression in combination with radiotherapy might be expected to exert strong anti-tumor effect on hypoxic human hepatoma cells. -- Highlights: Black-Right-Pointing-Pointer miR-210 downregulation radiosensitized hypoxic hepatoma. Black-Right-Pointing-Pointer AIFM3 was identified as a direct target gene of miR-210. Black-Right-Pointing-Pointer miR-210 might be a therapeutic target to hypoxic hepatoma.

  2. Developing a comprehensive time series of GDP per capita for 210 countries from 1950 to 2015

    Science.gov (United States)

    2012-01-01

    Background Income has been extensively studied and utilized as a determinant of health. There are several sources of income expressed as gross domestic product (GDP) per capita, but there are no time series that are complete for the years between 1950 and 2015 for the 210 countries for which data exist. It is in the interest of population health research to establish a global time series that is complete from 1950 to 2015. Methods We collected GDP per capita estimates expressed in either constant US dollar terms or international dollar terms (corrected for purchasing power parity) from seven sources. We applied several stages of models, including ordinary least-squares regressions and mixed effects models, to complete each of the seven source series from 1950 to 2015. The three US dollar and four international dollar series were each averaged to produce two new GDP per capita series. Results and discussion Nine complete series from 1950 to 2015 for 210 countries are available for use. These series can serve various analytical purposes and can illustrate myriad economic trends and features. The derivation of the two new series allows for researchers to avoid any series-specific biases that may exist. The modeling approach used is flexible and will allow for yearly updating as new estimates are produced by the source series. Conclusion GDP per capita is a necessary tool in population health research, and our development and implementation of a new method has allowed for the most comprehensive known time series to date. PMID:22846561

  3. Systematic study of heavy cluster emission from {sup 210-226}Ra isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P., E-mail: drkpsanthosh@gmail.com [School of Pure and Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327 (India); Sahadevan, Sabina; Priyanka, B.; Unnikrishnan, M.S. [School of Pure and Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327 (India)

    2012-05-15

    The half lives for various clusters lying in the cold reaction valleys of {sup 210-226}Ra isotopes are computed using our Coulomb and proximity potential model (CPPM). The computed half lives of {sup 4}He and {sup 14}C clusters from {sup 210-226}Ra isotopes are in good agreement with experimental data. Half lives are also computed using the universal formula for cluster decay (UNIV) of Poenaru et al., and are found to be in agreement with CPPM values. Our study reveals the role of doubly magic {sup 208}Pb daughter in cluster decay process. Geiger-Nuttall plots for all clusters up to {sup 62}Fe are studied and are found to be linear with different slopes and intercepts. {sup 12,14}C emission from {sup 220}Ra; {sup 14}C emission from {sup 222,224}Ra; {sup 14}C and {sup 20}O emission from {sup 226}Ra are found to be most favourable for measurement and this observation will serve as a guide to the future experiments.

  4. Surface air concentration and deposition of lead-210 in French Guiana: two years of continuous monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Melieres, Marie-Antoinette E-mail: melieres@glaciog.ujf-grenoble.fr; Pourchet, Michel; Richard, Sandrine

    2003-07-01

    To make up for the lack of data on {sup 210}Pb aerosol deposition in tropical regions and to use this radionuclide as an aerosol tracer,a monitoring station was run for two years at Petit-Saut, French Guiana. Lead-210 concentration in air at ground level was monitored continuously together with atmospheric total deposition. The air concentration has a mean value of 0.23{+-}0.02 mBq m{sup -3} during both wet and dry seasons, and it is only weakly affected by the precipitation mechanism. This result was unexpected in a wet tropical region, with a high precipitation rate. In contrast, deposition clearly correlates with precipitation for low/moderate rainfall (<15 cm per 15-day), while this correlation is masked by strong fluctuations at high rainfall. The estimated mean annual deposition over the last ten years is 163{+-}75 Bq m{sup -2} y{sup -1}. This provides a procedure fo estimating this mean flux at other sites in French Guiana.

  5. Sediment flux and source in northern Yellow Sea by 210Pb technique

    Institute of Scientific and Technical Information of China (English)

    LI Fengye; LI Xuegang; SONG Jinming; WANG Guizhi; CHENG Peng; GAO Shu

    2006-01-01

    Sedimentation of fine-grained deposits on coastal zones and continental shelves are important because of the association with chemical pollutants, and the implication to the impact on biological processes, the stratigraphic correlations, and changes in sedimentary environments. The Yellow Sea continental shelf receives large quantities of sediment from the Huanghe (Yellow) River. Unfortunately, little attention has been yet paid to the sedimentation on the shallow shelf and its features, and the vertical sediment flux in the area is poorly understood. In this study, nine cores were collected in northern Yellow Sea by the R/V Science 1 in September, 1998 and 1999 to examine the sedimentation rate, sediment flux and the provenance with 210Pb analysis. The 210Pb activity profiles showed that the vertical sediment flux ranged from 0.06 to 1.18 g/cm2·a in the region. In central part of the area, there was a patch of fine-grained mud, with the flux below 0.33 g/cm2·a. Most profiles were featured in two-segment model. Differences in the profiles reflected spatial and temporal variations in hydrodynamic and sedimentary processes. In order to determine the provenance and sedimentary setting in the area, the geochemistry of Ca, Fe, Sr, Cu, Ti and Rb in 11 surficial sediment samples were studied, which showed that in the central northern Yellow Sea, the mud deposit was from multi-source but mainly from the Huanghe River.

  6. The Diffuse and Compact X-ray Components of the Starburst Galaxy Henize~2-10

    CERN Document Server

    Kobulnicky, Henry A

    2010-01-01

    Chandra X-ray imaging spectroscopy of the starburst galaxy Henize 2-10 reveals a strong nuclear point source and at least two fainter compact sources embedded within a more luminous diffuse thermal component. Spectral fits to the nuclear X-ray source imply an unabsorbed X-ray luminosity L_x >10^40 erg/s for reasonable power law or blackbody models, consistent with accretion onto a >50 solar mass black hole behind a foreground absorbing column of N_H>10^23 /cm^2. Two of these point sources have L_x=2-5 x 10^38 erg/s, comparable to luminous X-ray binaries. These compact sources constitute a small fraction (<16%) of the total X-ray flux from He~2-10 in the 0.3--6.0 keV band and just 31% of the X-rays in the hard 1.1--6.0 keV band which is dominated by diffuse emission. Two-temperature solar-composition plasmas (kT~0.2 keV and kT~0.7 keV) fit the diffuse X-ray component as well as single-temperature plasmas with enhanced alpha/Fe ratios. Since the observed radial gradient of the X-ray surface brightness closel...

  7. Flow stress prediction for B210P steel at hot working conditions

    Science.gov (United States)

    Jiang, Guangwei; Di, Hongshuang; Cao, Yu; Zhang, Zhongwei; Wang, Yafei; Sui, Pengfei

    2013-05-01

    Prediction of the flow stress is a significant step to optimize the hot working processes. In order to establish a proper deformation constitutive equation, the compressive deformation behavior of B210P steel was investigated at temperature from 950° to 1150° and strain rates from 0.1s-1 to 10s-1 on a Gleeble-2000 thermo-simulation machine. Based on the true stress-strain data from flow stress curves, a revised model describing the relationships of the flow stress, strain rate and temperature of B210P steel at elevated temperatures is proposed considering the effect of strain on flow stress. The activation energies have been in the range of 277.740-420.241kJ/mol for different amounts of strain. Finally, the accuracy of the developed constitutive equation has been verified using standard statistical parameters. The results confirm that the developed strain-dependent constitutive equation gives an accurate and precise estimate of the flow stress in the relevant deformation conditions.

  8. 210例乳腺癌患者的危险因素分析%Analysis of risk factors on 210 patients of breast cancer

    Institute of Scientific and Technical Information of China (English)

    柏刁; 郑伯军; 张飞云

    2013-01-01

    Objective:The aim is to analysis the breast cancer patients of Traditional Chinese Medicine Hospital of Wansheng economic and Technological Development District,to explore the related risk factors that affect the occurrence of breast cancer,provide reference for the prevention of breast cancer.Methods:A case-control study method to select January 2005-2012 January 210 cases of pathologically-confirmed breast cancer patients in our hospital(Traditional Chinese Medicine Hospital of Wansheng,Wansheng economic and Technological Development District,Chongqing)as the case group,randomly selected over the same period has been confirmed210 cases of benign breast disease patients as a control group,using a unified design questionnaire,face-to-face survey study by investigators after uniform training.Univariate analysis a single conditional logistic regression analysis,multivariate analysis using conditional logistic regression model for statistical analysis,to explore the risk factors related to the incidence of breast cancer.Results:Univariate analysis results show a high degree of cultural contact with harmful substances,occupational passive smoking,menopausal age,abortion,family history of cancer,chronic mental depression,negative life events,meat,smoked food intake more times this 9 factor is a risk factor for breast cancer; sports,late age at menarche,menstrual regularity,have children more often,breastfeeding,breastfeeding duration and vegetable intake,more often these seven factors are protective factors for breast cancer.Multivariate analysis results show that the high level of education,age at menopause,family history of cancer,negative life events,the number of meat intake is more than breast cancer risk factors; late age at menarche,menstrual regularity,breastfeeding duration,vegetables intake more than the number of protective factors.Conclusion:The number of hospital treatment of breast cancer patients was significantly increasing trend occurred with patients

  9. Beryllium-7 and lead-210 chronometry of modern soil processes: The Linked Radionuclide aCcumulation model, LRC

    Science.gov (United States)

    Landis, Joshua D.; Renshaw, Carl E.; Kaste, James M.

    2016-05-01

    Soil systems are known to be repositories for atmospheric carbon and metal contaminants, but the complex processes that regulate the introduction, migration and fate of atmospheric elements in soils are poorly understood. This gap in knowledge is attributable, in part, to the lack of an established chronometer that is required for quantifying rates of relevant processes. Here we develop and test a framework for adapting atmospheric lead-210 chronometry (210Pb; half-life 22 years) to soil systems. We propose a new empirical model, the Linked Radionuclide aCcumulation model (LRC, aka "lark"), that incorporates measurements of beryllium-7 (7Be; half-life 54 days) to account for 210Pb penetration of the soil surface during initial deposition, a process which is endemic to soils but omitted from conventional 210Pb models (e.g., the Constant Rate of Supply, CRS model) and their application to sedimentary systems. We validate the LRC model using the 1963-1964 peak in bomb-fallout americium-241 (241Am; half-life of 432 years) as an independent, corroborating time marker. In three different soils we locate a sharp 241Am weapons horizon at disparate depths ranging from 2.5 to 6 cm, but with concordant ages averaging 1967 ± 4 via the LRC model. Similarly, at one site contaminated with mercury (HgT) we find that the LRC model is consistent with the recorded history of Hg emission. The close agreement of Pb, Am and Hg behavior demonstrated here suggests that organo-metallic colloid formation and migration incorporates many trace metals in universal soil processes and that these processes may be described quantitatively using atmospheric 210Pb chronometry. The 210Pb models evaluated here show that migration rates of soil colloids on the order of 1 mm yr-1 are typical, but also that these rates vary systematically with depth and are attributable to horizon-specific processes of leaf-litter decay, eluviation and illuviation. We thus interpret 210Pb models to quantify (i) exposure

  10. European Biogenic Volatile Organic Compound emissions estimate using MEGAN v2.10

    Science.gov (United States)

    Dawoud, M.; Pozzoli, L.; Unal, A.; Kindap, T.; Poupkou, A.; Katragou, E.; Melas, D.

    2013-12-01

    Biogenic emissions estimations are essential to obtain a comprehensive understanding of both anthropogenic and biogenic contributions of the emissions. In this paper we have calculated the Biogenic Volatile Organic Compound (BVOC) emissions from vegetation over Europe using the newly developed Model of Emissions of Gases and Aerosols from Nature version 2.10 (MEGAN2.10). We performed a simulation of the entire year 2008 for a domain covering all Europe at a resolution of 30 x 30 km. The meteorological fields needed to calculate the BVOC emissions (surface temperature and shortwave radiation) were provided by a WRFv3.3 simulation (driven by NCEP/FNL global reanalysis data at 1° x 1°) and interfaced to MEGAN with MCIPv3.6. We used the global dataset provided with the MEGAN2.10 model containing the Plant Functional Types (PFT, at 0.5° x 0.5°), Leaf Area Indices (LAI, at 30s resolution) and Emission Factors (EF, at 0.01° x 0.01°). The motivation behind this study is to quantify the biogenic emissions as calculated from the new version of MEGAN over Europe for the entire annual cycle, and in second step to quantify the impact of biogenic emissions on air quality, using the Community Multiscale Air Quality model (CMAQ). Isoprene emissions comprise about half of the total global biogenic volatile organic compound (BVOC) estimated using MEGAN2.10, while all Terpenes comprise about 18% of the estimated total global BVOC emissions. Our simulations showed that Isoprene emissions are ranging from 10.7 Gg/month in December to 6572.8 Gg/month over Europe in July, while Terpenes emissions range from 38 Gg/month in January and 1598.23 Gg/month in July. Around 15 Tg/year and 5 Tg/year are estimated as total annual emissions of Isoprene and Terpenes, respectively. In comparison with a previous study using the Natural Emission Model (NEMO), for the same period and the similar domain and resolution, for July we found 70% higher Isoprene emissions and 30% lower Terpenes emissions

  11. 210Pb and 137Cs measurements in the Circum Bohai Sea coastal region: sedimentation rates and implications

    Institute of Scientific and Technical Information of China (English)

    Fu WANG; Hong WANG; Jianfen LI; Yandong PEI; Changfu FAN; Lizhu TIAN; Zhiwen SHANG; Meiyu SONG; Yan GENG

    2008-01-01

    The representative 210Pb and 137Cs age-depth profiles were selected from more than 100 sites in the Circum Bohai Sea (CBS)coastal region to examine the sedimentation rates and associated environmental changes.There are three unique 210Pbexc distribution patterns:1)ideal-decaying type,representing relatively constant sediment supply and quieter environmental setting;2)wiggling type,but with approximately equivalent amplitude,representing coarser sediments and associated stronger flow current environment;and 3) episodic-eventinfluencing type,each representing typhoon storm-influenced depositional environment.Our results also show that there is a lower sedimentation rate(ca.0.1 cm/a)in the coastal lowlands,a higher sedimentation rate(ca.0.53 cm/a)in the intertidal flat and an intermediate rate of ca.0.58 cm/a in the subtidal zone near the Huanghua Harbor.The interbedded silt layer occurring in the core sediment reveals lower 210Pb activities,indicating a discontinuous sedimentation mostly due to typhoon events which dwarfs against 210Pb and 137Cs applicability.Overall,the 210Pb and 137Cs measurements of the present study provide physical insight into the evaluation of the coastal-marine ecological environment and associated management.

  12. Polonium-210 and selenium in tissues and tissue extracts of the mussel Mytilus galloprovincialis (Gulf of Trieste).

    Science.gov (United States)

    Kristan, Urška; Planinšek, Petra; Benedik, Ljudmila; Falnoga, Ingrid; Stibilj, Vekoslava

    2015-01-01

    Marine organisms such as mussels and fish take up polonium (Po) and selenium (Se), and distribute them into different cellular components and compartments. Due to its high radiotoxicity and possible biomagnification across the marine food chain Po-210 is potentially hazardous, while selenium is an essential trace element for humans and animals. The aim of this study was to investigate and compare the presence and extractability of the elements in the mussels Mytilus galloprovincialis collected in the Gulf of Trieste. The levels of Po-210 in the samples ranged from 220 to 400 Bq kg(-1) and of Se from 2.6 to 8.2 mg kg(-1), both on a dry matter basis. Using various extraction types and conditions in water, buffer or enzymatic media, the best extractability was obtained with enzymatic extraction (Protease XIV, 1h shaking at 40 °C) and the worst by water extraction (24 h shaking at 37 °C). 90% of Po-210 and 70% of Se was extractable in the first case versus less than 10% of Po-210 and less than 40% of Se in the second. Such evident differences in extractability between the investigated elements point to different metabolic pathways of the two elements. In enzymatic extracts Se speciation revealed three Se compounds (SeCys2, SeMet, one undefined), while Po-210 levels were too low to allow any conclusions about speciation.

  13. Multipolarity of the 2-→1- , ground-state transition in 210Bi via multivariable angular correlation analysis

    Science.gov (United States)

    Cieplicka-Oryńczak, N.; Szpak, B.; Leoni, S.; Fornal, B.; Bazzacco, D.; Blanc, A.; Bocchi, G.; Bottoni, S.; de France, G.; Jentschel, M.; Köster, U.; Mutti, P.; Simpson, G.; Soldner, T.; Ur, C.; Urban, W.

    2016-07-01

    The multipolarity of the main transition leading to the ground state in 210Bi was investigated using the angular correlations of γ rays. The analyzed γ -coincidence data were obtained from the 209Bi(n ,γ )210Bi experiment performed at Institut Laue-Langevin Grenoble at the PF1B cold-neutron facility. The EXILL (EXOGAM at the ILL) multidetector array, consisting of 16 high-purity germanium detectors, was used to detect γ transitions. The mixing ratio of the 320-keV γ ray was defined by minimizing a multivariable χΣ2 function constructed from the coefficients of angular correlation functions for seven pairs of strong transitions in 210Bi. As a result, the almost pure M 1 multipolarity of the 320-keV γ ray was obtained, with an E 2 admixture of less than 0.6% only (95% confidence limit). Based on this multipolarity the neutron-capture cross section leading to the ground state in 210Bi, that decays in turn to radiotoxic 210Po, was determined to be within the limits 21.3(9) and 21.5(9) mb. This result is important for nuclear reactor applications.

  14. Proposed systematic methodology for analysis of Pb-210 radioactivity in residues produced in Brazilian natural gas pipes; Proposicao de um modelo analitico sistematico da atividade de Pb-210 em residuos gerados em linhas de gas

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Aloisio Cordilha

    2003-11-15

    Since the 80's, the potential radiological hazards due to the handling of solid wastes contaminated with Rn-222 long-lived progeny - Pb-210 in special - produced in gas pipes and removed by pig operations have been subject of growing concern abroad our country. Nevertheless, little or no attention has been paid to this matter in the Brazilian plants up to now, being these hazards frequently underestimated or even ignored. The main purpose of this work was to propose a systematic methodology for analysis of Pb-210 radioactivity in black powder samples from some Brazilian plants, through the evaluation of direct Pb-210 gamma spectrometry and Bi-210 beta counting technical viabilities. In both cases, one in five samples of black powder analysed showed relevant activity (above 1Bq/kg) of Pb-210, being these results probably related to particular features of each specific plant (production levels, reservoir geochemical profile, etc.), in such a way that a single pattern is not observed. For the proposed methodology, gamma spectrometry proved to be the most reliable technique, showing a 3.5% standard deviation, and, for a 95% confidence level, overall fitness in the range of Pb-210 concentration of activity presented in the standard sample reference sheet, provided by IAEA for intercomparison purposes. In the Brazilian scene, however, the availability of statistically supported evidences is insufficient to allow the potential radiological hazard due to the management of black powder to be discarded. Thus, further research efforts are recommended in order to detect the eventually critical regions or plants where gas exploration, production and processing practices will require a regular program of radiological surveillance, in the near future. (author)

  15. Radiation dose estimation due Pb-210 incorporation in inhabitants from Recife/PE, Brazil; Estimacao da dose de radiacao por incorporacao de Pb-210 nos ossos de habitantes de Recife/Pernambuco, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Costa Junior, C.E.O.; Silva, E.B.; Santos Junior, J.A., E-mail: oliveiracosta@msn.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Energia Nuclear. Grupo de Radioprotecao e Radioecologia; Silva, C.M. [Universidade de Pernambuco (UPE), Recife, PE (Brazil). Departamento de Matematica

    2013-08-15

    {sup 210}Pb is an element widely distributed in the environment and when it is ingested by humans through air, water and food can cause various diseases including cancer because it is deposited in bones. Studies about assessment of the dose due to incorporation of {sup 210}Pb using the urine samples of volunteers from Recife are scarce. Thus, the purpose of this research was to estimate the radiation dose in bones of inhabitants from Recife (PE-Brazil) by incorporation of this radionuclide. For this, the concentration of {sup 210}Pb present in urine samples was determinate from 11 healthy and nonsmoker subjects. The urine samples were collected for a period of 24 hours following the procedures adopted by Instituto de Radioprotecao e Dosimetria. Pb-210 was separated by ion exchange resin technique. In this method, the {sup 210}Pb was precipitated in form of PbCrO{sub 4} followed by beta counting, which were conducted in a Canberra Tennelec S5E detector. To estimate radiation dose in bones it was adopted values of retention and excretion of activity from IAEA-37. Concentrations of {sup 210}Pb in the urine samples of inhabitants from Recife varied from 82 to 712 mBq.l{sup -1}. The maximum annual dose estimated in bones for individuals from Recife was about 2.15 nSv.y{sup -1}. This value is below from the recommended dose limit for member of the general public, which corresponding to 1 mSv.a{sup -1}, representing a negligible risk for the population studied. (author)

  16. MicroRNA-210 Modulates Endothelial Cell Response to Hypoxia and Inhibits the Receptor Tyrosine Kinase Ligand Ephrin-A3*S⃞

    Science.gov (United States)

    Fasanaro, Pasquale; D'Alessandra, Yuri; Di Stefano, Valeria; Melchionna, Roberta; Romani, Sveva; Pompilio, Giulio; Capogrossi, Maurizio C.; Martelli, Fabio

    2008-01-01

    MicroRNAs (miRNAs) are small non-protein-coding RNAs that function as negative gene expression regulators. In the present study, we investigated miRNAs role in endothelial cell response to hypoxia. We found that the expression of miR-210 progressively increased upon exposure to hypoxia. miR-210 overexpression in normoxic endothelial cells stimulated the formation of capillary-like structures on Matrigel and vascular endothelial growth factor-driven cell migration. Conversely, miR-210 blockade via anti-miRNA transfection inhibited the formation of capillary-like structures stimulated by hypoxia and decreased cell migration in response to vascular endothelial growth factor. miR-210 overexpression did not affect endothelial cell growth in both normoxia and hypoxia. However, anti-miR-210 transfection inhibited cell growth and induced apoptosis, in both normoxia and hypoxia. We determined that one relevant target of miR-210 in hypoxia was Ephrin-A3 since miR-210 was necessary and sufficient to down-modulate its expression. Moreover, luciferase reporter assays showed that Ephrin-A3 was a direct target of miR-210. Ephrin-A3 modulation by miR-210 had significant functional consequences; indeed, the expression of an Ephrin-A3 allele that is not targeted by miR-210 prevented miR-210-mediated stimulation of both tubulogenesis and chemotaxis. We conclude that miR-210 up-regulation is a crucial element of endothelial cell response to hypoxia, affecting cell survival, migration, and differentiation. PMID:18417479

  17. RP-HPLC法测定抗癌新药WF210的含量和有关物质%Determination of New Anticancer Drug WF210 and Its Related Substances by RP-HPLC

    Institute of Scientific and Technical Information of China (English)

    王曼曼; 霍艳双; 李清; 崔红霞; 陈晓辉; 毕开顺

    2012-01-01

    OBJECTIVE: To establish a method for the content determination of new anticancer drug WF210 and its related substances. METHODS: RP-HPLC method was adopted. The determination was performed on Diamonsil C18 column with mobile phase consisted of acetonitrile-methanol-water(60:20:20)at the flow rate of 1.0 mL·min-1. UV detection wavelength was set at 238 nm and column temperature was 30 ℃. RESULTS: The linear range of WF210 was 5.045~50.45 μg·mL-1 (r=0.999 8) with an average recovery of 100.0% (RSD=0.5%). The related substances of WF210 could be completely separated from WF210. The limit of detection was 0.8 ng. CONCLUSION: The method is simple, accurate and reproducible for the content determination of WF210 and its related substances.%目的:建立测定抗癌新药乙酰肼类化合物WF210的含量及有关物质的方法.方法:采用反相高效液相色谱法.色谱柱为DiamonsilC18,流动相为乙腈-甲醇-水(60:20:20),流速为1.0mL·min-1,紫外检测波长为238nm,柱温为30℃.结果:WF210检测浓度线性范围为5.045~50.45 μg·mL-1(r=0.9998),平均回收率为100.0% (RSD=0.5%);主成分与其有关物质分离良好,检测限为0.8 ng.结论:该方法简便、准确、重复性好,可用于WF210的含量测定和有关物质的检查.

  18. 东北四海龙湾玛珥湖沉积物纹层计年与137Cs、210Pb测年%VARVECHRONOLOGY AND RADIOMETRIC DATING (137Cs,210Pb)FROM THE SIHAILONGWAN MAAR,NORTHEASTERN CHINA

    Institute of Scientific and Technical Information of China (English)

    储国强; 顾兆炎; 许冰; 刘强; 孙青; 汉景泰; 刘嘉麒

    2005-01-01

    对东北四海龙湾玛珥湖SHL-F6孔纹层沉积物的137Cs放射性测量表明:137Cs比活度的最大值出现在5.5cm处,对应于1963年世界原子弹试爆高峰期.纹层计年表明0~6cm共有35个纹层层偶.从7.5cm到6.5cm,137Cs比活度从2.56±0.09dpm/g急剧增加到18.68±0.17dpm/g,可能6.5cm对应于1954年.通过测量226Ra子核214Pb和214Bi(能量为295keV,352keV和609keV)放射的光子数获得226Ra比活度数据,然后求得过剩210Pb比活度(210Pbuns). 210Pbuns比活度随深度增加而呈指数衰减,其异常波动可能与人类活动以及沉积速率变化有关,例如5.5cm处210Pb比活度较高,与137Cs的峰值对应,这可能与1963年前后人工核实验的高峰有关,因为核试验不仅产生137Cs,而且可以产生208Pb和210Pb; 4.5cm处210Pb比活度较低,而226Ra较高,可能与人类活动加剧,导致沉积速率增加有关.根据210PbunsCRS模式, SHL-F6孔0~19cm的平均沉积速率为20mg/cm2 · a,或约为0.11cm/a.210Pb测年数据与137Cs时标及纹层计年均有很好的一致性.四海龙湾玛珥湖发育的纹层为年纹层,可以建立高分辨率时间序列.

  19. Measurement of 210Po atoms content in glass as an indicator of long-term exposure to radon.

    Science.gov (United States)

    Jankowski, J; Olszewski, J; Skubalski, J

    1999-01-01

    Measurements of exposure to radon are performed using numerous research methods which register either temporary or periodic radon concentrations. The method presented below allows for the estimation of average radon concentration in the past. This is possible due to indirect measurement of the contents of 210Pb embedded in glass structure. The half-life of 210Pb is about 22 years. A number of exposures of window glass to radon have been carried out in laboratory conditions (radon chamber) and the obtained results were used to calculate the coefficient that renders it possible to define global indoor exposure to radon. The registration was made using a track detector CR-39, which records alpha particles resulting from the disintegration of 210Po, one of 222Rn decay products.

  20. Releases of phosphate fertilizer industry in the surrounding environment: investigation on heavy metals and polonium-210 in soil.

    Science.gov (United States)

    Aoun, M; El Samrani, A G; Lartiges, B S; Kazpard, V; Saad, Z

    2010-01-01

    Distribution of Cu, Zn, Pb, Cr, Ni, Mn concentrations and the activity of polonium-210 in the surrounding area of a phosphate fertilizer industry located on the eastern coast of the Mediterranean Sea has been determined. Nineteen sampling sites were distributed around the industrial zone on a surface area of about 100,000 m2. Atomic absorption spectroscopy and Alpha spectroscopy were used to quantify the heavy elements and polonium-210, respectively. Investigation on a particle scale was conducted by TEM and SEM coupled to EDX and X-ray cartography to determine the nature of heavy elements carriers and their distribution. Heavy elements were mainly concentrated inside the particle size fraction Polonium-210 with an enrichment factor of about 56, showed the same behavior of the spatial distribution of the trace elements.